BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780254|ref|YP_003064667.1| 50S ribosomal protein L16
[Candidatus Liberibacter asiaticus str. psy62]
         (138 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done



>gi|20808653|ref|NP_623824.1| 50S ribosomal protein L16 [Thermoanaerobacter tengcongensis MB4]
 gi|81590581|sp|Q8R7W1|RL16_THETN RecName: Full=50S ribosomal protein L16
 gi|20517287|gb|AAM25428.1| Ribosomal protein L16/L10E [Thermoanaerobacter tengcongensis MB4]
          Length = 144

 Score =  212 bits (541), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 73/135 (54%), Positives = 95/135 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY KQ +GRIKG A  G+ + +G + L+A E   I +++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKYRKQQRGRIKGNATRGNTLTYGEYGLQALEPGWITATQIEAARVAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT KP E RMG GKG+ E WV  VKPGR+LFEI GVSE+VA+ A RL
Sbjct: 61  GGKVWIKIFPDKPVTKKPAETRMGSGKGSPEFWVAVVKPGRVLFEIGGVSEDVAKEALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL + TKF++R 
Sbjct: 121 AMHKLPIKTKFLKRE 135


>gi|307267007|ref|ZP_07548523.1| ribosomal protein L16 [Thermoanaerobacter wiegelii Rt8.B1]
 gi|326390654|ref|ZP_08212209.1| ribosomal protein L16 [Thermoanaerobacter ethanolicus JW 200]
 gi|306917992|gb|EFN48250.1| ribosomal protein L16 [Thermoanaerobacter wiegelii Rt8.B1]
 gi|325993332|gb|EGD51769.1| ribosomal protein L16 [Thermoanaerobacter ethanolicus JW 200]
          Length = 144

 Score =  212 bits (541), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 74/135 (54%), Positives = 95/135 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY KQ +GRIKG A  G+ + +G + L+A E   I +++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKYRKQQRGRIKGNATRGNTLTYGEYGLQALEPGWITATQIEAARVAMTRFIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT KP E RMG GKG+ E WV  VKPGR+LFEI GVSEEVA+ A RL
Sbjct: 61  GGKVWIKIFPDKPVTKKPAETRMGSGKGSPEFWVAVVKPGRVLFEIGGVSEEVAKEALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL + TKF++R 
Sbjct: 121 AMHKLPIKTKFLKRE 135


>gi|167039527|ref|YP_001662512.1| 50S ribosomal protein L16 [Thermoanaerobacter sp. X514]
 gi|256752639|ref|ZP_05493491.1| ribosomal protein L16 [Thermoanaerobacter ethanolicus CCSD1]
 gi|300915222|ref|ZP_07132537.1| ribosomal protein L16 [Thermoanaerobacter sp. X561]
 gi|307725146|ref|YP_003904897.1| 50S ribosomal protein L16 [Thermoanaerobacter sp. X513]
 gi|226712368|sp|B0K5Q0|RL16_THEPX RecName: Full=50S ribosomal protein L16
 gi|166853767|gb|ABY92176.1| ribosomal protein L16 [Thermoanaerobacter sp. X514]
 gi|256748459|gb|EEU61511.1| ribosomal protein L16 [Thermoanaerobacter ethanolicus CCSD1]
 gi|300888946|gb|EFK84093.1| ribosomal protein L16 [Thermoanaerobacter sp. X561]
 gi|307582207|gb|ADN55606.1| ribosomal protein L16 [Thermoanaerobacter sp. X513]
          Length = 144

 Score =  211 bits (539), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 74/135 (54%), Positives = 95/135 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY KQ +GRIKG A  G+ + +G + L+A E   I +++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKYRKQQRGRIKGNATRGNTLTYGEYGLQALEPGWITATQIEAARVAMTRFIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT KP E RMG GKG+ E WV  VKPGR+LFEI GVSEEVA+ A RL
Sbjct: 61  GGKVWIKIFPDKPVTKKPAETRMGSGKGSPEFWVAVVKPGRVLFEIAGVSEEVAKEALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL + TKF++R 
Sbjct: 121 AMHKLPIKTKFLKRE 135


>gi|167036808|ref|YP_001664386.1| 50S ribosomal protein L16 [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|320115230|ref|YP_004185389.1| 50S ribosomal protein L16 [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
 gi|226712367|sp|B0KCK7|RL16_THEP3 RecName: Full=50S ribosomal protein L16
 gi|166855642|gb|ABY94050.1| ribosomal protein L16 [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|319928321|gb|ADV79006.1| ribosomal protein L16 [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
          Length = 144

 Score =  211 bits (538), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 74/135 (54%), Positives = 95/135 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY KQ +GRIKG A  G+ + +G + L+A E   I +++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKYRKQQRGRIKGNATRGNTLTYGEYGLQALEPGWITATQIEAARVAMTRFIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT KP E RMG GKG+ E WV  VKPGR+LFEI GVSEEVA+ A RL
Sbjct: 61  GGKVWIKIFPDKPVTKKPAETRMGSGKGSPEFWVAVVKPGRVLFEIAGVSEEVAKEALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL + TKF++R 
Sbjct: 121 AMHKLPIKTKFLKRE 135


>gi|125975391|ref|YP_001039301.1| 50S ribosomal protein L16 [Clostridium thermocellum ATCC 27405]
 gi|256005322|ref|ZP_05430288.1| ribosomal protein L16 [Clostridium thermocellum DSM 2360]
 gi|281419353|ref|ZP_06250368.1| ribosomal protein L16 [Clostridium thermocellum JW20]
 gi|166234574|sp|A3DJH9|RL16_CLOTH RecName: Full=50S ribosomal protein L16
 gi|125715616|gb|ABN54108.1| LSU ribosomal protein L16P [Clostridium thermocellum ATCC 27405]
 gi|255990758|gb|EEU00874.1| ribosomal protein L16 [Clostridium thermocellum DSM 2360]
 gi|281406973|gb|EFB37236.1| ribosomal protein L16 [Clostridium thermocellum JW20]
 gi|316939507|gb|ADU73541.1| ribosomal protein L16 [Clostridium thermocellum DSM 1313]
          Length = 145

 Score =  211 bits (538), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 74/137 (54%), Positives = 95/137 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ K  +GR+KGVA  G+++  G++ L+A E   I S++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKHRKVQRGRMKGVATRGNKVVHGDYGLQALEPAWITSNQIEAARIAMTRFIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT KP E RMG GKG+ E WV  VKPGR+LFEI GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPDKPVTKKPAETRMGSGKGSPEYWVAVVKPGRVLFEIAGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
              KL +  KF+ R  E
Sbjct: 121 AMHKLPIKCKFVAREDE 137


>gi|302388719|ref|YP_003824540.1| LSU ribosomal protein L16P [Thermosediminibacter oceani DSM 16646]
 gi|302199347|gb|ADL06917.1| LSU ribosomal protein L16P [Thermosediminibacter oceani DSM 16646]
          Length = 144

 Score =  211 bits (538), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 72/135 (53%), Positives = 93/135 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY KQ +G I+G A  G+ + +G + L+A E   I SS+IEAAR AI+R +KR
Sbjct: 1   MLMPKRVKYRKQQRGTIRGKATRGTEVTYGEYGLQALEPAWITSSQIEAARIAITRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT KP E RMG GKG+ E WV  VKPGR+LFE+ GVSEEVA+ A  L
Sbjct: 61  GGKVWIKIFPDKPVTKKPAETRMGSGKGSPEYWVAVVKPGRVLFELAGVSEEVAKEALTL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL + TK ++R 
Sbjct: 121 ASHKLPIKTKIVKRE 135


>gi|289579135|ref|YP_003477762.1| ribosomal protein L16 [Thermoanaerobacter italicus Ab9]
 gi|297545322|ref|YP_003677624.1| ribosomal protein L16 [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
 gi|289528848|gb|ADD03200.1| ribosomal protein L16 [Thermoanaerobacter italicus Ab9]
 gi|296843097|gb|ADH61613.1| ribosomal protein L16 [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
          Length = 144

 Score =  211 bits (537), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 72/135 (53%), Positives = 95/135 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY KQ +GRIKG A  G+ + +G + L+A E   I +++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKYRKQQRGRIKGNATRGNTLTYGEYGLQALEPGWITATQIEAARVAMTRFIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT KP E RMG GKG+ E WV  VKPGR+LFEI GVSE++A+ A RL
Sbjct: 61  GGKVWIKIFPDKPVTKKPAETRMGSGKGSPEFWVAVVKPGRVLFEIGGVSEDIAKEALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL + TKF++R 
Sbjct: 121 AMHKLPIKTKFLKRQ 135


>gi|307154835|ref|YP_003890219.1| 50S ribosomal protein L16 [Cyanothece sp. PCC 7822]
 gi|306985063|gb|ADN16944.1| ribosomal protein L16 [Cyanothece sp. PCC 7822]
          Length = 139

 Score =  210 bits (536), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 78/137 (56%), Positives = 99/137 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ KQ +GR+KG+A  GS I FG++ L+A E   I S +IEAARRAI+R ++R
Sbjct: 1   MLSPKRTKFRKQQRGRMKGLATRGSTIDFGDYGLQATEPCWITSRQIEAARRAITRYVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVT +P E RMG GKG+ E WV  VKPGRI+FEI GVSEE+AR A RL
Sbjct: 61  GGKIWIRIFPDKPVTMRPAETRMGSGKGSPEFWVAVVKPGRIMFEIAGVSEEIAREAMRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            A KL + TKF+ R  E
Sbjct: 121 AAQKLPIKTKFVGREEE 137


>gi|260893365|ref|YP_003239462.1| ribosomal protein L16 [Ammonifex degensii KC4]
 gi|260865506|gb|ACX52612.1| ribosomal protein L16 [Ammonifex degensii KC4]
          Length = 151

 Score =  210 bits (535), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 71/135 (52%), Positives = 95/135 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QP+  KY K  +GR+KG AKG + + FG++ L+A E + I + +IEAAR AI+R ++R
Sbjct: 1   MLQPRKVKYRKHHRGRMKGKAKGATTLHFGDYGLQALEPSWITARQIEAARVAITRHLRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVTAKP E RMG GKG+   WV  VKPGRILFE+ GV EEVA  A RL
Sbjct: 61  GGKVWIRIFPDKPVTAKPAETRMGSGKGSPAYWVAVVKPGRILFEVAGVPEEVALEALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL + T+ ++R 
Sbjct: 121 ASHKLPIDTRIVKRE 135


>gi|218440630|ref|YP_002378959.1| 50S ribosomal protein L16 [Cyanothece sp. PCC 7424]
 gi|226710709|sp|B7KHZ4|RL16_CYAP7 RecName: Full=50S ribosomal protein L16
 gi|218173358|gb|ACK72091.1| ribosomal protein L16 [Cyanothece sp. PCC 7424]
          Length = 139

 Score =  209 bits (533), Expect = 9e-53,   Method: Composition-based stats.
 Identities = 76/137 (55%), Positives = 99/137 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+ TK+ KQ +GR+KG+A  G+ I FG+F L+A E   I S +IEAARRAI+R ++R
Sbjct: 1   MLSPRRTKFRKQQRGRMKGLASRGNTINFGDFGLQATEPCWITSRQIEAARRAITRYVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T +P E RMG GKG+ E WV  VKPGRI+FEI GVSEE+AR A RL
Sbjct: 61  GGKIWIRIFPDKPITMRPAETRMGSGKGSPEFWVAVVKPGRIMFEIAGVSEEIAREAMRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            A KL + TKF+ R  E
Sbjct: 121 AAQKLPIKTKFVGREEE 137


>gi|304315947|ref|YP_003851092.1| ribosomal protein L16 [Thermoanaerobacterium thermosaccharolyticum
           DSM 571]
 gi|302777449|gb|ADL68008.1| ribosomal protein L16 [Thermoanaerobacterium thermosaccharolyticum
           DSM 571]
          Length = 144

 Score =  208 bits (531), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 73/134 (54%), Positives = 95/134 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY KQ +GRIKG A  G+ + +G++ L+A E   I + +IEAAR A++R +KR
Sbjct: 1   MLMPKRVKYRKQQRGRIKGNATRGNTLSYGDYGLQALEGGWITAVQIEAARVAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT KP E RMG GKG+ E WV  VKPGR+LFEI GV+E++AR A RL
Sbjct: 61  GGKVWIKIFPDKPVTEKPAETRMGSGKGSPEYWVAVVKPGRVLFEIAGVNEDIAREALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL + TKFI+R
Sbjct: 121 AKHKLPIKTKFIKR 134


>gi|313903144|ref|ZP_07836538.1| LSU ribosomal protein L16P [Thermaerobacter subterraneus DSM 13965]
 gi|313466646|gb|EFR62166.1| LSU ribosomal protein L16P [Thermaerobacter subterraneus DSM 13965]
          Length = 143

 Score =  208 bits (530), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 72/136 (52%), Positives = 94/136 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQ +GR++GVA+ G+ + FG + L+A E   I   +IEAAR A++R ++R
Sbjct: 1   MLMPKRVKWRKQHRGRMRGVAQRGNTVTFGEYGLQALERGWITDRQIEAARVAMTRYIRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT KP E RMG GKG+ E WV  VKPGR+LFEI GV EE AR A RL
Sbjct: 61  GGKVWIKIFPDKPVTKKPAETRMGSGKGSPEYWVAVVKPGRVLFEIAGVPEETAREAMRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            + KL + TKF+ R V
Sbjct: 121 ASHKLPIKTKFVARAV 136


>gi|317123090|ref|YP_004103093.1| 50S ribosomal protein L16P [Thermaerobacter marianensis DSM 12885]
 gi|315593070|gb|ADU52366.1| LSU ribosomal protein L16P [Thermaerobacter marianensis DSM 12885]
          Length = 143

 Score =  208 bits (530), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 71/136 (52%), Positives = 94/136 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQ +GR++GVA+ G+ + FG + L+A E   +   +IEAAR A++R ++R
Sbjct: 1   MLMPKRVKWRKQHRGRMRGVAQRGNTVTFGEYGLQALERGWVSDRQIEAARVAMTRYIRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT KP E RMG GKG+ E WV  VKPGR+LFEI GV EE AR A RL
Sbjct: 61  GGKVWIKIFPDKPVTKKPAETRMGSGKGSPEYWVAVVKPGRVLFEIAGVPEETAREAMRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            + KL + TKF+ R V
Sbjct: 121 ASHKLPIKTKFVTRAV 136


>gi|303240964|ref|ZP_07327475.1| ribosomal protein L16 [Acetivibrio cellulolyticus CD2]
 gi|302591550|gb|EFL61287.1| ribosomal protein L16 [Acetivibrio cellulolyticus CD2]
          Length = 145

 Score =  208 bits (529), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 73/137 (53%), Positives = 92/137 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K  K  +GR++GVA  G+ +  G+F L+A E   I S++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKRRKVQRGRMRGVATRGNTVINGDFGLQATEPAWITSNQIEAARVALTRFIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT+KP E RMG GKG+ E WV  VKPGRILFEI GV EE AR A RL
Sbjct: 61  GGKVWIKIFPDKPVTSKPAETRMGSGKGSPEYWVAVVKPGRILFEIAGVPEETAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
              KL +  KF+ R  E
Sbjct: 121 AMHKLPIKCKFVAREEE 137


>gi|323706457|ref|ZP_08118018.1| ribosomal protein L16 [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323534177|gb|EGB23967.1| ribosomal protein L16 [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 144

 Score =  208 bits (529), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 73/134 (54%), Positives = 95/134 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY KQ +GRIKG A  G+ + +G++ L+A E   I + +IEAAR A++R +KR
Sbjct: 1   MLMPKRVKYRKQQRGRIKGNATRGNTVTYGDYGLQALEGGWITAVQIEAARVAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT KP E RMG GKG+ E WV  VKPGR+LFEI GV+E+VAR A RL
Sbjct: 61  GGKVWIKIFPDKPVTEKPAETRMGSGKGSPEYWVAVVKPGRVLFEIAGVNEDVAREALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL + TKF++R
Sbjct: 121 AKHKLPIKTKFVKR 134


>gi|312135489|ref|YP_004002827.1| 50S ribosomal protein L16 [Caldicellulosiruptor owensensis OL]
 gi|311775540|gb|ADQ05027.1| ribosomal protein L16 [Caldicellulosiruptor owensensis OL]
          Length = 147

 Score =  208 bits (529), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 70/135 (51%), Positives = 91/135 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQ +GR+KG A  G+ + +G+F + A E   I S++IEAAR AISR +KR
Sbjct: 1   MLMPKRVKWRKQQRGRMKGKATRGNFVAYGDFGIMALEPGWITSNQIEAARVAISRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT KP E RMG GKG+ E WV  VKPGR++FE+ GV EEVA+ A RL
Sbjct: 61  GGKVWIKIFPDKPVTKKPAETRMGSGKGSPEYWVAVVKPGRVMFEVGGVDEEVAKEALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  K + R 
Sbjct: 121 AIHKLPIKCKIVSRE 135


>gi|28212169|ref|NP_783113.1| 50S ribosomal protein L16 [Clostridium tetani E88]
 gi|75541609|sp|Q890P5|RL16_CLOTE RecName: Full=50S ribosomal protein L16
 gi|28204613|gb|AAO37050.1| LSU ribosomal protein L16P [Clostridium tetani E88]
          Length = 147

 Score =  208 bits (529), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 69/134 (51%), Positives = 93/134 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ K  +GR+KG A  G+ I +G++ ++A E   I S++IE+AR AI+R ++R
Sbjct: 1   MLMPKRVKHRKVQRGRMKGKATRGNFIAYGDYGIQATECGWITSNQIESARIAINRYIRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVT KP E RMG GKG  E WV  VKPGR+LFE+ GV EE AR A RL
Sbjct: 61  GGKLWIKIFPDKPVTQKPAETRMGSGKGTPEYWVAVVKPGRVLFELTGVDEETAREAMRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL V TKF+++
Sbjct: 121 AAHKLPVKTKFVKK 134


>gi|254411972|ref|ZP_05025747.1| ribosomal protein L16 [Microcoleus chthonoplastes PCC 7420]
 gi|196180938|gb|EDX75927.1| ribosomal protein L16 [Microcoleus chthonoplastes PCC 7420]
          Length = 137

 Score =  208 bits (529), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 71/137 (51%), Positives = 95/137 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ KQ +GR++G A  G+ + FG+F L+A E + I + +IEA RRA++R ++R
Sbjct: 1   MLSPKRTKFRKQHRGRMRGQATRGNSLNFGDFGLQAIEPSWITARQIEAGRRAMTRYIRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD PVT +P E RMG GKG+ E WV  VKPGRIL+EI GV E +AR A RL
Sbjct: 61  GGKIWIRVFPDKPVTMRPAETRMGSGKGSPEYWVAVVKPGRILYEIAGVPEPLAREAMRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            A K  + TKF+ R  E
Sbjct: 121 AANKFPIKTKFVTREGE 137


>gi|150015050|ref|YP_001307304.1| 50S ribosomal protein L16 [Clostridium beijerinckii NCIMB 8052]
 gi|189041453|sp|A6LPR8|RL16_CLOB8 RecName: Full=50S ribosomal protein L16
 gi|149901515|gb|ABR32348.1| ribosomal protein L16 [Clostridium beijerinckii NCIMB 8052]
          Length = 144

 Score =  207 bits (528), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 67/134 (50%), Positives = 92/134 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ K  +GR+KG A  G+ + +G++ ++A     I S++IE+AR AI+R +KR
Sbjct: 1   MLMPKRVKHRKVQRGRMKGKATRGNFLAYGDYGIQALTCGWITSNQIESARIAINRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVT KP E RMG GKG+ E WV  VKPGR+LFE+ GV EE AR A RL
Sbjct: 61  GGKLWIKIFPDKPVTEKPAETRMGSGKGSPEYWVAVVKPGRVLFELSGVPEETAREAMRL 120

Query: 122 GAAKLSVVTKFIQR 135
            + KL V TKF+ +
Sbjct: 121 ASHKLPVKTKFVSK 134


>gi|302390965|ref|YP_003826785.1| 50S ribosomal protein L16P [Acetohalobium arabaticum DSM 5501]
 gi|302203042|gb|ADL11720.1| LSU ribosomal protein L16P [Acetohalobium arabaticum DSM 5501]
          Length = 144

 Score =  207 bits (528), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 68/135 (50%), Positives = 92/135 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQ +GR+KG A  G+++ FG + L+A E   I + +IEAAR A++R  KR
Sbjct: 1   MLLPKRVKHRKQQRGRMKGKATRGNKVNFGEYGLQALEPAWISNRQIEAARIALTRHAKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VW+ +FPD PVTA P E RMG GKG+ E W   VKPGRI+FEI G+ EEVA  A RL
Sbjct: 61  GGKVWVNIFPDKPVTATPAETRMGSGKGDPEYWAAVVKPGRIMFEIAGIQEEVAEEAMRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL + T+F++R 
Sbjct: 121 ASHKLPIQTRFVKRE 135


