HHsearch alignment of GI: 254780254 and MMDB domain: 3bbo_O_

>3bbo_O (O:) Ribosomal protein L16; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea}
Probab=100.00  E-value=0  Score=313.60  Aligned_cols=134  Identities=51%  Similarity=0.966  Sum_probs=132.9

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHCCEEECCCEEECHHHHHHHHHHHHHHCCCCCEEEEEECCCCEEEEECCC
Q ss_conf             98887755106789897234778753121310327405313259999999999997426784689875498607862154
Q gi|254780254|r    2 LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKRAGRVWICVFPDVPVTAKPTE   81 (138)
Q Consensus         2 ml~Pk~~KyrK~~kgr~~g~~~~~~~l~fG~yGL~a~e~g~it~~qiEaaR~~i~R~lkk~gkiwirv~P~~pvTkKp~e   81 (138)
                      ||+||+++|+|+|++++.|.++++++|.||+|||+|+|+++|+++|||++|++|+|++++.+++|+++|||+|+|+||+|
T Consensus         1 ml~Pkr~k~~k~~k~ri~g~~~~~~~l~~g~~gL~a~e~g~i~~~~lEaaR~~i~r~l~~~~~~~~~~~p~~~vT~k~~~   80 (135)
T 3bbo_O            1 MLSPKRTRFRKQHRGRMKGISYRGNRICFGRYALQALEPAWITSRQIEAGRRAMTRNARRGGKIWVRIFPDKPVTVRPAE   80 (135)
T ss_dssp             CCCCCCCCCCCCCCCCCCCTTSCCCCCCSSSEEEEESSCCCCCHHHHHHHHHHHHHTTCSSSCCCCCCCCCSCCCCCCSS
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCEEEECCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCCEEEEEECCCCCEEECCHH
T ss_conf             98887552125458988775778888742326779833773348899999999997401387799983598224744201


Q ss_pred             CCCCCCCCCCCEEEEEECCCEEEEEECCCCHHHHHHHHHHHHHHCCCEEEEEEE
Q ss_conf             400144788110699832150899974979999999999985438951799998
Q gi|254780254|r   82 VRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRLGAAKLSVVTKFIQR  135 (138)
Q Consensus        82 ~RMGkGKG~~~~wv~~Vk~G~ilfEi~gi~~~~a~~al~~a~~KLP~k~k~i~k  135 (138)
                      +|||+|||+|+||||+|++|+||||++++++++|++||++|++|||++|+||.+
T Consensus        81 ~rMG~GKG~~~~~~arVk~G~iifEi~~~~~~~a~~al~~a~~KLp~~~~iv~k  134 (135)
T 3bbo_O           81 TRMGSGKGSPEYWVAVVKPGRILYEISGVAENIARRAVAIAASKMPIRTQFIIS  134 (135)
T ss_dssp             CCSSCCCSCSSCCCCCCCTTCEEEEECSSCTTHHHHHHHHHHHHCSSCEEEECC
T ss_pred             CCCCCCCCCCEEEEEEECCCCEEEEECCCCHHHHHHHHHHHHHHCCCCEEEEEC
T ss_conf             235799988716899864891899965999999999999998728960899964