HHsearch alignment for GI: 254780254 and conserved domain: PRK09203

>PRK09203 rplP 50S ribosomal protein L16; Reviewed.
Probab=100.00  E-value=0  Score=375.71  Aligned_cols=137  Identities=63%  Similarity=1.005  Sum_probs=134.9

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHCCEEECCCEEECHHHHHHHHHHHHHHCCCCCEEEEEECCCCEEEEECCC
Q ss_conf             98887755106789897234778753121310327405313259999999999997426784689875498607862154
Q gi|254780254|r    2 LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKRAGRVWICVFPDVPVTAKPTE   81 (138)
Q Consensus         2 ml~Pk~~KyrK~~kgr~~g~~~~~~~l~fG~yGL~a~e~g~it~~qiEaaR~~i~R~lkk~gkiwirv~P~~pvTkKp~e   81 (138)
T Consensus         1 mL~PKrtKyrK~~kgr~~g~~~~g~~l~fG~yGL~ale~g~it~~qiEa~R~~i~R~lkr~gk~wirifP~~pvTkKp~e   80 (138)
T PRK09203          1 MLQPKRTKYRKQHKGRNRGLAKRGNTVSFGEFGLKALERGRITARQIEAARRAMTRHIKRGGKVWIRIFPDKPITKKPAE   80 (138)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCEECCCCEEEEECCCCEECHHHHHHHHHHHHHHHCCCCEEEEEECCCCCEECCCCC
T ss_conf             98887675123457888876777888711412457761770669999999999998741176189996798541217632


Q ss_pred             CCCCCCCCCCCEEEEEECCCEEEEEECCCCHHHHHHHHHHHHHHCCCEEEEEEEECC
Q ss_conf             400144788110699832150899974979999999999985438951799998629
Q gi|254780254|r   82 VRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRLGAAKLSVVTKFIQRVVE  138 (138)
Q Consensus        82 ~RMGkGKG~~~~wv~~Vk~G~ilfEi~gi~~~~a~~al~~a~~KLP~k~k~i~k~~~  138 (138)
T Consensus        81 ~RMGkGKG~~~~wv~~Vk~G~IlfEi~gv~~~~a~~al~~a~~KLP~ktk~I~r~~~  137 (138)
T PRK09203         81 VRMGKGKGSPEYWVAVVKPGRILFEIAGVSEELAREALRLAAAKLPIKTKFVKRGEE  137 (138)
T ss_pred             CCCCCCCCCHHHEEEEECCCCEEEEECCCCHHHHHHHHHHHHHHCCCCEEEEECCCC
T ss_conf             657789898557799967995899967999999999999998638974799972577