>gi|159904212|ref|YP_001551556.1| 50S ribosomal protein L16 [Prochlorococcus marinus str. MIT 9211]
 gi|226712337|sp|A9BCP0|RL16_PROM4 RecName: Full=50S ribosomal protein L16
 gi|159889388|gb|ABX09602.1| 50S ribosomal protein L16 [Prochlorococcus marinus str. MIT 9211]
          Length = 179

 Score =  207 bits (527), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 74/134 (55%), Positives = 97/134 (72%), Gaps = 2/134 (1%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ KQ +GR++GVA  G++I FG FAL+AQE   I S +IEA+RRA++R +KR
Sbjct: 1   MLSPKRTKFRKQQRGRMRGVATRGNKIAFGQFALQAQECGWITSRQIEASRRAMTRYVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDG--VSEEVARRAF 119
            G++WI +FPD PVT +P E RMG GKGN E WV  +KPGRILFE+ G  ++E +AR A 
Sbjct: 61  GGQIWIRIFPDKPVTMRPAETRMGSGKGNPEFWVAVIKPGRILFEMGGEEITESIAREAM 120

Query: 120 RLGAAKLSVVTKFI 133
           RL   KL + TKFI
Sbjct: 121 RLAQYKLPIKTKFI 134


>gi|254517477|ref|ZP_05129533.1| ribosomal protein L16 [Clostridium sp. 7_2_43FAA]
 gi|226911226|gb|EEH96427.1| ribosomal protein L16 [Clostridium sp. 7_2_43FAA]
          Length = 144

 Score =  207 bits (527), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 68/134 (50%), Positives = 93/134 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ K  +GR+KG A  G+ + +G+F ++A     I S++IE+AR AI+R ++R
Sbjct: 1   MLMPKRVKHRKVQRGRMKGKATRGNFLAYGDFGIQATTCGWITSNQIESARIAINRYIRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVT KP E RMG GKG+ E WV  VKPGR+LFE+ GV+EEVAR A RL
Sbjct: 61  GGKLWIKIFPDKPVTEKPAETRMGSGKGSPEYWVAVVKPGRVLFELSGVNEEVAREAMRL 120

Query: 122 GAAKLSVVTKFIQR 135
            + KL V  KF+ R
Sbjct: 121 ASHKLPVKCKFVTR 134


>gi|302871505|ref|YP_003840141.1| ribosomal protein L16 [Caldicellulosiruptor obsidiansis OB47]
 gi|302574364|gb|ADL42155.1| ribosomal protein L16 [Caldicellulosiruptor obsidiansis OB47]
          Length = 147

 Score =  207 bits (527), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 69/135 (51%), Positives = 91/135 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQ +GR+KG A  G+ + +G+F + A E   I S++IEAAR AI+R +KR
Sbjct: 1   MLMPKRVKWRKQQRGRMKGKATRGNFVAYGDFGIMALEPGWITSNQIEAARVAIARHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT KP E RMG GKG+ E WV  VKPGR++FE+ GV EEVA+ A RL
Sbjct: 61  GGKVWIKIFPDKPVTKKPAETRMGSGKGSPEYWVAVVKPGRVMFEVGGVDEEVAKEALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  K + R 
Sbjct: 121 AIHKLPIKCKIVSRE 135


>gi|153952868|ref|YP_001393633.1| 50S ribosomal protein L16 [Clostridium kluyveri DSM 555]
 gi|219853533|ref|YP_002470655.1| hypothetical protein CKR_0190 [Clostridium kluyveri NBRC 12016]
 gi|189041454|sp|A5N4Q4|RL16_CLOK5 RecName: Full=50S ribosomal protein L16
 gi|254799193|sp|B9DYB6|RL16_CLOK1 RecName: Full=50S ribosomal protein L16
 gi|146345749|gb|EDK32285.1| RplP [Clostridium kluyveri DSM 555]
 gi|219567257|dbj|BAH05241.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 147

 Score =  207 bits (527), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 68/134 (50%), Positives = 94/134 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ K  +GR+KG A  G+ I +G++A++A E   I +++IE+AR AI+R ++R
Sbjct: 1   MLMPKKVKHRKVQRGRMKGKATRGNSIAYGDYAIQATECAWITNNQIESARIAINRYIRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVT KP E RMG GKG+ E WV  VKPGRILFE+ GV EE AR A RL
Sbjct: 61  GGKLWIKIFPDKPVTEKPAETRMGSGKGSPEYWVAVVKPGRILFELSGVPEETAREAMRL 120

Query: 122 GAAKLSVVTKFIQR 135
            + KL + TKF+ +
Sbjct: 121 ASHKLPIKTKFVTK 134


>gi|222529723|ref|YP_002573605.1| 50S ribosomal protein L16 [Caldicellulosiruptor bescii DSM 6725]
 gi|312127233|ref|YP_003992107.1| 50S ribosomal protein L16 [Caldicellulosiruptor hydrothermalis 108]
 gi|312622052|ref|YP_004023665.1| 50S ribosomal protein L16 [Caldicellulosiruptor kronotskyensis
           2002]
 gi|312793932|ref|YP_004026855.1| 50S ribosomal protein L16 [Caldicellulosiruptor kristjanssonii
           177R1B]
 gi|312877372|ref|ZP_07737337.1| ribosomal protein L16 [Caldicellulosiruptor lactoaceticus 6A]
 gi|254799174|sp|B9MKH4|RL16_ANATD RecName: Full=50S ribosomal protein L16
 gi|222456570|gb|ACM60832.1| ribosomal protein L16 [Caldicellulosiruptor bescii DSM 6725]
 gi|311777252|gb|ADQ06738.1| ribosomal protein L16 [Caldicellulosiruptor hydrothermalis 108]
 gi|311795846|gb|EFR12210.1| ribosomal protein L16 [Caldicellulosiruptor lactoaceticus 6A]
 gi|312181072|gb|ADQ41242.1| ribosomal protein L16 [Caldicellulosiruptor kristjanssonii 177R1B]
 gi|312202519|gb|ADQ45846.1| ribosomal protein L16 [Caldicellulosiruptor kronotskyensis 2002]
          Length = 147

 Score =  206 bits (526), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 69/135 (51%), Positives = 91/135 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQ +GR+KG A  G+ + +G+F + A E   I S++IEAAR AI+R +KR
Sbjct: 1   MLMPKRVKWRKQQRGRMKGKATRGNFVAYGDFGIMALEPGWITSNQIEAARVAIARHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT KP E RMG GKG+ E WV  VKPGR++FE+ GV EEVA+ A RL
Sbjct: 61  GGKVWIKIFPDKPVTRKPAETRMGSGKGSPEYWVAVVKPGRVMFEVGGVDEEVAKEALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  K + R 
Sbjct: 121 AIHKLPIKCKIVSRE 135


>gi|291533617|emb|CBL06730.1| LSU ribosomal protein L16P [Megamonas hypermegale ART12/1]
          Length = 145

 Score =  206 bits (525), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 75/137 (54%), Positives = 97/137 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY KQF+G +KG A  G+ +  G F L+A E   I + +IEAAR A++R +KR
Sbjct: 1   MLIPKRVKYRKQFRGTMKGKAHKGNTVVHGEFGLQALEPAWITNRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVTAKP E RMG GKG+ E WV  VKPGRI+FE+ GVSEEVA+ A RL
Sbjct: 61  GGQVWIKIFPDKPVTAKPAETRMGSGKGSPEYWVAVVKPGRIMFEMGGVSEEVAKEAMRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            + KL + TKF++R V+
Sbjct: 121 ASHKLPIKTKFVKREVQ 137


>gi|154498890|ref|ZP_02037268.1| hypothetical protein BACCAP_02882 [Bacteroides capillosus ATCC
           29799]
 gi|150271730|gb|EDM98956.1| hypothetical protein BACCAP_02882 [Bacteroides capillosus ATCC
           29799]
          Length = 144

 Score =  206 bits (525), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 71/135 (52%), Positives = 91/135 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +  +GR+KG A  G+ + +G F L+A E   I S++IEAAR A++R  KR
Sbjct: 1   MLLPKRVKYRRVHRGRMKGKATRGNTVTYGEFGLQATEPAWITSNQIEAARVAMTRYTKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT KP E RMG GKG+ E WV  VKPGR++FEI GVSEEVAR A RL
Sbjct: 61  GGQVWIKIFPDKPVTEKPAETRMGSGKGSPEYWVAVVKPGRVMFEIAGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL V  K + + 
Sbjct: 121 ASHKLPVKCKIVAKE 135


>gi|83591269|ref|YP_431278.1| 50S ribosomal protein L16 [Moorella thermoacetica ATCC 39073]
 gi|115502762|sp|Q2RFQ4|RL16_MOOTA RecName: Full=50S ribosomal protein L16
 gi|83574183|gb|ABC20735.1| LSU ribosomal protein L16P [Moorella thermoacetica ATCC 39073]
          Length = 144

 Score =  206 bits (525), Expect = 8e-52,   Method: Composition-based stats.
 Identities = 72/135 (53%), Positives = 92/135 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY K  +   +G A  G+ + FG++ L+A E   I S +IEA+R A++R +KR
Sbjct: 1   MLMPKRVKYRKPHRPGTQGKATRGNEVTFGDYGLQALEPAWITSRQIEASRIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+TAKP E RMG GKG  E WV  VKPGRILFE+ GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPDTPITAKPAETRMGSGKGAPEYWVAVVKPGRILFEMAGVSEEVAREAMRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL + TKF++R 
Sbjct: 121 AAHKLPIKTKFVKRT 135


>gi|121534642|ref|ZP_01666463.1| ribosomal protein L16 [Thermosinus carboxydivorans Nor1]
 gi|121306662|gb|EAX47583.1| ribosomal protein L16 [Thermosinus carboxydivorans Nor1]
          Length = 151

 Score =  206 bits (525), Expect = 9e-52,   Method: Composition-based stats.
 Identities = 71/135 (52%), Positives = 96/135 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQF+GR+ G A  G+++  G + L A E   I + +IEAAR A++R +KR
Sbjct: 1   MLIPKRVKHRKQFRGRMTGKANKGNKVTHGQYGLVALEPAWITNRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+TAKP E RMG GKG+ E WV  VKPGR++FE+DGV+EEVA+ A RL
Sbjct: 61  GGKVWIKIFPDKPITAKPAETRMGSGKGSPEYWVAVVKPGRVMFEMDGVTEEVAKEAMRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL + TKF++R 
Sbjct: 121 AAHKLPIKTKFVKRE 135


>gi|16329934|ref|NP_440662.1| 50S ribosomal protein L16 [Synechocystis sp. PCC 6803]
 gi|2500277|sp|P73313|RL16_SYNY3 RecName: Full=50S ribosomal protein L16
 gi|1652420|dbj|BAA17342.1| 50S ribosomal protein L16 [Synechocystis sp. PCC 6803]
          Length = 139

 Score =  206 bits (525), Expect = 9e-52,   Method: Composition-based stats.
 Identities = 74/137 (54%), Positives = 101/137 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+ TK+ KQ +GR++G+A+ GS + FG++AL+A E   I S +IEAARRA++R ++R
Sbjct: 1   MLSPRRTKFRKQQRGRMRGLAERGSTLNFGDYALQATEPCWITSRQIEAARRAMTRYIRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVT +P E RMG GKG+ E WV  VKPGR++FE+ GVSEEVAR A RL
Sbjct: 61  GGKIWIRIFPDKPVTMRPAETRMGSGKGSPEYWVAVVKPGRVMFELAGVSEEVAREAMRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            A KL + TKFI R  +
Sbjct: 121 AAQKLPIKTKFISRQED 137


>gi|118443980|ref|YP_877205.1| 50S ribosomal protein L16 [Clostridium novyi NT]
 gi|166234573|sp|A0PXV3|RL16_CLONN RecName: Full=50S ribosomal protein L16
 gi|118134436|gb|ABK61480.1| ribosomal protein L16 [Clostridium novyi NT]
          Length = 147

 Score =  206 bits (525), Expect = 9e-52,   Method: Composition-based stats.
 Identities = 71/134 (52%), Positives = 94/134 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ K  +GR+KG A  G+ I +G++A++A E   + S++IEAAR AI+R +KR
Sbjct: 1   MLMPKKVKHRKVQRGRMKGKATRGNFIAYGDYAIQATECGWLTSNQIEAARIAINRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD PVT KP E RMG GKG+ E WV  VKPGR+LFE+ GV E VAR A RL
Sbjct: 61  GGKLWIKVFPDKPVTEKPAETRMGSGKGSPEYWVAVVKPGRVLFELSGVPENVAREAMRL 120

Query: 122 GAAKLSVVTKFIQR 135
            + KL + TKF+ R
Sbjct: 121 ASHKLPMKTKFVTR 134


>gi|300857239|ref|YP_003782223.1| 50S ribosomal protein L16 [Clostridium ljungdahlii DSM 13528]
 gi|300437354|gb|ADK17121.1| 50S ribosomal protein L16 [Clostridium ljungdahlii DSM 13528]
          Length = 147

 Score =  206 bits (524), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 69/134 (51%), Positives = 94/134 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ K  +GR+KG A  G+ I +G++A++A E   I +++IEAAR AI+R +KR
Sbjct: 1   MLMPKRVKHRKVQRGRMKGKATRGNFIAYGDYAIQATECAWITANQIEAARIAINRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T KP E RMG GKG+ E WV  VKPGR+LFE+ GV E VAR A RL
Sbjct: 61  GGKLWIKIFPDKPITEKPAETRMGSGKGSPEYWVAVVKPGRVLFELSGVPEPVAREAMRL 120

Query: 122 GAAKLSVVTKFIQR 135
            + KL + TKF+ R
Sbjct: 121 ASHKLPIKTKFVTR 134


>gi|326203889|ref|ZP_08193751.1| ribosomal protein L16 [Clostridium papyrosolvens DSM 2782]
 gi|325985987|gb|EGD46821.1| ribosomal protein L16 [Clostridium papyrosolvens DSM 2782]
          Length = 145

 Score =  206 bits (524), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 70/137 (51%), Positives = 89/137 (64%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ +  +GR+ G A  G+ +  G F ++A E   I S++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKHRRVHRGRMTGKATRGNFVSNGEFGIQALEPAWITSNQIEAARIAMTRFIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT KP E RMG GKG+ E WV  VKPGR+LFEI GV EE AR A RL
Sbjct: 61  GGKVWIKIFPDKPVTKKPAETRMGSGKGSPEYWVAVVKPGRVLFEIAGVPEETAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
              KL V  KF+ R  E
Sbjct: 121 AMHKLPVKCKFVTRETE 137


>gi|78043657|ref|YP_361111.1| 50S ribosomal protein L16 [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|85701219|sp|Q3A9S3|RL16_CARHZ RecName: Full=50S ribosomal protein L16
 gi|77995772|gb|ABB14671.1| ribosomal protein L16 [Carboxydothermus hydrogenoformans Z-2901]
          Length = 143

 Score =  205 bits (523), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 72/136 (52%), Positives = 95/136 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +  +  +KG AKGG+++ FG + L+A E   I S +IEAAR AISR ++R
Sbjct: 1   MLMPKRVKYRRPHRPSLKGKAKGGTQLHFGEYGLQAVEGAWITSQQIEAARVAISRYIRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T KP E RMG GKG  E WV  VKPG+I+FE+ GVSEEVAR A RL
Sbjct: 61  GGKIWINIFPDHPITRKPAETRMGSGKGAPEYWVAVVKPGKIMFELAGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            + KL + TKF++R V
Sbjct: 121 ASHKLPIKTKFVKREV 136


>gi|168187807|ref|ZP_02622442.1| ribosomal protein L16 [Clostridium botulinum C str. Eklund]
 gi|169294319|gb|EDS76452.1| ribosomal protein L16 [Clostridium botulinum C str. Eklund]
          Length = 147

 Score =  205 bits (523), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 71/134 (52%), Positives = 94/134 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ K  +GR+KG A  G+ I +G++A++A E   + S++IEAAR AI+R +KR
Sbjct: 1   MLMPKKVKHRKVQRGRMKGKATRGNFIAYGDYAIQATECGWLTSNQIEAARIAINRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD PVT KP E RMG GKG+ E WV  VKPGR+LFE+ GV E VAR A RL
Sbjct: 61  GGKLWIKVFPDKPVTEKPAETRMGSGKGSPEYWVAVVKPGRVLFELSGVPESVAREAMRL 120

Query: 122 GAAKLSVVTKFIQR 135
            + KL + TKF+ R
Sbjct: 121 ASHKLPMKTKFVTR 134


>gi|89893224|ref|YP_516711.1| 50S ribosomal protein L16 [Desulfitobacterium hafniense Y51]
 gi|115502746|sp|Q250M5|RL16_DESHY RecName: Full=50S ribosomal protein L16
 gi|89332672|dbj|BAE82267.1| 50S ribosomal protein L16 [Desulfitobacterium hafniense Y51]
          Length = 145

 Score =  205 bits (523), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 67/135 (49%), Positives = 89/135 (65%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P   K+ KQ +GR+ G A  G+ I FG + L A E   I + +IEAAR A++R +KR
Sbjct: 1   MLVPTRVKHRKQHRGRMHGKATRGNTITFGEYGLVALEPAWITNRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+TAKP E RMG GKG+ E WV  VKPGR++FE+ GV EE+A+ A RL
Sbjct: 61  GGKVWIKIFPDKPITAKPAETRMGSGKGSPEYWVAVVKPGRVMFELAGVPEEIAKEALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL V  K ++R 
Sbjct: 121 AMHKLPVKCKIVRRE 135


>gi|187935257|ref|YP_001884480.1| 50S ribosomal protein L16 [Clostridium botulinum B str. Eklund 17B]
 gi|188588061|ref|YP_001919679.1| 50S ribosomal protein L16 [Clostridium botulinum E3 str. Alaska
           E43]
 gi|251779745|ref|ZP_04822665.1| 50S ribosomal protein L16 [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
 gi|226710700|sp|B2UYB7|RL16_CLOBA RecName: Full=50S ribosomal protein L16
 gi|226710701|sp|B2TII2|RL16_CLOBB RecName: Full=50S ribosomal protein L16
 gi|187723410|gb|ACD24631.1| 50S ribosomal protein L16 [Clostridium botulinum B str. Eklund 17B]
 gi|188498342|gb|ACD51478.1| 50S ribosomal protein L16 [Clostridium botulinum E3 str. Alaska
           E43]
 gi|243084060|gb|EES49950.1| 50S ribosomal protein L16 [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
          Length = 144

 Score =  205 bits (523), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 69/134 (51%), Positives = 93/134 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ K  +GR+KG A  G+ + +G+F L+A     I S++IEAAR AI+R +KR
Sbjct: 1   MLMPKRVKHRKVQRGRMKGRATRGNFLAYGDFGLQATTCGWITSNQIEAARIAINRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVT KP E RMG GKG+ E WV  VKP R++FE+ GV+E+VAR A RL
Sbjct: 61  GGKLWIKIFPDKPVTEKPAETRMGSGKGSPEYWVAVVKPDRVVFELSGVTEDVAREAMRL 120

Query: 122 GAAKLSVVTKFIQR 135
            + KL V TKF+ R
Sbjct: 121 ASHKLPVRTKFVTR 134


>gi|86605859|ref|YP_474622.1| 50S ribosomal protein L16 [Synechococcus sp. JA-3-3Ab]
 gi|115502803|sp|Q2JV88|RL16_SYNJA RecName: Full=50S ribosomal protein L16
 gi|86554401|gb|ABC99359.1| ribosomal protein L16 [Synechococcus sp. JA-3-3Ab]
          Length = 158

 Score =  205 bits (523), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 73/134 (54%), Positives = 93/134 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY KQ +GR+KG A  G+RI FG + L A E   I + +IEA+RRA++R ++R
Sbjct: 1   MLSPKRTKYRKQQRGRMKGKATRGNRINFGEYGLVALEPAWITARQIEASRRAMARYVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVT +P E RMG GKGN E WVC VKPGRILFE+ GV E  AR A RL
Sbjct: 61  GGQIWIRIFPDKPVTQRPAETRMGSGKGNPEYWVCVVKPGRILFEMGGVPEATAREAMRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL +  KF+ +
Sbjct: 121 AAQKLPIKVKFVTK 134


>gi|146297278|ref|YP_001181049.1| 50S ribosomal protein L16 [Caldicellulosiruptor saccharolyticus DSM
           8903]
 gi|166234560|sp|A4XLS3|RL16_CALS8 RecName: Full=50S ribosomal protein L16
 gi|145410854|gb|ABP67858.1| LSU ribosomal protein L16P [Caldicellulosiruptor saccharolyticus
           DSM 8903]
          Length = 147

 Score =  205 bits (523), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 69/135 (51%), Positives = 91/135 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY KQ +GR+KG A  G+ + +G+F + A E   I S++IEAAR AI+R +KR
Sbjct: 1   MLMPKRVKYRKQQRGRMKGKATRGNFVAYGDFGIMALEPGWITSNQIEAARVAIARHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT KP E RMG GKG+ E WV  VKPGR++FE+ GV +EVA+ A RL
Sbjct: 61  GGKVWIKIFPDKPVTRKPAETRMGSGKGSPEYWVAVVKPGRVMFEVGGVDKEVAKEALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  K + R 
Sbjct: 121 AIHKLPIKCKIVSRQ 135


>gi|166368477|ref|YP_001660750.1| 50S ribosomal protein L16 [Microcystis aeruginosa NIES-843]
 gi|189041468|sp|B0JHZ6|RL16_MICAN RecName: Full=50S ribosomal protein L16
 gi|159028199|emb|CAO89806.1| rplP [Microcystis aeruginosa PCC 7806]
 gi|166090850|dbj|BAG05558.1| 50S ribosomal protein L16 [Microcystis aeruginosa NIES-843]
          Length = 139

 Score =  205 bits (522), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 76/137 (55%), Positives = 98/137 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ KQ +GR++G+A GG+ I FG+FAL+A E   I S +IEAARRA++R ++R
Sbjct: 1   MLSPKRTKFRKQQRGRMRGLATGGNTINFGDFALQATEPCWITSRQIEAARRAMTRYIRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD PVT +  E RMG GKG+ E WV  VKPG I+FEI GV+E VAR A RL
Sbjct: 61  GGKIWIRVFPDKPVTQRAAETRMGSGKGSPEFWVAVVKPGFIMFEIAGVAEPVAREAMRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            A KL + TKFI R  +
Sbjct: 121 AAQKLPIKTKFITREED 137


>gi|296131843|ref|YP_003639090.1| ribosomal protein L16 [Thermincola sp. JR]
 gi|296030421|gb|ADG81189.1| ribosomal protein L16 [Thermincola potens JR]
          Length = 144

 Score =  205 bits (522), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 78/135 (57%), Positives = 98/135 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQ KGR+KG AKGG++I FG + L+A E   I + +IEAAR A++R +KR
Sbjct: 1   MLVPKRVKHRKQQKGRMKGKAKGGTQIAFGEYGLQALEPAWITNRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+TAKP E RMG GKG+ E WV  VKPGR++FE+ GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPDKPITAKPAETRMGSGKGSPEYWVAVVKPGRVMFELAGVSEEVAREAMRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL + TKFI R 
Sbjct: 121 AAHKLPIKTKFITRQ 135


>gi|322807799|emb|CBZ05374.1| LSU ribosomal protein L16p (L10e) [Clostridium botulinum H04402
           065]
          Length = 147

 Score =  205 bits (522), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 74/134 (55%), Positives = 93/134 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K  K  +GR+KG A  G+ I +G+F ++A E   I S++IEAAR AI+R +KR
Sbjct: 1   MLMPKRVKRRKVQRGRMKGKATRGNFIAYGDFGIQATECGWITSNQIEAARIAINRYVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT KP E RMG GKG+ E WV  VKPGR+LFEI GVSE VAR A RL
Sbjct: 61  GGKVWIKIFPDKPVTEKPAETRMGSGKGSPEYWVAVVKPGRVLFEISGVSETVAREAMRL 120

Query: 122 GAAKLSVVTKFIQR 135
            + KL + TKF+ R
Sbjct: 121 ASHKLPIKTKFVTR 134


>gi|86610035|ref|YP_478797.1| 50S ribosomal protein L16 [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|115502804|sp|Q2JIM0|RL16_SYNJB RecName: Full=50S ribosomal protein L16
 gi|86558577|gb|ABD03534.1| ribosomal protein L16 [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 155

 Score =  205 bits (522), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 72/134 (53%), Positives = 94/134 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY KQ +GR+KG A  G+RI FG + L A E   I + +IEA+RRA++R ++R
Sbjct: 1   MLSPKRTKYRKQQRGRMKGKATRGNRINFGEYGLVALEPAWITARQIEASRRAMTRYVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVT +  E RMG GKGN E WVC VKPGRILFE+ GV+E +AR A RL
Sbjct: 61  GGQIWIRIFPDKPVTQRAAETRMGSGKGNPEYWVCVVKPGRILFEMGGVAEPIAREAMRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL +  KF+ +
Sbjct: 121 AAQKLPIKVKFVTK 134


>gi|209527134|ref|ZP_03275648.1| ribosomal protein L16 [Arthrospira maxima CS-328]
 gi|284053310|ref|ZP_06383520.1| 50S ribosomal protein L16 [Arthrospira platensis str. Paraca]
 gi|209492474|gb|EDZ92815.1| ribosomal protein L16 [Arthrospira maxima CS-328]
 gi|291567791|dbj|BAI90063.1| 50S ribosomal protein L16 [Arthrospira platensis NIES-39]
          Length = 139

 Score =  204 bits (521), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 76/135 (56%), Positives = 98/135 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+ TK+ KQ +GR++G A  G+ I FG+FAL+A E + I S +IEAARRA++R ++R
Sbjct: 1   MLSPRRTKFRKQQRGRMRGQATRGNNINFGDFALQALEPSWITSRQIEAARRAMTRYIRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD PVT +P E RMG GKG  E WV  VKPGRI+FEI GVSEEVAR A RL
Sbjct: 61  GGKIWIRVFPDKPVTMRPAETRMGSGKGAPEYWVAVVKPGRIMFEIAGVSEEVAREAMRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL + TKF+ R 
Sbjct: 121 ASFKLPIKTKFLTRE 135


>gi|148381414|ref|YP_001255955.1| ribosomal protein L16 [Clostridium botulinum A str. ATCC 3502]
 gi|153930985|ref|YP_001385789.1| 50S ribosomal protein L16 [Clostridium botulinum A str. ATCC 19397]
 gi|153937859|ref|YP_001389196.1| 50S ribosomal protein L16 [Clostridium botulinum A str. Hall]
 gi|153940903|ref|YP_001392827.1| 50S ribosomal protein L16 [Clostridium botulinum F str. Langeland]
 gi|168178839|ref|ZP_02613503.1| ribosomal protein L16 [Clostridium botulinum NCTC 2916]
 gi|168181871|ref|ZP_02616535.1| 50S ribosomal protein L16 [Clostridium botulinum Bf]
 gi|170756039|ref|YP_001783114.1| 50S ribosomal protein L16 [Clostridium botulinum B1 str. Okra]
 gi|170761603|ref|YP_001788814.1| 50S ribosomal protein L16 [Clostridium botulinum A3 str. Loch
           Maree]
 gi|226950926|ref|YP_002806017.1| ribosomal protein L16 [Clostridium botulinum A2 str. Kyoto]
 gi|237796935|ref|YP_002864487.1| 50S ribosomal protein L16 [Clostridium botulinum Ba4 str. 657]
 gi|166234570|sp|A7FZ62|RL16_CLOB1 RecName: Full=50S ribosomal protein L16
 gi|166234571|sp|A5I7J9|RL16_CLOBH RecName: Full=50S ribosomal protein L16
 gi|166234572|sp|A7GJ67|RL16_CLOBL RecName: Full=50S ribosomal protein L16
 gi|226710702|sp|B1IGE7|RL16_CLOBK RecName: Full=50S ribosomal protein L16
 gi|226710703|sp|B1KSL8|RL16_CLOBM RecName: Full=50S ribosomal protein L16
 gi|254799191|sp|C1FMU4|RL16_CLOBJ RecName: Full=50S ribosomal protein L16
 gi|259645642|sp|C3KVP4|RL16_CLOB6 RecName: Full=50S ribosomal protein L16
 gi|148290898|emb|CAL85034.1| 50S ribosomal protein L16 [Clostridium botulinum A str. ATCC 3502]
 gi|152927029|gb|ABS32529.1| 50S ribosomal protein L16 [Clostridium botulinum A str. ATCC 19397]
 gi|152933773|gb|ABS39272.1| 50S ribosomal protein L16 [Clostridium botulinum A str. Hall]
 gi|152936799|gb|ABS42297.1| 50S ribosomal protein L16 [Clostridium botulinum F str. Langeland]
 gi|169121251|gb|ACA45087.1| 50S ribosomal protein L16 [Clostridium botulinum B1 str. Okra]
 gi|169408592|gb|ACA57003.1| 50S ribosomal protein L16 [Clostridium botulinum A3 str. Loch
           Maree]
 gi|182670220|gb|EDT82196.1| ribosomal protein L16 [Clostridium botulinum NCTC 2916]
 gi|182674942|gb|EDT86903.1| 50S ribosomal protein L16 [Clostridium botulinum Bf]
 gi|226842095|gb|ACO84761.1| ribosomal protein L16 [Clostridium botulinum A2 str. Kyoto]
 gi|229263964|gb|ACQ54997.1| 50S ribosomal protein L16 [Clostridium botulinum Ba4 str. 657]
 gi|295320807|gb|ADG01185.1| 50S ribosomal protein L16 [Clostridium botulinum F str. 230613]
          Length = 147

 Score =  204 bits (521), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 75/134 (55%), Positives = 93/134 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K  K  +GR+KG A  G+ I +G+F ++A E   I S++IEAAR AI+R +KR
Sbjct: 1   MLMPKRVKRRKVQRGRMKGKATRGNFIAYGDFGIQATECGWITSNQIEAARIAINRYVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT KP E RMG GKG+ E WV  VKPGR+LFEI GVSE VAR A RL
Sbjct: 61  GGKVWIKIFPDKPVTEKPAETRMGSGKGSPEYWVAVVKPGRVLFEISGVSETVAREAMRL 120

Query: 122 GAAKLSVVTKFIQR 135
            + KL V TKF+ R
Sbjct: 121 ASHKLPVKTKFVTR 134


>gi|302876527|ref|YP_003845160.1| 50S ribosomal protein L16 [Clostridium cellulovorans 743B]
 gi|307687200|ref|ZP_07629646.1| 50S ribosomal protein L16 [Clostridium cellulovorans 743B]
 gi|302579384|gb|ADL53396.1| ribosomal protein L16 [Clostridium cellulovorans 743B]
          Length = 144

 Score =  204 bits (520), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 69/134 (51%), Positives = 95/134 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ K  KGR++G A  G+ I +G++A++A E   I S++IEAAR AI+R ++R
Sbjct: 1   MLMPKRVKHRKVQKGRMRGKATRGNFIAYGDYAIQATECGWITSNQIEAARIAINRYIRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T KP E RMG GKG+ E WV  VKPGR+LFE+ GV+EE AR A RL
Sbjct: 61  GGKLWIKIFPDKPITEKPAETRMGSGKGSPEYWVAVVKPGRVLFELSGVNEETAREAMRL 120

Query: 122 GAAKLSVVTKFIQR 135
            + KL + TKF+ R
Sbjct: 121 ASHKLPIKTKFVTR 134


>gi|225175667|ref|ZP_03729661.1| ribosomal protein L16 [Dethiobacter alkaliphilus AHT 1]
 gi|225168996|gb|EEG77796.1| ribosomal protein L16 [Dethiobacter alkaliphilus AHT 1]
          Length = 144

 Score =  204 bits (520), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 74/134 (55%), Positives = 94/134 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +Q +GR+KG A+ G+ I FG + L+A E   I + +IE+AR A++R +KR
Sbjct: 1   MLIPKRVKYRRQHRGRMKGKAQAGNTIAFGEYGLQALEPAWITNQQIESARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVTAKP E RMG GKG+ E WV  VKPGRILFE+ GV EE AR A RL
Sbjct: 61  GGKVWIKIFPDKPVTAKPAETRMGSGKGSPEFWVAVVKPGRILFELAGVPEETAREAMRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + TKF+ R
Sbjct: 121 AAHKLPIKTKFVMR 134


>gi|167771260|ref|ZP_02443313.1| hypothetical protein ANACOL_02618 [Anaerotruncus colihominis DSM
           17241]
 gi|167666511|gb|EDS10641.1| hypothetical protein ANACOL_02618 [Anaerotruncus colihominis DSM
           17241]
          Length = 143

 Score =  204 bits (520), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 72/137 (52%), Positives = 96/137 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +  +GR+KG A  G+++ +G+F L+A E   + S++IEAAR A++R +KR
Sbjct: 1   MLLPKRVKYRRVQRGRLKGKAMRGNKVTYGDFGLQALEPAWVTSNQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T KP E RMG GKG+ E WV  VKPGR++FEI GVSEE+AR A RL
Sbjct: 61  GGQVWIKIFPDKPITEKPAETRMGSGKGSPEYWVAVVKPGRVMFEIGGVSEELAREAMRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            A KL V  KFI +  E
Sbjct: 121 AAHKLPVKCKFIAKESE 137


>gi|220928214|ref|YP_002505123.1| 50S ribosomal protein L16 [Clostridium cellulolyticum H10]
 gi|254799192|sp|B8I7Y6|RL16_CLOCE RecName: Full=50S ribosomal protein L16
 gi|219998542|gb|ACL75143.1| ribosomal protein L16 [Clostridium cellulolyticum H10]
          Length = 145

 Score =  204 bits (520), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 70/137 (51%), Positives = 89/137 (64%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ +  +GR+ G A  G+ +  G F ++A E   I S++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKHRRVHRGRMTGKATRGNFVSNGEFGIQAMEPAWITSNQIEAARIAMTRFIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT KP E RMG GKG+ E WV  VKPGR+LFEI GV EE AR A RL
Sbjct: 61  GGKVWIKIFPDKPVTKKPAETRMGSGKGSPEYWVAVVKPGRVLFEIAGVPEETAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
              KL V  KF+ R  E
Sbjct: 121 AMHKLPVKCKFVTRETE 137


>gi|254503577|ref|ZP_05115728.1| ribosomal protein L16 [Labrenzia alexandrii DFL-11]
 gi|222439648|gb|EEE46327.1| ribosomal protein L16 [Labrenzia alexandrii DFL-11]
          Length = 137

 Score =  204 bits (520), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 87/137 (63%), Positives = 110/137 (80%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQ KGRI G++KGG+ + FG F LKA E  R+ + +IEAARRA++R MKR
Sbjct: 1   MLQPKRTKFRKQHKGRIHGLSKGGTDLNFGAFGLKALEPERVTARQIEAARRAMTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AGRVWI +FPD+PV++KP EVRMGKGKG+ + W CRVKPGRI+FEIDGVSE+VAR A RL
Sbjct: 61  AGRVWIRIFPDLPVSSKPAEVRMGKGKGSPDYWACRVKPGRIMFEIDGVSEDVAREAMRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            AAKL +  +F+QR+ E
Sbjct: 121 AAAKLPIKCRFVQRIGE 137


>gi|67923590|ref|ZP_00517062.1| Ribosomal protein L16 [Crocosphaera watsonii WH 8501]
 gi|67854560|gb|EAM49847.1| Ribosomal protein L16 [Crocosphaera watsonii WH 8501]
          Length = 139

 Score =  204 bits (520), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 73/137 (53%), Positives = 97/137 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+ TK+ KQ +GR++G+A+ GS + FG++ L+A E   I S +IEAARRA++R +KR
Sbjct: 1   MLSPRRTKFRKQQRGRMRGLARRGSTLNFGDYGLQATEPCWITSRQIEAARRAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT +  E RMG GKG+ E WV  VKPGRI+FE+ GV E VAR A RL
Sbjct: 61  GGKVWIRIFPDKPVTMRAAETRMGSGKGSPEYWVAVVKPGRIMFELSGVEEPVAREAMRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            A KL + TKF+ R  E
Sbjct: 121 AAQKLPIKTKFVTRQQE 137


>gi|240850828|ref|YP_002972228.1| 50S ribosomal protein L16 [Bartonella grahamii as4aup]
 gi|240267951|gb|ACS51539.1| 50S ribosomal protein L16 [Bartonella grahamii as4aup]
          Length = 137

 Score =  204 bits (519), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 92/137 (67%), Positives = 112/137 (81%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQFKGRI GVAKGG+ + FG + LKA E  RI + +IEAARRAI+R MKR
Sbjct: 1   MLQPKRTKFRKQFKGRIHGVAKGGTDLNFGAYGLKAVEPERITARQIEAARRAITRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           +GRVWI +FPD+PVT+KPTEVRMGKGKG+V+ W  RV PGRI+FE+DGV E+VAR A RL
Sbjct: 61  SGRVWIRIFPDLPVTSKPTEVRMGKGKGSVDYWAARVAPGRIMFELDGVPEDVAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
           GAAKL + T+FIQR+ E
Sbjct: 121 GAAKLPIKTRFIQRIAE 137


>gi|328543365|ref|YP_004303474.1| 50S ribosomal protein L16 [Polymorphum gilvum SL003B-26A1]
 gi|326413110|gb|ADZ70173.1| 50S ribosomal protein L16 [Polymorphum gilvum SL003B-26A1]
          Length = 137

 Score =  204 bits (519), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 87/137 (63%), Positives = 108/137 (78%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQ KGRI G+AKGG+ + FG + LKA E  R+ + +IEAARRA++R MKR
Sbjct: 1   MLQPKRTKFRKQHKGRIHGLAKGGTDLNFGEYGLKAVEPERVTARQIEAARRAMTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AGRVWI +FPDVPV++KP EVRMGKGKG  + W CRVKPGRI+FEIDGV E+VAR A RL
Sbjct: 61  AGRVWIRIFPDVPVSSKPAEVRMGKGKGAPDFWACRVKPGRIMFEIDGVPEDVAREAMRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            AAKL +  +F+QR+ E
Sbjct: 121 AAAKLPIKCRFVQRIAE 137


>gi|18311380|ref|NP_563314.1| 50S ribosomal protein L16 [Clostridium perfringens str. 13]
 gi|110798970|ref|YP_697087.1| 50S ribosomal protein L16 [Clostridium perfringens ATCC 13124]
 gi|110803597|ref|YP_699656.1| 50S ribosomal protein L16 [Clostridium perfringens SM101]
 gi|168205227|ref|ZP_02631232.1| ribosomal protein L16 [Clostridium perfringens E str. JGS1987]
 gi|168211898|ref|ZP_02637523.1| ribosomal protein L16 [Clostridium perfringens B str. ATCC 3626]
 gi|168215183|ref|ZP_02640808.1| ribosomal protein L16 [Clostridium perfringens CPE str. F4969]
 gi|168216638|ref|ZP_02642263.1| ribosomal protein L16 [Clostridium perfringens NCTC 8239]
 gi|169347099|ref|ZP_02866041.1| ribosomal protein L16 [Clostridium perfringens C str. JGS1495]
 gi|182626938|ref|ZP_02954671.1| ribosomal protein L16 [Clostridium perfringens D str. JGS1721]
 gi|81766491|sp|Q8XHT0|RL16_CLOPE RecName: Full=50S ribosomal protein L16
 gi|122956497|sp|Q0SQF1|RL16_CLOPS RecName: Full=50S ribosomal protein L16
 gi|123344489|sp|Q0TMQ3|RL16_CLOP1 RecName: Full=50S ribosomal protein L16
 gi|18146064|dbj|BAB82104.1| 50S ribosomal protein L16 [Clostridium perfringens str. 13]
 gi|110673617|gb|ABG82604.1| 50S ribosomal protein L16 [Clostridium perfringens ATCC 13124]
 gi|110684098|gb|ABG87468.1| 50S ribosomal protein L16 [Clostridium perfringens SM101]
 gi|169296782|gb|EDS78911.1| ribosomal protein L16 [Clostridium perfringens C str. JGS1495]
 gi|170663298|gb|EDT15981.1| ribosomal protein L16 [Clostridium perfringens E str. JGS1987]
 gi|170710175|gb|EDT22357.1| ribosomal protein L16 [Clostridium perfringens B str. ATCC 3626]
 gi|170713412|gb|EDT25594.1| ribosomal protein L16 [Clostridium perfringens CPE str. F4969]
 gi|177907728|gb|EDT70343.1| ribosomal protein L16 [Clostridium perfringens D str. JGS1721]
 gi|182381121|gb|EDT78600.1| ribosomal protein L16 [Clostridium perfringens NCTC 8239]
          Length = 144

 Score =  204 bits (519), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 70/134 (52%), Positives = 93/134 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ K  +GR+KG A  G+ + +G+F ++A     I S++IEAAR AI+R ++R
Sbjct: 1   MLMPKRVKHRKVQRGRMKGKATRGNFLAYGDFGIQATTCGWITSNQIEAARIAINRYIRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVT KP E RMG GKG+VE WV  VKPGR+LFE+ GV EE AR A RL
Sbjct: 61  GGKLWIKIFPDKPVTEKPAETRMGSGKGSVEYWVAVVKPGRVLFELSGVDEEKAREAMRL 120

Query: 122 GAAKLSVVTKFIQR 135
            + KL V TKF+ R
Sbjct: 121 ASHKLPVKTKFVTR 134


>gi|15896376|ref|NP_349725.1| 50S ribosomal protein L16 [Clostridium acetobutylicum ATCC 824]
 gi|81595892|sp|Q97EI5|RL16_CLOAB RecName: Full=50S ribosomal protein L16
 gi|15026192|gb|AAK81065.1|AE007808_18 Ribosomal protein L16 [Clostridium acetobutylicum ATCC 824]
 gi|325510532|gb|ADZ22168.1| 50S ribosomal protein L16 [Clostridium acetobutylicum EA 2018]
          Length = 147

 Score =  203 bits (518), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 72/134 (53%), Positives = 95/134 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ K  +GR+KG A  G+ I +G+FA++A E   I S++IEAAR AI+R +KR
Sbjct: 1   MLMPKRVKHRKVQRGRMKGKATRGNFIAYGDFAIQATECAWITSNQIEAARIAINRYVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVT KP E RMG GKG+ E WV  VKPGR+LFE+  V+EE AR AFRL
Sbjct: 61  GGKLWIKIFPDKPVTQKPAETRMGSGKGSPEYWVAVVKPGRVLFEMSDVTEEQAREAFRL 120

Query: 122 GAAKLSVVTKFIQR 135
            + KL + TKF+ R
Sbjct: 121 ASHKLPIKTKFVTR 134


>gi|253682185|ref|ZP_04862982.1| ribosomal protein L16 [Clostridium botulinum D str. 1873]
 gi|253561897|gb|EES91349.1| ribosomal protein L16 [Clostridium botulinum D str. 1873]
          Length = 147

 Score =  203 bits (518), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 70/134 (52%), Positives = 95/134 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ K  +GR+KG A  G+ I +G++A++A E   + S++IEAAR AI+R +KR
Sbjct: 1   MLMPKKVKHRKVQRGRMKGKATRGNFIAYGDYAIQATECGWLTSNQIEAARIAINRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD P+T KP E RMG GKG+ E WV  VKPGR+LFE+ GV+E VAR A RL
Sbjct: 61  GGKLWIKVFPDKPITEKPAETRMGSGKGSPEYWVAVVKPGRVLFELSGVAENVAREAMRL 120

Query: 122 GAAKLSVVTKFIQR 135
            + KL + TKF+ R
Sbjct: 121 ASHKLPMKTKFVTR 134


>gi|163868643|ref|YP_001609852.1| 50S ribosomal protein L16 [Bartonella tribocorum CIP 105476]
 gi|189041447|sp|A9IW18|RL16_BART1 RecName: Full=50S ribosomal protein L16
 gi|161018299|emb|CAK01857.1| 50S ribosomal protein L16 [Bartonella tribocorum CIP 105476]
          Length = 137

 Score =  203 bits (518), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 90/137 (65%), Positives = 112/137 (81%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQFKGRI GVAKGG+ + FG + LKA E  R+ + +IEAARRAI+R MKR
Sbjct: 1   MLQPKRTKFRKQFKGRIHGVAKGGTDLNFGAYGLKAVEPERVTARQIEAARRAITRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           +GRVWI +FPD+PVT+KPTEVRMGKGKG+V+ W  RV PGR++FE+DGV E+VAR A RL
Sbjct: 61  SGRVWIRIFPDLPVTSKPTEVRMGKGKGSVDYWAARVAPGRVMFELDGVPEDVAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
           GAAKL + T+FIQR+ E
Sbjct: 121 GAAKLPIKTRFIQRIAE 137


>gi|319408758|emb|CBI82415.1| 50S ribosomal protein L16 [Bartonella schoenbuchensis R1]
          Length = 137

 Score =  203 bits (518), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 90/137 (65%), Positives = 112/137 (81%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQFKGRI GVAKGG+ + FG + LKA E  RI + +IEAARRAI+R MKR
Sbjct: 1   MLQPKRTKFRKQFKGRIHGVAKGGTDLNFGAYGLKAIEPERITARQIEAARRAITRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           +GRVWI +FPD+PVT+KPTEVRMGKGKG+V+ W  RV PGR++FE+DG+ E+VAR A RL
Sbjct: 61  SGRVWIRIFPDLPVTSKPTEVRMGKGKGSVDYWAARVSPGRVMFELDGIPEDVAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
           GAAKL V T+F+QR+ E
Sbjct: 121 GAAKLPVKTRFVQRIAE 137


>gi|307694145|ref|ZP_07636382.1| 50S ribosomal protein L16 [Ruminococcaceae bacterium D16]
          Length = 143

 Score =  203 bits (518), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 72/135 (53%), Positives = 92/135 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +  +GR+KG A  G+ + +G F L A E + I S++IEAAR A++R  KR
Sbjct: 1   MLLPKRVKYRRVHRGRMKGKATRGNTVSYGEFGLMATEPSWITSNQIEAARIAMTRHTKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT KP E RMG GKG+ E WV  VKPGR++FEI GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPDKPVTEKPAETRMGSGKGSPEYWVAVVKPGRVMFEIAGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL V  K ++R 
Sbjct: 121 ASHKLPVKCKIVKRE 135


>gi|220930972|ref|YP_002507880.1| ribosomal protein L16 [Halothermothrix orenii H 168]
 gi|254799205|sp|B8D0D1|RL16_HALOH RecName: Full=50S ribosomal protein L16
 gi|219992282|gb|ACL68885.1| ribosomal protein L16 [Halothermothrix orenii H 168]
          Length = 144

 Score =  203 bits (518), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 77/135 (57%), Positives = 97/135 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY KQ +GR+ G AK G+RI FG + L+A E   I + +IEAAR AI+R +KR
Sbjct: 1   MLIPKRVKYRKQHRGRMTGKAKRGNRITFGEYGLQALEPAWITNRQIEAARVAITRSLKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVTAKP E RMG GKG  EKWV  VKPGRI+FE+ GVSEE+AR A RL
Sbjct: 61  GGKVWIKIFPDKPVTAKPAETRMGGGKGAPEKWVAVVKPGRIMFEVAGVSEELAREAIRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL + T+F++R 
Sbjct: 121 ASHKLPIKTRFVKRE 135


>gi|313904945|ref|ZP_07838316.1| ribosomal protein L16 [Eubacterium cellulosolvens 6]
 gi|313470202|gb|EFR65533.1| ribosomal protein L16 [Eubacterium cellulosolvens 6]
          Length = 142

 Score =  203 bits (517), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 72/135 (53%), Positives = 90/135 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQF+G ++G A  G+ I  G + L A E   I S++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKHRKQFRGSMRGKALRGNTISNGQYGLVALEPCWIRSNQIEAARIALTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+TAKP E RMG GKG+VE WV  VKPGR+LFEIDGV EE AR A RL
Sbjct: 61  GGKVWIKIFPDKPITAKPAETRMGSGKGSVEYWVSVVKPGRVLFEIDGVPEETAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL    K + R 
Sbjct: 121 AMHKLPCKCKIVARE 135


>gi|218245133|ref|YP_002370504.1| 50S ribosomal protein L16 [Cyanothece sp. PCC 8801]
 gi|257058158|ref|YP_003136046.1| 50S ribosomal protein L16 [Cyanothece sp. PCC 8802]
 gi|226710710|sp|B7K241|RL16_CYAP8 RecName: Full=50S ribosomal protein L16
 gi|218165611|gb|ACK64348.1| ribosomal protein L16 [Cyanothece sp. PCC 8801]
 gi|256588324|gb|ACU99210.1| ribosomal protein L16 [Cyanothece sp. PCC 8802]
          Length = 139

 Score =  203 bits (517), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 76/137 (55%), Positives = 100/137 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+ TK+ KQ +GR++G+A  GS I FG++AL+A E   I S +IEAARRA++R +KR
Sbjct: 1   MLSPRRTKFRKQQRGRMRGMAYRGSTINFGDYALQATEPCWITSRQIEAARRAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVT +P E RMG GKG+ E WV  VKPGRI+FE+DGVSE +AR A RL
Sbjct: 61  GGKIWIRIFPDKPVTMRPAETRMGSGKGSPEYWVAVVKPGRIMFELDGVSEPIAREAMRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            A KL + TKFI +  E
Sbjct: 121 AAQKLPIKTKFITKAEE 137


>gi|260886883|ref|ZP_05898146.1| ribosomal protein L16 [Selenomonas sputigena ATCC 35185]
 gi|330839319|ref|YP_004413899.1| ribosomal protein L16 [Selenomonas sputigena ATCC 35185]
 gi|260863482|gb|EEX77982.1| ribosomal protein L16 [Selenomonas sputigena ATCC 35185]
 gi|329747083|gb|AEC00440.1| ribosomal protein L16 [Selenomonas sputigena ATCC 35185]
          Length = 149

 Score =  203 bits (517), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 75/135 (55%), Positives = 94/135 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY KQF+GR+KG A  G+ +  G F L A E   I + +IEAAR A++R +KR
Sbjct: 1   MLLPKRVKYRKQFRGRMKGKAHRGNTVSHGEFGLVALEPAWITNRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVTAKP E RMG GKG+ E WVC VKPGR+LFE++GVS+EVA  A RL
Sbjct: 61  GGKVWIKIFPDKPVTAKPAETRMGSGKGSPEYWVCVVKPGRVLFEMNGVSKEVAMEAMRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL + TKF+ R 
Sbjct: 121 AGHKLPIRTKFVTRE 135


>gi|254470364|ref|ZP_05083768.1| ribosomal protein L16 [Pseudovibrio sp. JE062]
 gi|211960675|gb|EEA95871.1| ribosomal protein L16 [Pseudovibrio sp. JE062]
          Length = 137

 Score =  203 bits (517), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 89/137 (64%), Positives = 109/137 (79%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQ KGRI G AKGG+ + FG + LKA E  RI + +IEAARRA++R MKR
Sbjct: 1   MLQPKRTKFRKQHKGRIHGNAKGGTDLNFGAYGLKAMEPERITARQIEAARRAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AGRVWI +FPDVPV++KP EVRMGKGKG+ E W CRVKPGRI+FE+DGVSEE+AR A RL
Sbjct: 61  AGRVWIRIFPDVPVSSKPAEVRMGKGKGSPEYWACRVKPGRIMFEMDGVSEEIAREAMRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            AAKL +  +F+QR+ E
Sbjct: 121 AAAKLPIKCRFVQRIGE 137


>gi|218289999|ref|ZP_03494176.1| ribosomal protein L16 [Alicyclobacillus acidocaldarius LAA1]
 gi|258512663|ref|YP_003186097.1| 50S ribosomal protein L16 [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
 gi|218239984|gb|EED07171.1| ribosomal protein L16 [Alicyclobacillus acidocaldarius LAA1]
 gi|257479389|gb|ACV59708.1| ribosomal protein L16 [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
          Length = 145

 Score =  203 bits (517), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 73/135 (54%), Positives = 93/135 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY K+ +GR+KG AKGG  + FG++ L A E   + + +IEAAR A++R M+R
Sbjct: 1   MLMPKRVKYRKEHRGRLKGRAKGGRTVAFGDYGLVALEPAWVTNRQIEAARIAMTRYMRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP  PVT KP E RMG GKG+ E WV  VKPGR+LFE+ GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPSKPVTKKPAETRMGSGKGSPEMWVAVVKPGRVLFEVAGVSEEVAREAMRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL +  KF+ R 
Sbjct: 121 AAHKLPIKCKFVTRE 135


>gi|282899959|ref|ZP_06307920.1| Ribosomal protein L16 [Cylindrospermopsis raciborskii CS-505]
 gi|281195229|gb|EFA70165.1| Ribosomal protein L16 [Cylindrospermopsis raciborskii CS-505]
          Length = 141

 Score =  203 bits (517), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 78/134 (58%), Positives = 100/134 (74%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+ TK+ KQ +GR++G+A  GS + FG+FAL+AQE   I S +IEA+RRA++R ++R
Sbjct: 1   MLSPRRTKFRKQQRGRMEGLAHRGSTLNFGDFALQAQEPCWITSRQIEASRRAMTRYIRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVT +P E RMG GKGN E WV  VKPGRILFEI GVSEE+AR A RL
Sbjct: 61  GGKIWIRIFPDKPVTMRPAETRMGSGKGNPEFWVAVVKPGRILFEIAGVSEEIAREAMRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + TKFI R
Sbjct: 121 AAYKLPIKTKFIVR 134


>gi|319407419|emb|CBI81070.1| 50S ribosomal protein L16 [Bartonella sp. 1-1C]
          Length = 137

 Score =  203 bits (517), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 89/137 (64%), Positives = 111/137 (81%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQFKGRI G +KGG+ + FG + LKA E  R+ + +IEAARRAI+R MKR
Sbjct: 1   MLQPKRTKFRKQFKGRIHGSSKGGTSLNFGAYGLKAIEPERVTARQIEAARRAITRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           +GRVWI +FPDVPVT+KPTEVRMGKGKG+V+ W  RV PGR++FE+DGV E+VAR A RL
Sbjct: 61  SGRVWIRIFPDVPVTSKPTEVRMGKGKGSVDYWAARVAPGRVMFELDGVPEDVAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
           GAAKL V T+F+QR+ E
Sbjct: 121 GAAKLPVKTRFVQRISE 137


>gi|220921906|ref|YP_002497207.1| 50S ribosomal protein L16 [Methylobacterium nodulans ORS 2060]
 gi|254799210|sp|B8IS92|RL16_METNO RecName: Full=50S ribosomal protein L16
 gi|219946512|gb|ACL56904.1| ribosomal protein L16 [Methylobacterium nodulans ORS 2060]
          Length = 137

 Score =  203 bits (517), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 90/137 (65%), Positives = 110/137 (80%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQFKGRI G AKGG+ + FG++ LKA E  R+ + +IEAARRAI+R MKR
Sbjct: 1   MLQPKKTKFRKQFKGRIHGAAKGGTDLNFGSYGLKALEPERVTARQIEAARRAITREMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPDVPVT KPTEVRMG GKG+ E W  RV PGR++FEIDGV+E++AR A RL
Sbjct: 61  QGRVWIRIFPDVPVTQKPTEVRMGSGKGSPEYWAARVHPGRVMFEIDGVAEDIAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
           GAAKL V T+FIQR+V+
Sbjct: 121 GAAKLPVRTRFIQRIVD 137


>gi|297618377|ref|YP_003703536.1| ribosomal protein L16 [Syntrophothermus lipocalidus DSM 12680]
 gi|297146214|gb|ADI02971.1| ribosomal protein L16 [Syntrophothermus lipocalidus DSM 12680]
          Length = 144

 Score =  203 bits (517), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 70/135 (51%), Positives = 95/135 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY KQ +  +KG A  G+ + +G + L+A EA  I + +IEAAR AI+R +KR
Sbjct: 1   MLVPKRVKYRKQHRPSLKGKATKGNSVTYGEYGLQALEAAWITNRQIEAARVAITRHVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+TAKP E RMGKGKG+ E WV  VKPGR++FE+ GVSEEVA+ A RL
Sbjct: 61  GGKVWIKIFPDRPITAKPAETRMGKGKGSPEYWVAVVKPGRVMFELAGVSEEVAKEAMRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL +  +F++R 
Sbjct: 121 ASHKLPIKCRFVKRE 135


>gi|313895081|ref|ZP_07828638.1| ribosomal protein L16 [Selenomonas sp. oral taxon 137 str. F0430]
 gi|320529803|ref|ZP_08030880.1| ribosomal protein L16 [Selenomonas artemidis F0399]
 gi|312975976|gb|EFR41434.1| ribosomal protein L16 [Selenomonas sp. oral taxon 137 str. F0430]
 gi|320137821|gb|EFW29726.1| ribosomal protein L16 [Selenomonas artemidis F0399]
          Length = 145

 Score =  203 bits (517), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 72/135 (53%), Positives = 93/135 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY KQF+GR+KG A+ G+ +  G + L A E   I + +IEAAR A++R +KR
Sbjct: 1   MLLPKRVKYRKQFRGRMKGKAQRGNTVSHGQYGLVALEPAWITNRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVTAKP E RMG GKG+ E WV  VKPGR+LFE+DGV+ +VA  A RL
Sbjct: 61  GGKVWIKIFPDKPVTAKPAETRMGSGKGSPEYWVAVVKPGRVLFEMDGVARDVAAEAMRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL + TKF+ R 
Sbjct: 121 AGHKLPIKTKFVVRE 135


>gi|219666497|ref|YP_002456932.1| 50S ribosomal protein L16 [Desulfitobacterium hafniense DCB-2]
 gi|254799198|sp|B8G1X3|RL16_DESHD RecName: Full=50S ribosomal protein L16
 gi|219536757|gb|ACL18496.1| ribosomal protein L16 [Desulfitobacterium hafniense DCB-2]
          Length = 145

 Score =  203 bits (517), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 67/135 (49%), Positives = 89/135 (65%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P   K+ KQ +GR+ G A  G+ I FG + L A E   I + +IEAAR A++R +KR
Sbjct: 1   MLVPTRVKHRKQHRGRMHGKATRGNVITFGEYGLVAMEPAWITNRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+TAKP E RMG GKG+ E WV  VKPGR++FE+ GV EE+A+ A RL
Sbjct: 61  GGKVWIKIFPDKPITAKPAETRMGSGKGSPEYWVAVVKPGRVMFELAGVPEEIAKEALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL V  K ++R 
Sbjct: 121 AMHKLPVKCKIVRRE 135


>gi|261367796|ref|ZP_05980679.1| ribosomal protein L16 [Subdoligranulum variabile DSM 15176]
 gi|282570594|gb|EFB76129.1| ribosomal protein L16 [Subdoligranulum variabile DSM 15176]
          Length = 146

 Score =  203 bits (516), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 68/135 (50%), Positives = 90/135 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +  +GR+ G A  G+++  G++ L A E   I S++IEAAR A++R +KR
Sbjct: 1   MLLPKRVKYRRVQRGRMTGKAMRGNKVNQGDYGLIALEPAWITSNQIEAARVAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT KP   RMG GKG+ E WV  VKPGR+LFE+  VSEE AR A RL
Sbjct: 61  GGKVWIKIFPDKPVTEKPAGTRMGSGKGSPEYWVAVVKPGRVLFELADVSEETAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL V  KF++R 
Sbjct: 121 ASHKLPVRCKFVKRE 135


>gi|261409514|ref|YP_003245755.1| 50S ribosomal protein L16 [Paenibacillus sp. Y412MC10]
 gi|329922048|ref|ZP_08277841.1| ribosomal protein L16 [Paenibacillus sp. HGF5]
 gi|261285977|gb|ACX67948.1| ribosomal protein L16 [Paenibacillus sp. Y412MC10]
 gi|328942431|gb|EGG38695.1| ribosomal protein L16 [Paenibacillus sp. HGF5]
          Length = 144

 Score =  203 bits (516), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 76/135 (56%), Positives = 99/135 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQ +G ++G AKGG+ + FG F L+A E   I + +IEAAR A++R ++R
Sbjct: 1   MLVPKRVKHRKQQRGHMRGQAKGGTELNFGEFGLQATEPGWITNRQIEAARIAMTRYIRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T KP EVRMG GKGNVEKWV  VKPG+I+FE+ GVSEE+AR A RL
Sbjct: 61  GGKVWIKIFPDKPITQKPLEVRMGSGKGNVEKWVAVVKPGKIMFELGGVSEEIAREAMRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL V TKF++R 
Sbjct: 121 AAHKLPVKTKFVKRE 135


>gi|307946293|ref|ZP_07661628.1| ribosomal protein L16 [Roseibium sp. TrichSKD4]
 gi|307769957|gb|EFO29183.1| ribosomal protein L16 [Roseibium sp. TrichSKD4]
          Length = 137

 Score =  203 bits (516), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 85/137 (62%), Positives = 109/137 (79%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQ KGRI G++KGG+ + FG F LKA E  R+ + +IEAARRA++R MKR
Sbjct: 1   MLQPKRTKFRKQHKGRIHGLSKGGTDLNFGAFGLKAVEPERVTARQIEAARRAMTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AGRVWI +FPD+PV++KP EVRMGKGKG+ + W CRVKPGRI+FEIDGV E+VAR A RL
Sbjct: 61  AGRVWIRIFPDLPVSSKPAEVRMGKGKGSPDYWACRVKPGRIMFEIDGVPEDVAREAMRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            AAKL +  +F+QR+ +
Sbjct: 121 AAAKLPIKCRFVQRIAD 137


>gi|253577186|ref|ZP_04854506.1| 50S ribosomal protein L16 [Paenibacillus sp. oral taxon 786 str.
           D14]
 gi|251843430|gb|EES71458.1| 50S ribosomal protein L16 [Paenibacillus sp. oral taxon 786 str.
           D14]
          Length = 144

 Score =  203 bits (516), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 76/135 (56%), Positives = 99/135 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQ +G ++G AKGG+ + FG + L+A E   I + +IEAAR A++R +KR
Sbjct: 1   MLVPKRVKHRKQQRGNMRGQAKGGTELNFGEYGLQALEPTWITNRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T KP EVRMG GKGNVEKWV  VKPG+I+FE+ GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPDKPITQKPLEVRMGSGKGNVEKWVAVVKPGKIMFELAGVSEEVAREAMRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL + TKF++R 
Sbjct: 121 AAHKLPIKTKFVKRE 135


>gi|22297632|ref|NP_680879.1| 50S ribosomal protein L16 [Thermosynechococcus elongatus BP-1]
 gi|81744005|sp|Q8DMM5|RL16_THEEB RecName: Full=50S ribosomal protein L16
 gi|22293809|dbj|BAC07641.1| 50S ribosomal protein L16 [Thermosynechococcus elongatus BP-1]
          Length = 143

 Score =  202 bits (515), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 72/137 (52%), Positives = 98/137 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ KQ +GR+ GVA  G+ I FG++AL+A E   I + +IEA RRA++R ++R
Sbjct: 1   MLSPKRTKFRKQQRGRMTGVASRGNSIHFGDYALQALEPAWITARQIEAGRRAMTRYIRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVT +P E RMG GKG+ E WV  VKPGRI++EI GV+EEVAR A RL
Sbjct: 61  GGKIWIRIFPDKPVTMRPAETRMGSGKGSPEYWVAVVKPGRIMYEIAGVTEEVAREAMRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            A K+ + T+F+ R  E
Sbjct: 121 AAYKMPIKTRFLVRNQE 137


>gi|312899050|ref|ZP_07758434.1| ribosomal protein L16 [Megasphaera micronuciformis F0359]
 gi|310619835|gb|EFQ03411.1| ribosomal protein L16 [Megasphaera micronuciformis F0359]
          Length = 145

 Score =  202 bits (515), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 69/137 (50%), Positives = 95/137 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQF+GR+KG A+ G+++  G++ L A E   I + +IEAAR A++R +KR
Sbjct: 1   MLIPKRVKHRKQFRGRMKGTAQRGNKVAHGDYGLVALEPAWITNRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+TAKP E RMG GKG+ E WV  VKPGR+LFE+ GV+  +AR A RL
Sbjct: 61  GGKVWIKIFPDKPITAKPAETRMGSGKGSPEYWVAVVKPGRVLFEMGGVNPTIAREAMRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
              KL + TKF+ +  E
Sbjct: 121 AGHKLPIKTKFVVKGQE 137


>gi|255659510|ref|ZP_05404919.1| ribosomal protein L16 [Mitsuokella multacida DSM 20544]
 gi|260848062|gb|EEX68069.1| ribosomal protein L16 [Mitsuokella multacida DSM 20544]
          Length = 147

 Score =  202 bits (515), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 72/135 (53%), Positives = 93/135 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY KQF+GR+KG A  G+ +  G + L A E   I + +IEAAR A++R +KR
Sbjct: 1   MLLPKRVKYRKQFRGRMKGKAHRGNTLSHGQYGLVALEPAWITNRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVTAKP E RMG GKG+ E WV  VKPGR+LFE+DGVS+E+A  A RL
Sbjct: 61  GGQVWIKIFPDKPVTAKPAETRMGSGKGSPEYWVAVVKPGRVLFEMDGVSKEIAMEAMRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL + TKF+ + 
Sbjct: 121 AGHKLPIKTKFVMKE 135


>gi|118591176|ref|ZP_01548575.1| 50S ribosomal protein L16 [Stappia aggregata IAM 12614]
 gi|118436252|gb|EAV42894.1| 50S ribosomal protein L16 [Stappia aggregata IAM 12614]
          Length = 137

 Score =  202 bits (515), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 86/137 (62%), Positives = 109/137 (79%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQ KGRI G++KGG+ + FG F LKA E  R+ + +IEAARRA++R MKR
Sbjct: 1   MLQPKRTKFRKQHKGRIHGLSKGGTDLNFGAFGLKAMEPERVTARQIEAARRAMTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AGRVWI +FPDVPV++KP EVRMGKGKG+ + W CRVKPGRI+FEIDGV E++AR A RL
Sbjct: 61  AGRVWIRIFPDVPVSSKPAEVRMGKGKGSPDYWACRVKPGRIMFEIDGVPEDIAREAMRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            AAKL +  +F+QR+ E
Sbjct: 121 AAAKLPIKCRFVQRIGE 137


>gi|295694844|ref|YP_003588082.1| ribosomal protein L16 [Bacillus tusciae DSM 2912]
 gi|295410446|gb|ADG04938.1| ribosomal protein L16 [Bacillus tusciae DSM 2912]
          Length = 144

 Score =  202 bits (515), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 71/134 (52%), Positives = 95/134 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ K+ +GR+KG +KGG+ I FG + L+A E   I + +IEAAR A++R ++R
Sbjct: 1   MLMPKRVKHRKEHRGRLKGRSKGGNEIAFGEYGLQALEPAWITNRQIEAARIAMTRYIRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP  PVT KP E RMG GKG+ E+WV  VKPGRILFE+ GV EEVA+ A RL
Sbjct: 61  GGKVWIKIFPAKPVTKKPAETRMGSGKGSPEQWVAVVKPGRILFELAGVPEEVAKEAMRL 120

Query: 122 GAAKLSVVTKFIQR 135
            + KL + TKF+ R
Sbjct: 121 ASHKLPIKTKFVTR 134


>gi|291532100|emb|CBK97685.1| LSU ribosomal protein L16P [Eubacterium siraeum 70/3]
          Length = 140

 Score =  202 bits (515), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 66/135 (48%), Positives = 88/135 (65%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +  +GR+ G A  G+ +  G + L+A E   I S++IEAAR A++R +KR
Sbjct: 1   MLLPKRVKYRRVQRGRMTGKATRGNVVSHGEYGLQALEPAWITSNQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T KP E RMG GKG+ E WV  VKPGR++FEI GV EE AR A RL
Sbjct: 61  GGQVWIKIFPDKPITEKPAETRMGSGKGSPEYWVAVVKPGRVMFEIAGVPEETAREAMRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  KF+ + 
Sbjct: 121 AMHKLPIKCKFVSKE 135


>gi|303230137|ref|ZP_07316906.1| ribosomal protein L16 [Veillonella atypica ACS-134-V-Col7a]
 gi|303231254|ref|ZP_07317992.1| ribosomal protein L16 [Veillonella atypica ACS-049-V-Sch6]
 gi|302514161|gb|EFL56165.1| ribosomal protein L16 [Veillonella atypica ACS-049-V-Sch6]
 gi|302515198|gb|EFL57171.1| ribosomal protein L16 [Veillonella atypica ACS-134-V-Col7a]
          Length = 145

 Score =  202 bits (515), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 70/137 (51%), Positives = 93/137 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQF+GR+KG A  G+ +  G F L A E + I + +IEAAR A++R +KR
Sbjct: 1   MLIPKRVKHRKQFRGRMKGRAMRGNTVSHGEFGLVACEPSWITNRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+TAKP   RMG GKG+ E WV  VKPGR++FE+DGV E VAR A RL
Sbjct: 61  GGQVWIKIFPDKPITAKPAGTRMGSGKGSPEYWVAVVKPGRVMFEMDGVPEAVAREAMRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            + KL +  KF+ +  E
Sbjct: 121 ASHKLPIKCKFVVKGKE 137


>gi|298491405|ref|YP_003721582.1| 50S ribosomal protein L16 ['Nostoc azollae' 0708]
 gi|298233323|gb|ADI64459.1| ribosomal protein L16 ['Nostoc azollae' 0708]
          Length = 141

 Score =  202 bits (515), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 78/134 (58%), Positives = 100/134 (74%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+ TK+ KQ +GR++G+A  GS + FG+FAL+AQE   I S +IEA+RRA++R ++R
Sbjct: 1   MLSPRRTKFRKQQRGRMEGLANRGSTLNFGDFALQAQEPAWITSRQIEASRRAMTRYIRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVT +P E RMG GKGN E WV  VKPGRILFEI GVSEE+AR A RL
Sbjct: 61  GGKIWIRIFPDKPVTMRPAETRMGSGKGNPEFWVAVVKPGRILFEIAGVSEEIAREAMRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + TKFI R
Sbjct: 121 AAYKLPIKTKFIVR 134


>gi|313888800|ref|ZP_07822461.1| ribosomal protein L16 [Peptoniphilus harei ACS-146-V-Sch2b]
 gi|312845169|gb|EFR32569.1| ribosomal protein L16 [Peptoniphilus harei ACS-146-V-Sch2b]
          Length = 143

 Score =  202 bits (515), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 71/134 (52%), Positives = 93/134 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY K  +GR+KG A  G+ + +G + +KA E   I S++IEAARRA++R ++R
Sbjct: 1   MLMPKRVKYRKVHRGRMKGKAMRGNELAYGEYGIKALEPCWITSNQIEAARRAMTRYIRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G +WI +FPD PVT KP E RMG GKG  E WV  VKPGR+LFE+ GVSEEVAR A RL
Sbjct: 61  GGNIWIKIFPDKPVTEKPAETRMGSGKGAPEYWVAVVKPGRVLFEMGGVSEEVAREAMRL 120

Query: 122 GAAKLSVVTKFIQR 135
            + KL + TKF+ +
Sbjct: 121 ASMKLPIKTKFVMK 134


>gi|282882508|ref|ZP_06291129.1| ribosomal protein L16 [Peptoniphilus lacrimalis 315-B]
 gi|300814577|ref|ZP_07094828.1| ribosomal protein L16 [Peptoniphilus sp. oral taxon 836 str. F0141]
 gi|281297650|gb|EFA90125.1| ribosomal protein L16 [Peptoniphilus lacrimalis 315-B]
 gi|300511196|gb|EFK38445.1| ribosomal protein L16 [Peptoniphilus sp. oral taxon 836 str. F0141]
          Length = 142

 Score =  202 bits (515), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 69/135 (51%), Positives = 95/135 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +  +GR+KG A+ G+ + +G + +KA E   I S++IEAARRA++R ++R
Sbjct: 1   MLMPKRVKYRRVHRGRMKGKAQRGNTLAYGEYGIKALEPAWITSNQIEAARRAMTRYIRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G +WI +FPD PV+ KP E RMG GKG  E WV  VKPGR+LFE+ GVSEEVAR A RL
Sbjct: 61  GGNIWIKIFPDKPVSEKPAETRMGSGKGAPEYWVAVVKPGRVLFEMSGVSEEVAREAMRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL + TKF+++ 
Sbjct: 121 ASMKLPIKTKFVKKE 135


>gi|309789660|ref|ZP_07684241.1| hypothetical protein OSCT_0192 [Oscillochloris trichoides DG6]
 gi|308228396|gb|EFO82043.1| hypothetical protein OSCT_0192 [Oscillochloris trichoides DG6]
          Length = 145

 Score =  202 bits (515), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 72/138 (52%), Positives = 93/138 (67%), Gaps = 1/138 (0%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY KQ +GR +G+A  GS + FG + L A E+  I S +IEAARR I+  +KR
Sbjct: 1   MLLPKRTKYRKQQRGRNRGLAYRGSGVVFGEYGLMALESTWITSRQIEAARRTITNYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT KP E RMG GKG+V+ WV  +KPGR++FE+ GVSEE+A  A R 
Sbjct: 61  GGKVWIRIFPDKPVTQKPAETRMGGGKGSVDHWVAVIKPGRVMFELGGVSEEIALEALRR 120

Query: 122 GAAKLSVVTKFIQR-VVE 138
            A K+ +  K I R  VE
Sbjct: 121 AAQKMPIPCKIITRDEVE 138


>gi|170738696|ref|YP_001767351.1| 50S ribosomal protein L16 [Methylobacterium sp. 4-46]
 gi|226712323|sp|B0UHW2|RL16_METS4 RecName: Full=50S ribosomal protein L16
 gi|168192970|gb|ACA14917.1| ribosomal protein L16 [Methylobacterium sp. 4-46]
          Length = 137

 Score =  202 bits (515), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 89/137 (64%), Positives = 109/137 (79%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQFKGRI G AKGG+ + FG++ LKA E  R+ + +IEAARRAI+R MKR
Sbjct: 1   MLQPKKTKFRKQFKGRIHGTAKGGTDLNFGSYGLKALEPERVTARQIEAARRAITREMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPDVPVT KPTEVRMG GKG+ E W  RV PGR++FEIDGV+E++AR A RL
Sbjct: 61  QGRVWIRIFPDVPVTQKPTEVRMGSGKGSPEYWAARVHPGRVMFEIDGVAEDIAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
           GAAKL V T+FIQR+ +
Sbjct: 121 GAAKLPVRTRFIQRIAD 137


>gi|225016278|ref|ZP_03705470.1| hypothetical protein CLOSTMETH_00181 [Clostridium methylpentosum
           DSM 5476]
 gi|224950953|gb|EEG32162.1| hypothetical protein CLOSTMETH_00181 [Clostridium methylpentosum
           DSM 5476]
          Length = 139

 Score =  202 bits (515), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 70/135 (51%), Positives = 92/135 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +  +GR+KG A  G+ + +G+F L A E   I S++IEAAR A++R +KR
Sbjct: 1   MLLPKRVKYRRVHRGRLKGKAMRGNTVTYGDFGLAALEPGWITSNQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T KP E RMG GKG+ E WV  VKPGR++FEI GVSEEVAR A RL
Sbjct: 61  GGQVWIKIFPDKPITEKPAETRMGSGKGSPEYWVAVVKPGRVMFEIAGVSEEVAREAMRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  KF+ + 
Sbjct: 121 AMHKLPIKCKFVTKE 135


>gi|126657995|ref|ZP_01729147.1| 50S ribosomal protein L16 [Cyanothece sp. CCY0110]
 gi|126620633|gb|EAZ91350.1| 50S ribosomal protein L16 [Cyanothece sp. CCY0110]
          Length = 139

 Score =  202 bits (515), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 74/137 (54%), Positives = 98/137 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+ TK+ KQ +GR++G+A  GS + FG +AL+A E + I + +IEAARRA++R +KR
Sbjct: 1   MLSPRRTKFRKQQRGRMRGLAHRGSTLNFGEYALQATEPSWITARQIEAARRAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD PVT +  E RMG GKG+ E WV  VKPGRI+FE+ GVSE +AR A RL
Sbjct: 61  GGKIWIRVFPDKPVTMRAAETRMGSGKGSPEYWVAVVKPGRIMFELSGVSEPIAREAMRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            A KL + TKFI R  E
Sbjct: 121 AAQKLPIKTKFITRQEE 137


>gi|89100342|ref|ZP_01173207.1| 50S ribosomal protein L16 [Bacillus sp. NRRL B-14911]
 gi|89084963|gb|EAR64099.1| 50S ribosomal protein L16 [Bacillus sp. NRRL B-14911]
          Length = 144

 Score =  202 bits (515), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 73/135 (54%), Positives = 96/135 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +  +G+++G +KGG+ + FG F L+A EA+ I + +IE+AR A++R MKR
Sbjct: 1   MLLPKRVKYRRVHRGKMRGQSKGGTEVNFGEFGLQALEASWITNRQIESARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP  P TAKP EVRMG GKG  E WV  VKPG+I+FEI GVSEEVAR A RL
Sbjct: 61  GGKVWINIFPHKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKIMFEIAGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL V  KF++R 
Sbjct: 121 ASHKLPVKCKFVKRE 135


>gi|119484826|ref|ZP_01619308.1| 50S ribosomal protein L16 [Lyngbya sp. PCC 8106]
 gi|119457644|gb|EAW38768.1| 50S ribosomal protein L16 [Lyngbya sp. PCC 8106]
          Length = 142

 Score =  202 bits (514), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 72/137 (52%), Positives = 98/137 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ KQ +GR++G A  G+ I FG +AL+A E + I + +IEAARRA++R ++R
Sbjct: 1   MLSPKRTKFRKQQRGRMRGQASRGNTISFGEYALQALEPSWITARQIEAARRAMTRYIRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T +P E RMG GKG  E WV  VKPGRI+FE+ GVSEE+AR A RL
Sbjct: 61  GGQIWIRIFPDKPITMRPAETRMGSGKGAPEYWVAVVKPGRIMFELAGVSEEIAREAMRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
             +KL + TKFI +  E
Sbjct: 121 ADSKLPIKTKFIVKPKE 137


>gi|75457563|sp|Q6H090|RL16_FREDI RecName: Full=50S ribosomal protein L16
 gi|48374163|gb|AAT41876.1| 50S ribosomal subunit L16 [Fremyella diplosiphon Fd33]
          Length = 141

 Score =  202 bits (514), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 79/134 (58%), Positives = 100/134 (74%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+ TK+ KQ +GR++G+A  GS + FG+FAL+AQE   I S +IEA+RRA++R ++R
Sbjct: 1   MLSPRRTKFRKQQRGRMEGLAHRGSTLNFGDFALQAQEPAWITSRQIEASRRAMTRYIRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVT +P E RMG GKGN E WV  VKPGRILFEI GVSEEVAR A RL
Sbjct: 61  GGQIWIRIFPDKPVTMRPAETRMGSGKGNPEFWVAVVKPGRILFEIAGVSEEVAREAMRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + TKFI R
Sbjct: 121 AAYKLPIKTKFIVR 134


>gi|186684503|ref|YP_001867699.1| 50S ribosomal protein L16 [Nostoc punctiforme PCC 73102]
 gi|226712328|sp|B2ITP8|RL16_NOSP7 RecName: Full=50S ribosomal protein L16
 gi|186466955|gb|ACC82756.1| ribosomal protein L16 [Nostoc punctiforme PCC 73102]
          Length = 141

 Score =  202 bits (514), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 77/134 (57%), Positives = 100/134 (74%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+ TK+ KQ +GR++G+A  GS + FG+FAL+AQE   I S +IEA+RRA++R ++R
Sbjct: 1   MLSPRRTKFRKQQRGRMEGLATRGSTLNFGDFALQAQEPAWITSRQIEASRRAMTRYIRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVT +P E RMG GKGN E WV  VKPGRILFEI GVSEE+AR A RL
Sbjct: 61  GGQIWIRIFPDKPVTMRPAETRMGSGKGNPEFWVAVVKPGRILFEIGGVSEEIAREAMRL 120

Query: 122 GAAKLSVVTKFIQR 135
            + KL + TKFI R
Sbjct: 121 ASFKLPIKTKFIVR 134


>gi|121601897|ref|YP_989004.1| 50S ribosomal protein L16 [Bartonella bacilliformis KC583]
 gi|121602176|ref|YP_988974.1| 50S ribosomal protein L16 [Bartonella bacilliformis KC583]
 gi|215274786|sp|A1USM1|RL16_BARBK RecName: Full=50S ribosomal protein L16
 gi|120614074|gb|ABM44675.1| ribosomal protein L16 [Bartonella bacilliformis KC583]
 gi|120614353|gb|ABM44954.1| ribosomal protein L16 [Bartonella bacilliformis KC583]
          Length = 137

 Score =  202 bits (514), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 91/137 (66%), Positives = 111/137 (81%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQFKGRI G +KGG+ + FG + LK  E  RI + +IEAARRAI+R MKR
Sbjct: 1   MLQPKRTKFRKQFKGRIHGASKGGTDLNFGAYGLKVVEPERITARQIEAARRAITRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           +GRVWI VFPD+PVT+KPTEVRMGKGKG+V+ W  RV PGRI+FE+DGV E+VAR A RL
Sbjct: 61  SGRVWIRVFPDLPVTSKPTEVRMGKGKGSVDYWAARVAPGRIMFELDGVPEDVAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
           GAAKL + T+FIQR+VE
Sbjct: 121 GAAKLPIKTRFIQRIVE 137


>gi|319899092|ref|YP_004159185.1| 50S ribosomal protein L16 [Bartonella clarridgeiae 73]
 gi|319403056|emb|CBI76611.1| 50S ribosomal protein L16 [Bartonella clarridgeiae 73]
          Length = 137

 Score =  202 bits (514), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 90/137 (65%), Positives = 112/137 (81%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQFKGRI G +KGG+ + FG + LKA E  RI + +IEAARRAI+R MKR
Sbjct: 1   MLQPKRTKFRKQFKGRIHGYSKGGTGLNFGAYGLKAVEPERITARQIEAARRAITRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           +GRVWI +FPDVPVT+KPTEVRMGKGKG+V+ W  RV PGR++FE+DGVSE+VAR A RL
Sbjct: 61  SGRVWIRIFPDVPVTSKPTEVRMGKGKGSVDYWAARVAPGRVMFELDGVSEDVAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
           GAAKL + T+F+QR+ E
Sbjct: 121 GAAKLPIKTRFVQRIAE 137


>gi|227485518|ref|ZP_03915834.1| ribosomal protein L16 [Anaerococcus lactolyticus ATCC 51172]
 gi|227236517|gb|EEI86532.1| ribosomal protein L16 [Anaerococcus lactolyticus ATCC 51172]
          Length = 142

 Score =  202 bits (514), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 75/134 (55%), Positives = 98/134 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +Q +GR+KG A  G+++ +G F L+A EA  + +++IEAARRA++R +KR
Sbjct: 1   MLMPKRVKYRRQHRGRMKGNANRGNQLAYGEFGLQALEACWMTANQIEAARRAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G +WI VFPD PV+ KP EVRMG GKG  E WV  +KPGR+LFE+ GVSEEVA+ A RL
Sbjct: 61  GGNIWIKVFPDKPVSKKPAEVRMGSGKGAPEYWVAVIKPGRVLFEMSGVSEEVAKEAMRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + TKFIQR
Sbjct: 121 AAQKLPIKTKFIQR 134


>gi|33241154|ref|NP_876096.1| 50S ribosomal protein L16 [Prochlorococcus marinus subsp. marinus
           str. CCMP1375]
 gi|81663960|sp|Q7V9W9|RL16_PROMA RecName: Full=50S ribosomal protein L16
 gi|33238684|gb|AAQ00749.1| Ribosomal protein L16/L10E [Prochlorococcus marinus subsp. marinus
           str. CCMP1375]
          Length = 182

 Score =  202 bits (514), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 74/134 (55%), Positives = 98/134 (73%), Gaps = 2/134 (1%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ KQ +GR++GVA  G++I FG FAL+AQE   I S +IEA+RRA++R +KR
Sbjct: 1   MLSPKRTKFRKQQRGRMRGVATRGNKIAFGQFALQAQECGWITSRQIEASRRAMTRYVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDG--VSEEVARRAF 119
            G++WI +FPD PVT +P E RMG GKGN E WV  VKPGRILFE+ G  ++EE+A+ A 
Sbjct: 61  GGQIWIRIFPDKPVTMRPAETRMGSGKGNPEFWVAVVKPGRILFEMGGEEITEEIAKEAM 120

Query: 120 RLGAAKLSVVTKFI 133
           RL   KL + TKF+
Sbjct: 121 RLAQYKLPIKTKFL 134


>gi|167749432|ref|ZP_02421559.1| hypothetical protein EUBSIR_00386 [Eubacterium siraeum DSM 15702]
 gi|167657604|gb|EDS01734.1| hypothetical protein EUBSIR_00386 [Eubacterium siraeum DSM 15702]
 gi|291558159|emb|CBL35276.1| LSU ribosomal protein L16P [Eubacterium siraeum V10Sc8a]
          Length = 140

 Score =  202 bits (514), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 66/135 (48%), Positives = 88/135 (65%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +  +GR+ G A  G+ +  G + L+A E   I S++IEAAR A++R +KR
Sbjct: 1   MLLPKRVKYRRVQRGRMTGKATRGNVVSHGEYGLQALEPAWITSNQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T KP E RMG GKG+ E WV  VKPGR++FEI GV EE AR A RL
Sbjct: 61  GGQVWIKIFPDKPITEKPAETRMGSGKGSPEYWVAVVKPGRVMFEIAGVPEETAREAMRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  KF+ + 
Sbjct: 121 AMHKLPIKCKFVTKE 135


>gi|23097581|ref|NP_691047.1| 50S ribosomal protein L16 [Oceanobacillus iheyensis HTE831]
 gi|81747270|sp|Q8ETX6|RL16_OCEIH RecName: Full=50S ribosomal protein L16
 gi|22775804|dbj|BAC12082.1| 50S ribosomal protein L16 [Oceanobacillus iheyensis HTE831]
          Length = 144

 Score =  202 bits (514), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 78/135 (57%), Positives = 99/135 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +Q +G+++G AKGG+ + FG + L+A EA+ I S +IEAAR A++R MKR
Sbjct: 1   MLMPKRVKYRRQHRGKMRGQAKGGTTVAFGEYGLQATEASWITSRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P TAKP EVRMG GKG  E WV  VKPG+I+FEI GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPDKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKIMFEIAGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL V TKF++R 
Sbjct: 121 ASHKLPVKTKFVKRE 135


>gi|229542196|ref|ZP_04431256.1| ribosomal protein L16 [Bacillus coagulans 36D1]
 gi|229326616|gb|EEN92291.1| ribosomal protein L16 [Bacillus coagulans 36D1]
          Length = 144

 Score =  202 bits (514), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 73/135 (54%), Positives = 96/135 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY ++ +G+++G AKGG+ + FG + L+A EA+ I + +IEAAR A++R MKR
Sbjct: 1   MLMPKRVKYRREHRGKMRGRAKGGTEVAFGEYGLQALEASWITNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP  P TAKP EVRMG GKG  E WV  VKPG+ILFEI GV EEVAR A RL
Sbjct: 61  GGKVWIKIFPHKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKILFEIAGVPEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL +  KF++R 
Sbjct: 121 ASHKLPIKCKFVKRE 135


>gi|114567834|ref|YP_754988.1| 50S ribosomal protein L16 [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
 gi|122317290|sp|Q0AUI7|RL16_SYNWW RecName: Full=50S ribosomal protein L16
 gi|114338769|gb|ABI69617.1| LSU ribosomal protein L16P [Syntrophomonas wolfei subsp. wolfei
           str. Goettingen]
          Length = 144

 Score =  201 bits (513), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 70/135 (51%), Positives = 93/135 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQ +  + G A  G+ I +G++ L+A E   I + +IEAAR AI+R +KR
Sbjct: 1   MLTPKRVKHRKQHRPSLAGKANKGNTITYGDYGLQALEPAWITNRQIEAARIAINRYVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T KP E RMGKGKG+ E WV  VKPGR++FE+ GVSEEVAR A RL
Sbjct: 61  GGKLWIKIFPDRPLTVKPAETRMGKGKGSPEHWVAVVKPGRVMFELSGVSEEVAREAMRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL V  KF++R 
Sbjct: 121 AAHKLPVKCKFLKRE 135


>gi|182418826|ref|ZP_02950091.1| ribosomal protein L16 [Clostridium butyricum 5521]
 gi|237666958|ref|ZP_04526943.1| ribosomal protein L16 [Clostridium butyricum E4 str. BoNT E BL5262]
 gi|182377323|gb|EDT74884.1| ribosomal protein L16 [Clostridium butyricum 5521]
 gi|237658157|gb|EEP55712.1| ribosomal protein L16 [Clostridium butyricum E4 str. BoNT E BL5262]
          Length = 144

 Score =  201 bits (513), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 68/134 (50%), Positives = 94/134 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ K  +GR+KG A  G+ + +G++ ++AQ    I S++IE+AR AI+R +KR
Sbjct: 1   MLMPKRVKHRKVQRGRMKGKATRGNFLAYGDYGIQAQTCGWITSNQIESARIAINRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVT KP E RMG GKG+ E WV  VKPGR+LFE+ GV+EE AR A RL
Sbjct: 61  GGKLWIKIFPDKPVTEKPAETRMGSGKGSPEYWVAVVKPGRVLFELSGVAEETAREAMRL 120

Query: 122 GAAKLSVVTKFIQR 135
            + KL V TKF+ +
Sbjct: 121 ASHKLPVKTKFVTK 134


>gi|315649692|ref|ZP_07902776.1| ribosomal protein L16 [Paenibacillus vortex V453]
 gi|315274880|gb|EFU38256.1| ribosomal protein L16 [Paenibacillus vortex V453]
          Length = 144

 Score =  201 bits (513), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 76/135 (56%), Positives = 99/135 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQ +G ++G AKGG+ + FG F L+A E   I + +IEAAR A++R ++R
Sbjct: 1   MLVPKRVKHRKQQRGHMRGQAKGGTEVSFGEFGLQATEPGWITNRQIEAARIAMTRYIRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T KP EVRMG GKGNVEKWV  VKPG+I+FE+ GVSEE+AR A RL
Sbjct: 61  GGKVWIKIFPDKPITQKPLEVRMGSGKGNVEKWVAVVKPGKIMFELGGVSEEIAREAMRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL V TKF++R 
Sbjct: 121 AAHKLPVKTKFVKRE 135


>gi|170077678|ref|YP_001734316.1| 50S ribosomal protein L16 [Synechococcus sp. PCC 7002]
 gi|226712365|sp|B1XJT2|RL16_SYNP2 RecName: Full=50S ribosomal protein L16
 gi|169885347|gb|ACA99060.1| ribosomal protein L16 [Synechococcus sp. PCC 7002]
          Length = 139

 Score =  201 bits (513), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 74/137 (54%), Positives = 101/137 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ KQ +GR++G+A  G+ I FG++AL+A E + I + +IEAARRA++R +KR
Sbjct: 1   MLSPKRTKFRKQHRGRMRGMAYRGNNIQFGDYALQAVEPSWITARQIEAARRAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T +P E RMG GKGN E WV  VKPGRI+FE++GV+E +AR A RL
Sbjct: 61  GGKIWIRIFPDKPITMRPAETRMGSGKGNPEFWVAVVKPGRIMFEMNGVAEPIAREAMRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            A KL + TKFI R  E
Sbjct: 121 AAQKLPIKTKFITRNEE 137


>gi|83594013|ref|YP_427765.1| 50S ribosomal protein L16 [Rhodospirillum rubrum ATCC 11170]
 gi|115502785|sp|Q2RQW7|RL16_RHORT RecName: Full=50S ribosomal protein L16
 gi|83576927|gb|ABC23478.1| LSU ribosomal protein L16P [Rhodospirillum rubrum ATCC 11170]
          Length = 138

 Score =  201 bits (513), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 85/137 (62%), Positives = 106/137 (77%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ KQ KGRI G+AKGG+ + FG+F LKA E  R+ + +IEAARRAI+R MKR
Sbjct: 1   MLSPKRTKFRKQHKGRIHGLAKGGTDLNFGSFGLKAVEPERVTARQIEAARRAITRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI +FPDVPV+ KP EVRMG GKG+ E WV RVKPGR++FE+DGV E++AR AF L
Sbjct: 61  QGRLWIRIFPDVPVSKKPAEVRMGSGKGSPEFWVARVKPGRVMFELDGVPEDIARGAFEL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            AAKL + TKFI R+ E
Sbjct: 121 AAAKLPLKTKFIARIGE 137


>gi|319405891|emb|CBI79523.1| 50S ribosomal protein L16 [Bartonella sp. AR 15-3]
          Length = 137

 Score =  201 bits (513), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 91/137 (66%), Positives = 112/137 (81%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQFKGRI G +KGG+ + FG + LKA E  RI + +IEAARRAI+R MKR
Sbjct: 1   MLQPKRTKFRKQFKGRIHGSSKGGTGLNFGAYGLKAIEPERITARQIEAARRAITRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           +GRVWI +FPDVPVT+KPTEVRMGKGKG+V+ W  RV PGR++FE+DGVSE+VAR A RL
Sbjct: 61  SGRVWIRIFPDVPVTSKPTEVRMGKGKGSVDYWAARVAPGRVMFELDGVSEDVAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
           GAAKL V T+F+QR+ E
Sbjct: 121 GAAKLPVKTRFVQRIAE 137


>gi|49475787|ref|YP_033828.1| 50S ribosomal protein L16 [Bartonella henselae str. Houston-1]
 gi|81647793|sp|Q6G2X2|RL16_BARHE RecName: Full=50S ribosomal protein L16
 gi|49238594|emb|CAF27835.1| 50S ribosomal protein l16 [Bartonella henselae str. Houston-1]
          Length = 137

 Score =  201 bits (513), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 89/137 (64%), Positives = 112/137 (81%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK T++ KQFKGRI GV+KGG+ + FG + LKA E  RI + +IEAARRAI+R MKR
Sbjct: 1   MLQPKRTRFRKQFKGRIHGVSKGGTDLNFGAYGLKAVEPERITARQIEAARRAITRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           +GRVWI +FPD+PVT+KPTEVRMGKGKG+V+ W  RV PGRI+FE+DG+ E+VAR A RL
Sbjct: 61  SGRVWIRIFPDLPVTSKPTEVRMGKGKGSVDYWAARVAPGRIMFELDGIPEDVAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
           GAAKL + T+FIQR+ E
Sbjct: 121 GAAKLPIKTRFIQRIAE 137


>gi|17231700|ref|NP_488248.1| 50S ribosomal protein L16 [Nostoc sp. PCC 7120]
 gi|75906921|ref|YP_321217.1| 50S ribosomal protein L16 [Anabaena variabilis ATCC 29413]
 gi|81770180|sp|Q8YPI6|RL16_ANASP RecName: Full=50S ribosomal protein L16
 gi|115502731|sp|Q3MFB4|RL16_ANAVT RecName: Full=50S ribosomal protein L16
 gi|17133343|dbj|BAB75907.1| 50S ribosomal protein L16 [Nostoc sp. PCC 7120]
 gi|75700646|gb|ABA20322.1| LSU ribosomal protein L16P [Anabaena variabilis ATCC 29413]
          Length = 142

 Score =  201 bits (513), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 77/134 (57%), Positives = 99/134 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+ TK+ KQ +GR+ G+A  GS + FG+FAL+AQE   I S +IEA+RRA++R ++R
Sbjct: 1   MLSPRRTKFRKQQRGRMGGLAHRGSTLNFGDFALQAQEPAWITSRQIEASRRAMTRYIRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVT +P E RMG GKGN E WV  VKPGRILFEI GV+EE+AR A RL
Sbjct: 61  GGKIWIRIFPDKPVTMRPAETRMGSGKGNPEFWVAVVKPGRILFEIAGVTEEIAREAMRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + TKFI R
Sbjct: 121 AAYKLPIKTKFIVR 134


>gi|319654875|ref|ZP_08008950.1| 50S ribosomal protein L16 [Bacillus sp. 2_A_57_CT2]
 gi|317393438|gb|EFV74201.1| 50S ribosomal protein L16 [Bacillus sp. 2_A_57_CT2]
          Length = 144

 Score =  201 bits (512), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 70/135 (51%), Positives = 96/135 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +  +G+++G +KGG+ + FG + L+A EA+ I + +IE+AR A++R MKR
Sbjct: 1   MLLPKRVKYRRVHRGKMRGQSKGGTEVNFGEYGLQALEASWITNRQIESARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP  P TAKP EVRMG GKG  E WV  VKPG+++FEI GVSEE+AR A RL
Sbjct: 61  GGKVWIQIFPHKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKVMFEIAGVSEEIAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL V  KF++R 
Sbjct: 121 ASHKLPVKCKFVKRE 135


>gi|308070968|ref|YP_003872573.1| 50S ribosomal protein L16 [Paenibacillus polymyxa E681]
 gi|310644195|ref|YP_003948954.1| 50S ribosomal protein l16 [Paenibacillus polymyxa SC2]
 gi|305860247|gb|ADM72035.1| 50S ribosomal protein L16 [Paenibacillus polymyxa E681]
 gi|309249146|gb|ADO58713.1| 50S ribosomal protein L16 [Paenibacillus polymyxa SC2]
          Length = 144

 Score =  201 bits (512), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 75/135 (55%), Positives = 98/135 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQ +G +KG AKGG+ + FG + L+A E   I + +IEAAR A++R +KR
Sbjct: 1   MLVPKRVKHRKQQRGHMKGRAKGGTTLNFGEYGLQATEPAWITNRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T KP EVRMG GKGNVEKWV  VKPG+I+FE+ GV EE+AR A RL
Sbjct: 61  GGKVWIKIFPDKPITQKPLEVRMGSGKGNVEKWVAVVKPGKIMFELAGVPEEIAREAMRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL + TKF++R 
Sbjct: 121 AAHKLPIKTKFVKRE 135


>gi|319404418|emb|CBI78021.1| 50S ribosomal protein L16 [Bartonella rochalimae ATCC BAA-1498]
          Length = 137

 Score =  201 bits (512), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 89/137 (64%), Positives = 111/137 (81%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQFKGRI G +KGG+ + FG + LKA E  R+ + +IEAARRAI+R MKR
Sbjct: 1   MLQPKRTKFRKQFKGRIHGSSKGGTSLNFGAYGLKAIEPERVTARQIEAARRAITRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           +GRVWI +FPDVPVT+KPTEVRMGKGKG+V+ W  RV PGR++FE+DGV E+VAR A RL
Sbjct: 61  SGRVWIRIFPDVPVTSKPTEVRMGKGKGSVDYWAVRVAPGRVMFELDGVPEDVAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
           GAAKL V T+F+QR+ E
Sbjct: 121 GAAKLPVKTRFVQRISE 137


>gi|295401913|ref|ZP_06811876.1| ribosomal protein L16 [Geobacillus thermoglucosidasius C56-YS93]
 gi|312109268|ref|YP_003987584.1| ribosomal protein L16 [Geobacillus sp. Y4.1MC1]
 gi|294976043|gb|EFG51658.1| ribosomal protein L16 [Geobacillus thermoglucosidasius C56-YS93]
 gi|311214369|gb|ADP72973.1| ribosomal protein L16 [Geobacillus sp. Y4.1MC1]
          Length = 144

 Score =  201 bits (512), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 73/135 (54%), Positives = 97/135 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY ++ +GR+KG AKGG+ + FG + L+A E+  I + +IEAARRA++R MKR
Sbjct: 1   MLMPKRVKYRREHRGRMKGRAKGGTEVHFGEYGLQALESAWITNRQIEAARRAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP  P TAKP EVRMG GKG  E WV  VKPG+++FE+ GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPSKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKVMFEVGGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL +  KF++R 
Sbjct: 121 ASHKLPIKCKFVKRE 135


>gi|313112873|ref|ZP_07798519.1| ribosomal protein L16 [Faecalibacterium cf. prausnitzii KLE1255]
 gi|295101421|emb|CBK98966.1| LSU ribosomal protein L16P [Faecalibacterium prausnitzii L2-6]
 gi|310624778|gb|EFQ08087.1| ribosomal protein L16 [Faecalibacterium cf. prausnitzii KLE1255]
          Length = 146

 Score =  201 bits (512), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 67/135 (49%), Positives = 86/135 (63%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +  +GR+ G A  G+ +C G + L A E   I S++IEAAR A++R +KR
Sbjct: 1   MLLPKRVKYRRVQRGRMTGKATRGNVVCQGQYGLVALEPAWISSTQIEAARVAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT KP E RMG GKG+ E WV  VKPGR+LFE+  V E  AR A RL
Sbjct: 61  GGKVWIKIFPDKPVTEKPAETRMGSGKGSPEYWVAVVKPGRVLFELADVDEATAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  KF+ R 
Sbjct: 121 AMHKLPIKCKFVVRE 135


>gi|56751881|ref|YP_172582.1| 50S ribosomal protein L16 [Synechococcus elongatus PCC 6301]
 gi|81301034|ref|YP_401242.1| 50S ribosomal protein L16 [Synechococcus elongatus PCC 7942]
 gi|3122683|sp|O24696|RL16_SYNP6 RecName: Full=50S ribosomal protein L16
 gi|115502805|sp|Q31L14|RL16_SYNE7 RecName: Full=50S ribosomal protein L16
 gi|2446897|dbj|BAA22456.1| 50S ribosomal protein L16 [Synechococcus elongatus PCC 6301]
 gi|56686840|dbj|BAD80062.1| 50S ribosomal protein L16 [Synechococcus elongatus PCC 6301]
 gi|81169915|gb|ABB58255.1| LSU ribosomal protein L16P [Synechococcus elongatus PCC 7942]
          Length = 142

 Score =  201 bits (512), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 72/138 (52%), Positives = 96/138 (69%), Gaps = 1/138 (0%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+ TK+ KQ +GR+ G A  G+ + FGNF L+A E + I + +IEA+RRA++R  +R
Sbjct: 1   MLSPRRTKFRKQQRGRMTGKATRGNTLAFGNFGLQALECSWITARQIEASRRAMTRYTRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDG-VSEEVARRAFR 120
            G++WI +FPD P+T +P E RMG GKGN E WV  VKPGR+LFEI G V+EE AR A R
Sbjct: 61  GGKIWIRIFPDKPITMRPAETRMGSGKGNPEFWVAVVKPGRVLFEIGGEVAEETAREAMR 120

Query: 121 LGAAKLSVVTKFIQRVVE 138
           L + KL + TKFI R  E
Sbjct: 121 LASHKLPIKTKFITRDSE 138


>gi|238018630|ref|ZP_04599056.1| hypothetical protein VEIDISOL_00465 [Veillonella dispar ATCC 17748]
 gi|269798543|ref|YP_003312443.1| ribosomal protein L16 [Veillonella parvula DSM 2008]
 gi|282849871|ref|ZP_06259254.1| ribosomal protein L16 [Veillonella parvula ATCC 17745]
 gi|294792801|ref|ZP_06757948.1| ribosomal protein L16 [Veillonella sp. 6_1_27]
 gi|294794555|ref|ZP_06759691.1| ribosomal protein L16 [Veillonella sp. 3_1_44]
 gi|313893077|ref|ZP_07826654.1| ribosomal protein L16 [Veillonella sp. oral taxon 158 str. F0412]
 gi|237865101|gb|EEP66391.1| hypothetical protein VEIDISOL_00465 [Veillonella dispar ATCC 17748]
 gi|269095172|gb|ACZ25163.1| ribosomal protein L16 [Veillonella parvula DSM 2008]
 gi|282580308|gb|EFB85708.1| ribosomal protein L16 [Veillonella parvula ATCC 17745]
 gi|294454885|gb|EFG23258.1| ribosomal protein L16 [Veillonella sp. 3_1_44]
 gi|294456700|gb|EFG25063.1| ribosomal protein L16 [Veillonella sp. 6_1_27]
 gi|313442430|gb|EFR60845.1| ribosomal protein L16 [Veillonella sp. oral taxon 158 str. F0412]
          Length = 145

 Score =  201 bits (512), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 69/137 (50%), Positives = 92/137 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQF+GR+KG A  G+ +  G F L A E + I + +IEAAR A++R +KR
Sbjct: 1   MLIPKRVKHRKQFRGRMKGRAMRGNTVSHGEFGLVACEPSWITNRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+TAKP   RMG GKG+ E WV  VKPGR++FE+DGV E  AR A RL
Sbjct: 61  GGKVWIKIFPDKPITAKPAGTRMGSGKGSPEYWVAVVKPGRVMFEMDGVPEATAREAMRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            + KL +  KF+ +  E
Sbjct: 121 ASHKLPIKCKFVVKGKE 137


>gi|325288585|ref|YP_004264766.1| LSU ribosomal protein L16P [Syntrophobotulus glycolicus DSM 8271]
 gi|324963986|gb|ADY54765.1| LSU ribosomal protein L16P [Syntrophobotulus glycolicus DSM 8271]
          Length = 149

 Score =  201 bits (512), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 67/135 (49%), Positives = 90/135 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P   K+ KQF+  IKG A  G+++ +G + L A E   + + +IEAAR A++R +KR
Sbjct: 1   MLVPTRVKHRKQFRPSIKGKAYKGNKVTYGEYGLMALEGAWVTNRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+TAKP E RMG GKG  E WV  VKP R++FE+ GVSEEVAR A RL
Sbjct: 61  GGQVWINIFPDRPITAKPAETRMGSGKGAPEYWVAVVKPNRVMFELAGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  KF++R 
Sbjct: 121 AMHKLPIKCKFVRRE 135


>gi|255526585|ref|ZP_05393492.1| ribosomal protein L16 [Clostridium carboxidivorans P7]
 gi|296187273|ref|ZP_06855669.1| ribosomal protein L16 [Clostridium carboxidivorans P7]
 gi|255509693|gb|EET86026.1| ribosomal protein L16 [Clostridium carboxidivorans P7]
 gi|296048144|gb|EFG87582.1| ribosomal protein L16 [Clostridium carboxidivorans P7]
          Length = 147

 Score =  201 bits (512), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 70/134 (52%), Positives = 92/134 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K  K  +GR+KG A  G+ I +G+FA++A E   I S++IE+AR AI+R +KR
Sbjct: 1   MLMPKRVKRRKVQRGRMKGKATRGNFIAYGDFAIQATECGWITSNQIESARIAINRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVT KP E RMG GKG+ E WV  VKPGR+LFE+ GV E  AR A RL
Sbjct: 61  GGKLWIKIFPDKPVTEKPAETRMGSGKGSPEYWVSVVKPGRVLFELSGVDETTAREAMRL 120

Query: 122 GAAKLSVVTKFIQR 135
            + KL + TKF+ R
Sbjct: 121 ASHKLPLKTKFVTR 134


>gi|227871795|ref|ZP_03990199.1| ribosomal protein L16 [Oribacterium sinus F0268]
 gi|227842358|gb|EEJ52584.1| ribosomal protein L16 [Oribacterium sinus F0268]
          Length = 142

 Score =  201 bits (512), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 68/134 (50%), Positives = 89/134 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ KQ +GR+ G A  G+ +  G F + + E   I S++IEAAR A++R +KR
Sbjct: 1   MLMPKRTKFRKQMRGRMTGKATRGNTVSHGEFGIISTEPCWIRSNQIEAARVALTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PV+AKP  VRMG GKG  E WV  VKPGR+LFEI GV EE+AR A RL
Sbjct: 61  GGKVWIDIFPDKPVSAKPLGVRMGSGKGATEYWVAVVKPGRVLFEIAGVPEEIAREALRL 120

Query: 122 GAAKLSVVTKFIQR 135
            + KL    K + +
Sbjct: 121 ASHKLPCNCKIVAK 134


>gi|317126868|ref|YP_004093150.1| ribosomal protein L16 [Bacillus cellulosilyticus DSM 2522]
 gi|315471816|gb|ADU28419.1| ribosomal protein L16 [Bacillus cellulosilyticus DSM 2522]
          Length = 144

 Score =  201 bits (511), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 74/135 (54%), Positives = 99/135 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ ++ +G++KG AKGG+ + FG + L+A EA+ I + +IE+AR A++R MKR
Sbjct: 1   MLMPKRVKFRREHRGKMKGRAKGGTEVSFGEYGLQALEASWITNRQIESARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P TAKP EVRMG GKG  E WV  VKPG+I+FEI GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPDKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKIMFEIAGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL + TKF++R 
Sbjct: 121 ASHKLPIKTKFVKRE 135


>gi|172038934|ref|YP_001805435.1| 50S ribosomal protein L16 [Cyanothece sp. ATCC 51142]
 gi|254799195|sp|B1WQR7|RL16_CYAA5 RecName: Full=50S ribosomal protein L16
 gi|171700388|gb|ACB53369.1| 50S ribosomal protein L16 [Cyanothece sp. ATCC 51142]
          Length = 139

 Score =  201 bits (511), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 75/137 (54%), Positives = 98/137 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+ TK+ KQ +GR++G+A  GS + FG +AL+A E + I S +IEAARRA++R +KR
Sbjct: 1   MLSPRRTKFRKQQRGRMRGLAHRGSTLNFGEYALQATEPSWITSRQIEAARRAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD PVT +  E RMG GKG+ E WV  VKPGRI+FE+ GV+E VAR A RL
Sbjct: 61  GGKIWIRVFPDKPVTMRAAETRMGSGKGSPEYWVAVVKPGRIMFELSGVAEPVAREAMRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            A KL + TKFI R  E
Sbjct: 121 AAQKLPIKTKFITRQEE 137


>gi|309389926|gb|ADO77806.1| LSU ribosomal protein L16P [Halanaerobium praevalens DSM 2228]
          Length = 144

 Score =  201 bits (511), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 75/135 (55%), Positives = 95/135 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQ +GR+KG A  G++I FG + L+A E   I + +IEAAR A++R +KR
Sbjct: 1   MLVPKRVKHRKQMRGRMKGKAHRGNKITFGEYGLQALEPVWITNRQIEAARVALTRSIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVTAKP E RMG GKG  EKWV  VKPGRI+FE+ GV EEVAR A RL
Sbjct: 61  GGKVWIKIFPDKPVTAKPAETRMGSGKGAPEKWVAVVKPGRIMFELAGVPEEVAREAMRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL + TKF+ R 
Sbjct: 121 ASHKLPIKTKFVARE 135


>gi|290968237|ref|ZP_06559780.1| ribosomal protein L16 [Megasphaera genomosp. type_1 str. 28L]
 gi|290781719|gb|EFD94304.1| ribosomal protein L16 [Megasphaera genomosp. type_1 str. 28L]
          Length = 145

 Score =  201 bits (511), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 74/137 (54%), Positives = 93/137 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY KQF+GR+KG A  G+++  G F L A E + I + +IEAAR A++R +KR
Sbjct: 1   MLIPKRVKYRKQFRGRMKGKALRGNKVAHGEFGLVAAEPSWITNRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+TAKP   RMG GKG  E WV   KPGR+LFE+ GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPDKPITAKPAGTRMGSGKGAPEYWVAVAKPGRVLFEMGGVSEEVAREAMRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
              KL + TKF+ R  E
Sbjct: 121 AGHKLPIKTKFVVRGQE 137


>gi|212637961|ref|YP_002314481.1| 50S ribosomal protein L16 [Anoxybacillus flavithermus WK1]
 gi|226710673|sp|B7GJ74|RL16_ANOFW RecName: Full=50S ribosomal protein L16
 gi|212559441|gb|ACJ32496.1| Ribosomal protein L16 [Anoxybacillus flavithermus WK1]
          Length = 144

 Score =  201 bits (511), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 73/135 (54%), Positives = 96/135 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY ++ +GR+KG AKGG+ + FG + L+A E   I + +IEAARRA++R M+R
Sbjct: 1   MLMPKRVKYRREHRGRMKGRAKGGTEVHFGEYGLQALEPAWITNRQIEAARRAMTRYMRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP  P TAKP EVRMG GKG  E WV  VKPG+++FEI GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPSKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKVMFEIAGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL +  KF++R 
Sbjct: 121 ASHKLPIKCKFVKRE 135


>gi|113476572|ref|YP_722633.1| 50S ribosomal protein L16 [Trichodesmium erythraeum IMS101]
 gi|123352121|sp|Q110B4|RL16_TRIEI RecName: Full=50S ribosomal protein L16
 gi|110167620|gb|ABG52160.1| LSU ribosomal protein L16P [Trichodesmium erythraeum IMS101]
          Length = 137

 Score =  201 bits (511), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 72/137 (52%), Positives = 97/137 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ KQ +GR++G A  G++I FG +AL+A E + I S +IEAARRA++R ++R
Sbjct: 1   MLSPKRTKFRKQQRGRMRGNANSGNKISFGQYALQALEPSWITSRQIEAARRAMTRYIRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD PVT +  E RMG GKG  E WV  VKPGRI+FE+ GV EE+AR A RL
Sbjct: 61  GGKIWIRVFPDKPVTMRAAETRMGSGKGAPEYWVAVVKPGRIMFELGGVVEEIAREAMRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            + KL + T+FI R  +
Sbjct: 121 ASFKLPIKTRFIVREED 137


>gi|298243961|ref|ZP_06967768.1| ribosomal protein L16 [Ktedonobacter racemifer DSM 44963]
 gi|297557015|gb|EFH90879.1| ribosomal protein L16 [Ktedonobacter racemifer DSM 44963]
          Length = 143

 Score =  201 bits (511), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 73/135 (54%), Positives = 95/135 (70%)

Query: 1   MLRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMK 60
           ML  P  TKY +Q +GR++G A  G+ + FG+F L+A E   + + +IE+AR A++R MK
Sbjct: 1   MLLAPSRTKYRRQHRGRMRGEATRGATLAFGDFGLQALEPCWMEARQIESARIAMTRYMK 60

Query: 61  RAGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFR 120
           R G+VWI VFPD P+TAKP E RMG GKG V+ WV  VKPGRI+FEI GVSEE+A+ A R
Sbjct: 61  RGGKVWIRVFPDKPITAKPAETRMGSGKGAVDHWVAVVKPGRIIFEIGGVSEEIAKEAIR 120

Query: 121 LGAAKLSVVTKFIQR 135
           L   KL V  +FI +
Sbjct: 121 LAIHKLPVKCRFITK 135


>gi|227499188|ref|ZP_03929323.1| 50S ribosomal protein L16 [Acidaminococcus sp. D21]
 gi|226904635|gb|EEH90553.1| 50S ribosomal protein L16 [Acidaminococcus sp. D21]
          Length = 152

 Score =  201 bits (511), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 67/135 (49%), Positives = 92/135 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  ++ KQ +GR+KG A  G+R+  G + L A E + I + +IEAAR A++R +KR
Sbjct: 1   MLLPKRVQHRKQHRGRMKGRAMRGNRVAHGEYGLVALEPSWITNRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVTAK    RMG GKG+ E WV  VKPGR++FE+ GV+EEVAR A RL
Sbjct: 61  GGQVWIQIFPDKPVTAKAAGSRMGSGKGSPEYWVAVVKPGRVMFEMAGVTEEVAREAMRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL + T+F+ + 
Sbjct: 121 AGNKLPIKTRFVSKE 135


>gi|229917351|ref|YP_002885997.1| 50S ribosomal protein L16 [Exiguobacterium sp. AT1b]
 gi|259645651|sp|C4KZN9|RL16_EXISA RecName: Full=50S ribosomal protein L16
 gi|229468780|gb|ACQ70552.1| ribosomal protein L16 [Exiguobacterium sp. AT1b]
          Length = 145

 Score =  201 bits (511), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 71/135 (52%), Positives = 94/135 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +  +G+++G AK G+ + FG F L+A EA+ I + +IE+AR A++R MKR
Sbjct: 1   MLLPKRVKYRRVHRGKMRGNAKRGTTVHFGEFGLQALEASWITNRQIESARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP  P T KP EVRMG GKG  E WV  VKPG+++FEI GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPHKPYTKKPLEVRMGSGKGAPEGWVAVVKPGKVMFEIAGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL V  KF++R 
Sbjct: 121 ASHKLPVKCKFVKRE 135


>gi|56961939|ref|YP_173661.1| 50S ribosomal protein L16 [Bacillus clausii KSM-K16]
 gi|81601104|sp|Q5WLQ5|RL16_BACSK RecName: Full=50S ribosomal protein L16
 gi|56908173|dbj|BAD62700.1| 50S ribosomal protein L16 [Bacillus clausii KSM-K16]
          Length = 145

 Score =  201 bits (511), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 74/135 (54%), Positives = 97/135 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY ++ +G+++G AKGG+ + FG F L+A EA+ I + +IEAAR A++R MKR
Sbjct: 1   MLMPKRVKYRREHRGKMRGRAKGGTEVHFGEFGLQALEASWITNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP  P TAKP EVRMG GKG  E WV  VKPG+I+FEI GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPSKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKIMFEISGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL +  KF++R 
Sbjct: 121 ASHKLPIKCKFVKRE 135


>gi|239825700|ref|YP_002948324.1| 50S ribosomal protein L16 [Geobacillus sp. WCH70]
 gi|259645965|sp|C5D3S4|RL16_GEOSW RecName: Full=50S ribosomal protein L16
 gi|239805993|gb|ACS23058.1| ribosomal protein L16 [Geobacillus sp. WCH70]
          Length = 144

 Score =  200 bits (510), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 73/135 (54%), Positives = 97/135 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY ++ +GR+KG AKGG+ + FG + L+A E+  I + +IEAARRA++R MKR
Sbjct: 1   MLMPKRVKYRREHRGRMKGRAKGGTEVHFGEYGLQALESAWITNRQIEAARRAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP  P TAKP EVRMG GKG  E WV  VKPG+++FE+ GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPSKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKVMFEVGGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL +  KF++R 
Sbjct: 121 ASHKLPIKCKFVKRE 135


>gi|17987047|ref|NP_539681.1| 50S ribosomal protein L16 [Brucella melitensis bv. 1 str. 16M]
 gi|23502103|ref|NP_698230.1| 50S ribosomal protein L16 [Brucella suis 1330]
 gi|62290137|ref|YP_221930.1| 50S ribosomal protein L16 [Brucella abortus bv. 1 str. 9-941]
 gi|82700060|ref|YP_414634.1| 50S ribosomal protein L16 [Brucella melitensis biovar Abortus 2308]
 gi|148559122|ref|YP_001259146.1| 50S ribosomal protein L16 [Brucella ovis ATCC 25840]
 gi|161619182|ref|YP_001593069.1| 50S ribosomal protein L16 [Brucella canis ATCC 23365]
 gi|163843492|ref|YP_001627896.1| 50S ribosomal protein L16 [Brucella suis ATCC 23445]
 gi|189024375|ref|YP_001935143.1| Ribosomal protein L16 [Brucella abortus S19]
 gi|225627696|ref|ZP_03785733.1| ribosomal protein L16 [Brucella ceti str. Cudo]
 gi|225852723|ref|YP_002732956.1| 50S ribosomal protein L16 [Brucella melitensis ATCC 23457]
 gi|237815645|ref|ZP_04594642.1| ribosomal protein L16 [Brucella abortus str. 2308 A]
 gi|254689446|ref|ZP_05152700.1| 50S ribosomal protein L16 [Brucella abortus bv. 6 str. 870]
 gi|254693931|ref|ZP_05155759.1| 50S ribosomal protein L16 [Brucella abortus bv. 3 str. Tulya]
 gi|254697581|ref|ZP_05159409.1| 50S ribosomal protein L16 [Brucella abortus bv. 2 str. 86/8/59]
 gi|254701967|ref|ZP_05163795.1| 50S ribosomal protein L16 [Brucella suis bv. 5 str. 513]
 gi|254704511|ref|ZP_05166339.1| 50S ribosomal protein L16 [Brucella suis bv. 3 str. 686]
 gi|254706593|ref|ZP_05168421.1| 50S ribosomal protein L16 [Brucella pinnipedialis M163/99/10]
 gi|254710297|ref|ZP_05172108.1| 50S ribosomal protein L16 [Brucella pinnipedialis B2/94]
 gi|254714294|ref|ZP_05176105.1| 50S ribosomal protein L16 [Brucella ceti M644/93/1]
 gi|254717731|ref|ZP_05179542.1| 50S ribosomal protein L16 [Brucella ceti M13/05/1]
 gi|254719284|ref|ZP_05181095.1| 50S ribosomal protein L16 [Brucella sp. 83/13]
 gi|254730475|ref|ZP_05189053.1| 50S ribosomal protein L16 [Brucella abortus bv. 4 str. 292]
 gi|256031791|ref|ZP_05445405.1| 50S ribosomal protein L16 [Brucella pinnipedialis M292/94/1]
 gi|256044876|ref|ZP_05447780.1| 50S ribosomal protein L16 [Brucella melitensis bv. 1 str. Rev.1]
 gi|256061306|ref|ZP_05451456.1| 50S ribosomal protein L16 [Brucella neotomae 5K33]
 gi|256113780|ref|ZP_05454584.1| 50S ribosomal protein L16 [Brucella melitensis bv. 3 str. Ether]
 gi|256159961|ref|ZP_05457679.1| 50S ribosomal protein L16 [Brucella ceti M490/95/1]
 gi|256255192|ref|ZP_05460728.1| 50S ribosomal protein L16 [Brucella ceti B1/94]
 gi|256257692|ref|ZP_05463228.1| 50S ribosomal protein L16 [Brucella abortus bv. 9 str. C68]
 gi|256263787|ref|ZP_05466319.1| ribosomal protein L16 [Brucella melitensis bv. 2 str. 63/9]
 gi|256369650|ref|YP_003107160.1| 50S ribosomal protein L16 [Brucella microti CCM 4915]
 gi|260168925|ref|ZP_05755736.1| 50S ribosomal protein L16 [Brucella sp. F5/99]
 gi|260546685|ref|ZP_05822424.1| ribosomal protein L16 [Brucella abortus NCTC 8038]
 gi|260565522|ref|ZP_05836006.1| ribosomal protein L16 [Brucella melitensis bv. 1 str. 16M]
 gi|260566245|ref|ZP_05836715.1| ribosomal protein L16 [Brucella suis bv. 4 str. 40]
 gi|260754969|ref|ZP_05867317.1| 50S ribosomal protein L16 [Brucella abortus bv. 6 str. 870]
 gi|260758185|ref|ZP_05870533.1| 50S ribosomal protein L16 [Brucella abortus bv. 4 str. 292]
 gi|260762011|ref|ZP_05874354.1| 50S ribosomal protein L16 [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883978|ref|ZP_05895592.1| 50S ribosomal protein L16 [Brucella abortus bv. 9 str. C68]
 gi|261214223|ref|ZP_05928504.1| 50S ribosomal protein L16 [Brucella abortus bv. 3 str. Tulya]
 gi|261219574|ref|ZP_05933855.1| 50S ribosomal protein L16 [Brucella ceti M13/05/1]
 gi|261222388|ref|ZP_05936669.1| 50S ribosomal protein L16 [Brucella ceti B1/94]
 gi|261314052|ref|ZP_05953249.1| 50S ribosomal protein L16 [Brucella pinnipedialis M163/99/10]
 gi|261317860|ref|ZP_05957057.1| 50S ribosomal protein L16 [Brucella pinnipedialis B2/94]
 gi|261322069|ref|ZP_05961266.1| 50S ribosomal protein L16 [Brucella ceti M644/93/1]
 gi|261325313|ref|ZP_05964510.1| 50S ribosomal protein L16 [Brucella neotomae 5K33]
 gi|261752535|ref|ZP_05996244.1| 50S ribosomal protein L16 [Brucella suis bv. 5 str. 513]
 gi|261755194|ref|ZP_05998903.1| 50S ribosomal protein L16 [Brucella suis bv. 3 str. 686]
 gi|261758418|ref|ZP_06002127.1| ribosomal protein L16 [Brucella sp. F5/99]
 gi|265984284|ref|ZP_06097019.1| 50S ribosomal protein L16 [Brucella sp. 83/13]
 gi|265988889|ref|ZP_06101446.1| 50S ribosomal protein L16 [Brucella pinnipedialis M292/94/1]
 gi|265991303|ref|ZP_06103860.1| 50S ribosomal protein L16 [Brucella melitensis bv. 1 str. Rev.1]
 gi|265995140|ref|ZP_06107697.1| 50S ribosomal protein L16 [Brucella melitensis bv. 3 str. Ether]
 gi|265998353|ref|ZP_06110910.1| 50S ribosomal protein L16 [Brucella ceti M490/95/1]
 gi|294852563|ref|ZP_06793236.1| 50S ribosomal protein L16 [Brucella sp. NVSL 07-0026]
 gi|297248532|ref|ZP_06932250.1| 50S ribosomal protein L16 [Brucella abortus bv. 5 str. B3196]
 gi|306838036|ref|ZP_07470894.1| ribosomal protein L16 [Brucella sp. NF 2653]
 gi|306840308|ref|ZP_07473080.1| ribosomal protein L16 [Brucella sp. BO2]
 gi|306844130|ref|ZP_07476724.1| ribosomal protein L16 [Brucella sp. BO1]
 gi|81752496|sp|Q8G081|RL16_BRUSU RecName: Full=50S ribosomal protein L16
 gi|81852034|sp|Q8YHN3|RL16_BRUME RecName: Full=50S ribosomal protein L16
 gi|88930451|sp|P0C0Z4|RL16_BRUA2 RecName: Full=50S ribosomal protein L16
 gi|90109933|sp|P0C0Z3|RL16_BRUAB RecName: Full=50S ribosomal protein L16
 gi|166234552|sp|A5VQZ9|RL16_BRUO2 RecName: Full=50S ribosomal protein L16
 gi|189041448|sp|A9M5P3|RL16_BRUC2 RecName: Full=50S ribosomal protein L16
 gi|189041449|sp|B0CH25|RL16_BRUSI RecName: Full=50S ribosomal protein L16
 gi|226710687|sp|B2S672|RL16_BRUA1 RecName: Full=50S ribosomal protein L16
 gi|254799184|sp|C0RJJ4|RL16_BRUMB RecName: Full=50S ribosomal protein L16
 gi|17982703|gb|AAL51945.1| lsu ribosomal protein l16p [Brucella melitensis bv. 1 str. 16M]
 gi|23348063|gb|AAN30145.1| ribosomal protein L16 [Brucella suis 1330]
 gi|62196269|gb|AAX74569.1| RplP, ribosomal protein L16 [Brucella abortus bv. 1 str. 9-941]
 gi|82616161|emb|CAJ11204.1| Ribosomal protein L16 [Brucella melitensis biovar Abortus 2308]
 gi|148370379|gb|ABQ60358.1| ribosomal protein L16 [Brucella ovis ATCC 25840]
 gi|161335993|gb|ABX62298.1| ribosomal protein L16 [Brucella canis ATCC 23365]
 gi|163674215|gb|ABY38326.1| ribosomal protein L16 [Brucella suis ATCC 23445]
 gi|189019947|gb|ACD72669.1| Ribosomal protein L16 [Brucella abortus S19]
 gi|225617701|gb|EEH14746.1| ribosomal protein L16 [Brucella ceti str. Cudo]
 gi|225641088|gb|ACO01002.1| ribosomal protein L16 [Brucella melitensis ATCC 23457]
 gi|237788943|gb|EEP63154.1| ribosomal protein L16 [Brucella abortus str. 2308 A]
 gi|255999812|gb|ACU48211.1| 50S ribosomal protein L16 [Brucella microti CCM 4915]
 gi|260095735|gb|EEW79612.1| ribosomal protein L16 [Brucella abortus NCTC 8038]
 gi|260151590|gb|EEW86684.1| ribosomal protein L16 [Brucella melitensis bv. 1 str. 16M]
 gi|260155763|gb|EEW90843.1| ribosomal protein L16 [Brucella suis bv. 4 str. 40]
 gi|260668503|gb|EEX55443.1| 50S ribosomal protein L16 [Brucella abortus bv. 4 str. 292]
 gi|260672443|gb|EEX59264.1| 50S ribosomal protein L16 [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675077|gb|EEX61898.1| 50S ribosomal protein L16 [Brucella abortus bv. 6 str. 870]
 gi|260873506|gb|EEX80575.1| 50S ribosomal protein L16 [Brucella abortus bv. 9 str. C68]
 gi|260915830|gb|EEX82691.1| 50S ribosomal protein L16 [Brucella abortus bv. 3 str. Tulya]
 gi|260920972|gb|EEX87625.1| 50S ribosomal protein L16 [Brucella ceti B1/94]
 gi|260924663|gb|EEX91231.1| 50S ribosomal protein L16 [Brucella ceti M13/05/1]
 gi|261294759|gb|EEX98255.1| 50S ribosomal protein L16 [Brucella ceti M644/93/1]
 gi|261297083|gb|EEY00580.1| 50S ribosomal protein L16 [Brucella pinnipedialis B2/94]
 gi|261301293|gb|EEY04790.1| 50S ribosomal protein L16 [Brucella neotomae 5K33]
 gi|261303078|gb|EEY06575.1| 50S ribosomal protein L16 [Brucella pinnipedialis M163/99/10]
 gi|261738402|gb|EEY26398.1| ribosomal protein L16 [Brucella sp. F5/99]
 gi|261742288|gb|EEY30214.1| 50S ribosomal protein L16 [Brucella suis bv. 5 str. 513]
 gi|261744947|gb|EEY32873.1| 50S ribosomal protein L16 [Brucella suis bv. 3 str. 686]
 gi|262552821|gb|EEZ08811.1| 50S ribosomal protein L16 [Brucella ceti M490/95/1]
 gi|262766253|gb|EEZ12042.1| 50S ribosomal protein L16 [Brucella melitensis bv. 3 str. Ether]
 gi|263002087|gb|EEZ14662.1| 50S ribosomal protein L16 [Brucella melitensis bv. 1 str. Rev.1]
 gi|263093915|gb|EEZ17849.1| ribosomal protein L16 [Brucella melitensis bv. 2 str. 63/9]
 gi|264661086|gb|EEZ31347.1| 50S ribosomal protein L16 [Brucella pinnipedialis M292/94/1]
 gi|264662876|gb|EEZ33137.1| 50S ribosomal protein L16 [Brucella sp. 83/13]
 gi|294821152|gb|EFG38151.1| 50S ribosomal protein L16 [Brucella sp. NVSL 07-0026]
 gi|297175701|gb|EFH35048.1| 50S ribosomal protein L16 [Brucella abortus bv. 5 str. B3196]
 gi|306275573|gb|EFM57305.1| ribosomal protein L16 [Brucella sp. BO1]
 gi|306289707|gb|EFM60896.1| ribosomal protein L16 [Brucella sp. BO2]
 gi|306406960|gb|EFM63181.1| ribosomal protein L16 [Brucella sp. NF 2653]
 gi|326409248|gb|ADZ66313.1| Ribosomal protein L16 [Brucella melitensis M28]
 gi|326538956|gb|ADZ87171.1| ribosomal protein L16 [Brucella melitensis M5-90]
          Length = 137

 Score =  200 bits (510), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 91/137 (66%), Positives = 112/137 (81%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQFKGRI G +KGG+ + FG F LKA E  R+ + +IEAARRAI+R MKR
Sbjct: 1   MMQPKRTKFRKQFKGRIHGNSKGGTDLNFGAFGLKALEPERVTARQIEAARRAITRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AGRVWI +FPD+PVT+KPTEVRMGKGKG+V+ W CRV PGR++FE+DGV E+VAR A RL
Sbjct: 61  AGRVWIRIFPDLPVTSKPTEVRMGKGKGSVDYWACRVAPGRVMFELDGVPEDVAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
           GAAKL + T+FIQR+ E
Sbjct: 121 GAAKLPIKTRFIQRIAE 137


>gi|124026701|ref|YP_001015816.1| 50S ribosomal protein L16 [Prochlorococcus marinus str. NATL1A]
 gi|166199702|sp|A2C4Z2|RL16_PROM1 RecName: Full=50S ribosomal protein L16
 gi|123961769|gb|ABM76552.1| 50S ribosomal protein L16 [Prochlorococcus marinus str. NATL1A]
          Length = 161

 Score =  200 bits (510), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 73/135 (54%), Positives = 97/135 (71%), Gaps = 2/135 (1%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ KQ +GR++GVA  G++I FG FAL+AQ+   + S +IEA+RRA++R +KR
Sbjct: 1   MLSPKRTKFRKQQRGRMRGVATRGNKIAFGQFALQAQDCGWVTSRQIEASRRAMTRYVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDG--VSEEVARRAF 119
            G++WI +FPD PVT +P E RMG GKGN E WV  VKPGRILFE+ G  ++E +A+ A 
Sbjct: 61  GGQIWIRIFPDKPVTMRPAETRMGSGKGNPEFWVAVVKPGRILFEMGGDEITETIAKEAM 120

Query: 120 RLGAAKLSVVTKFIQ 134
           RL   KL V TKFI 
Sbjct: 121 RLAQYKLPVKTKFIS 135


>gi|284929568|ref|YP_003422090.1| 50S ribosomal protein L16P [cyanobacterium UCYN-A]
 gi|284810012|gb|ADB95709.1| LSU ribosomal protein L16P [cyanobacterium UCYN-A]
          Length = 139

 Score =  200 bits (510), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 70/133 (52%), Positives = 95/133 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ KQ +GR++G+A  GS + FG +AL+A E   I + +IEAARRA++R ++R
Sbjct: 1   MLSPKRTKFRKQQRGRMRGLAYRGSTLNFGEYALQAIEPCWITARQIEAARRAMTRYIRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVT +  E RMG GKG+ E WV  VKPGRI+FE+ GV+E +AR A RL
Sbjct: 61  GGKIWIRIFPDKPVTMRAAETRMGSGKGSPEYWVAVVKPGRIMFELSGVTEPIAREAMRL 120

Query: 122 GAAKLSVVTKFIQ 134
            A KL + TKFI 
Sbjct: 121 AAQKLPIKTKFIT 133


>gi|219849880|ref|YP_002464313.1| 50S ribosomal protein L16 [Chloroflexus aggregans DSM 9485]
 gi|254799189|sp|B8G6R8|RL16_CHLAD RecName: Full=50S ribosomal protein L16
 gi|219544139|gb|ACL25877.1| ribosomal protein L16 [Chloroflexus aggregans DSM 9485]
          Length = 151

 Score =  200 bits (510), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 70/135 (51%), Positives = 89/135 (65%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY K  KGR  G++  G+ + FG + L A E + I S +IEAARRAI+  +KR
Sbjct: 1   MLLPKRTKYRKMQKGRSHGLSYRGNSVAFGEYGLMALEPSWISSRQIEAARRAITNYVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T KP E RMG GKG+V+ WV  VKPGRI+FE+ GV E++A  A R 
Sbjct: 61  GGKVWIRIFPDKPITRKPAETRMGGGKGSVDHWVAVVKPGRIMFELAGVREDIAHEALRR 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL V  K I R 
Sbjct: 121 AAQKLPVKCKVIDRE 135


>gi|317131376|ref|YP_004090690.1| ribosomal protein L16 [Ethanoligenens harbinense YUAN-3]
 gi|315469355|gb|ADU25959.1| ribosomal protein L16 [Ethanoligenens harbinense YUAN-3]
          Length = 142

 Score =  200 bits (510), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 67/135 (49%), Positives = 91/135 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ +Q +GR+ G A  G+ + +G + ++A E   I S++IEAAR A++R  KR
Sbjct: 1   MLMPKRVKFRRQQRGRLTGRALRGNTVTYGEYGIQALEPAWITSNQIEAARIAMTRFTKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP  P+T KP E RMG GKG+ E WV  VKPGRILFEI GVSEE+AR A RL
Sbjct: 61  GGQVWIKIFPHKPITEKPAETRMGSGKGSPEYWVAVVKPGRILFEIGGVSEEIAREATRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  KF+++ 
Sbjct: 121 AMYKLPIKCKFVKKE 135


>gi|72382960|ref|YP_292315.1| 50S ribosomal protein L16 [Prochlorococcus marinus str. NATL2A]
 gi|85541815|sp|Q46IR6|RL16_PROMT RecName: Full=50S ribosomal protein L16
 gi|72002810|gb|AAZ58612.1| LSU ribosomal protein L16P [Prochlorococcus marinus str. NATL2A]
          Length = 161

 Score =  200 bits (510), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 73/135 (54%), Positives = 97/135 (71%), Gaps = 2/135 (1%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ KQ +GR++GVA  G++I FG FAL+AQ+   + S +IEA+RRA++R +KR
Sbjct: 1   MLSPKRTKFRKQQRGRMRGVATRGNKIAFGQFALQAQDCGWVTSRQIEASRRAMTRYVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDG--VSEEVARRAF 119
            G++WI +FPD PVT +P E RMG GKGN E WV  VKPGRILFE+ G  ++E +A+ A 
Sbjct: 61  GGQIWIRIFPDKPVTMRPAETRMGSGKGNPEFWVAVVKPGRILFEMGGDEITEAIAKEAM 120

Query: 120 RLGAAKLSVVTKFIQ 134
           RL   KL V TKFI 
Sbjct: 121 RLAQYKLPVKTKFIS 135


>gi|220906726|ref|YP_002482037.1| 50S ribosomal protein L16 [Cyanothece sp. PCC 7425]
 gi|254799196|sp|B8HMR1|RL16_CYAP4 RecName: Full=50S ribosomal protein L16
 gi|219863337|gb|ACL43676.1| ribosomal protein L16 [Cyanothece sp. PCC 7425]
          Length = 140

 Score =  200 bits (509), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 70/135 (51%), Positives = 95/135 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+ TK+ KQ +GR++G A  G+ + FG++ L+A E   I + +IEA RRA++R ++R
Sbjct: 1   MLSPRRTKFRKQQRGRMEGAATRGNTLTFGDYGLQALEPAWITARQIEAGRRAMTRYIRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVT +P E RMG GKG  E WV  VKPGRI++EI GVSEEVAR A RL
Sbjct: 61  GGKIWIRLFPDKPVTMRPAETRMGSGKGAPEFWVAVVKPGRIMYEIAGVSEEVAREAIRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A K+ + TKFI R 
Sbjct: 121 AAYKMPIKTKFIMRE 135


>gi|160947693|ref|ZP_02094860.1| hypothetical protein PEPMIC_01628 [Parvimonas micra ATCC 33270]
 gi|158446827|gb|EDP23822.1| hypothetical protein PEPMIC_01628 [Parvimonas micra ATCC 33270]
          Length = 144

 Score =  200 bits (509), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 71/137 (51%), Positives = 96/137 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +  +GR+ G A  G+ I +G++A++A E   + +++IE+ARRA++R +KR
Sbjct: 1   MLMPKRVKYRRVHRGRMTGKALRGNTISYGDYAIQALEPCWMTANQIESARRAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD PVT KP EVRMG GKG  E WV  VKPGR+LFE+ GV  +VAR A RL
Sbjct: 61  GGKIWIKVFPDKPVTKKPAEVRMGSGKGAPEYWVAVVKPGRVLFEMSGVPVDVAREAMRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            A KL V TKFI R ++
Sbjct: 121 AAHKLPVKTKFITREMK 137


>gi|291542042|emb|CBL15152.1| LSU ribosomal protein L16P [Ruminococcus bromii L2-63]
          Length = 139

 Score =  200 bits (509), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 68/135 (50%), Positives = 92/135 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +  +GR+ G A  G+++ +G+F L+A E   I S++IEAAR A++R  KR
Sbjct: 1   MLLPKRVKYRRVHRGRMTGKALRGNKVTYGDFGLQATEPAWITSNQIEAARVAMTRYCKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVTAKP E RMG GKG+ E WV  VKPGR++FE+ GV E  AR A RL
Sbjct: 61  FGKVWIKIFPDKPVTAKPAETRMGSGKGSPEYWVAVVKPGRVMFELGGVDEATAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL +  KF+++ 
Sbjct: 121 AANKLPIKCKFVKKE 135


>gi|288554732|ref|YP_003426667.1| 50S ribosomal protein L16 [Bacillus pseudofirmus OF4]
 gi|288545892|gb|ADC49775.1| 50S ribosomal protein L16 [Bacillus pseudofirmus OF4]
          Length = 144

 Score =  200 bits (509), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 74/135 (54%), Positives = 97/135 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY ++ +G+++G AKGG+ + FG + L+A EA+ I + +IEAAR A++R MKR
Sbjct: 1   MLMPKRVKYRREHRGKMRGRAKGGTEVHFGEYGLQALEASWITNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP  P TAKP EVRMG GKG  E WV  VKPG+I+FEI GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPSKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKIMFEISGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL V  KF++R 
Sbjct: 121 ASHKLPVKCKFVKRE 135


>gi|330993853|ref|ZP_08317785.1| 50S ribosomal protein L16 [Gluconacetobacter sp. SXCC-1]
 gi|329759121|gb|EGG75633.1| 50S ribosomal protein L16 [Gluconacetobacter sp. SXCC-1]
          Length = 138

 Score =  200 bits (509), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 88/137 (64%), Positives = 104/137 (75%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY K  KGRI G+AKGG+ + FG F LKA +  RI + +IEAARRAI+R MKR
Sbjct: 1   MLSPKRTKYRKAHKGRIHGLAKGGTTLNFGAFGLKALQPERITARQIEAARRAITRAMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AGRVWI +FPD+PV+ KP EVRMG GKG+ E WV RVKPGRILFEI+GV  EVAR A  L
Sbjct: 61  AGRVWIRIFPDLPVSTKPAEVRMGSGKGSPEYWVARVKPGRILFEIEGVPPEVAREALAL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
           GAAKL + TKF+ R+ E
Sbjct: 121 GAAKLPIKTKFVTRIGE 137


>gi|330850876|ref|YP_004376626.1| 50S ribosomal protein L16 [Fistulifera sp. JPCC DA0580]
 gi|328835696|dbj|BAK18992.1| 50S ribosomal protein L16 [Fistulifera sp. JPCC DA0580]
          Length = 138

 Score =  200 bits (509), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 74/134 (55%), Positives = 90/134 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY K  +GR++G    G+ +CFGNF L+A E + I S +IEAARR I+R  KR
Sbjct: 1   MLSPKRTKYRKYHRGRMRGTKTRGNEVCFGNFGLQALEPSWITSRQIEAARRTITRYTKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
              +WI +FPD  VTA+  E RMG GKG V+ WVC VKPG ILFEI  V EEVAR AF L
Sbjct: 61  GASLWIRIFPDKTVTARAAESRMGSGKGAVDYWVCVVKPGTILFEISSVPEEVARAAFNL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + TKFI +
Sbjct: 121 AAYKLPIKTKFIIK 134


>gi|312144240|ref|YP_003995686.1| ribosomal protein L16 [Halanaerobium sp. 'sapolanicus']
 gi|311904891|gb|ADQ15332.1| ribosomal protein L16 [Halanaerobium sp. 'sapolanicus']
          Length = 144

 Score =  200 bits (509), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 75/135 (55%), Positives = 94/135 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQ +GR+KG A  G+ I FG + L+A E   I + +IEAAR A++R +KR
Sbjct: 1   MLVPKRVKHRKQMRGRMKGKAVRGTEITFGEYGLQALEPVWITNRQIEAARVALTRSIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVTAKP E RMG GKG  EKWV  VKPGRI+FE+ GV EEVAR A RL
Sbjct: 61  GGKVWIKIFPDKPVTAKPAETRMGSGKGAPEKWVAVVKPGRIMFELAGVPEEVAREAMRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL + TKF+ R 
Sbjct: 121 ASHKLPIKTKFVARE 135


>gi|226309815|ref|YP_002769709.1| 50S ribosomal protein L16 [Brevibacillus brevis NBRC 100599]
 gi|254799183|sp|C0ZII7|RL16_BREBN RecName: Full=50S ribosomal protein L16
 gi|226092763|dbj|BAH41205.1| 50S ribosomal protein L16 [Brevibacillus brevis NBRC 100599]
          Length = 144

 Score =  200 bits (509), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 71/135 (52%), Positives = 96/135 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQ +G++ G AKGG+ + FG + L+A E + + + +IEAAR A++R +KR
Sbjct: 1   MLTPKRVKHRKQHRGKMAGNAKGGTTVAFGEYGLQAMEPSWVTNRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT KP EVRMG GKG+ EKWV  VKPG+I+FE+ GV EEVAR A RL
Sbjct: 61  GGKVWIKIFPDKPVTQKPLEVRMGSGKGSPEKWVAVVKPGKIMFELAGVPEEVAREAMRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  KF++R 
Sbjct: 121 AMHKLPIKCKFVKRE 135


>gi|205372062|ref|ZP_03224879.1| 50S ribosomal protein L16 [Bacillus coahuilensis m4-4]
          Length = 144

 Score =  200 bits (509), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 74/135 (54%), Positives = 96/135 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +Q +G+++G AKGG+ + FG F L+A  A  I + +IE+AR A++R MKR
Sbjct: 1   MLLPKRVKYRRQHRGKMRGNAKGGTEVSFGEFGLQATTAGWITNRQIESARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP  P TAKP EVRMG GKG  E WV  VKPG+++FEI GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPHKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKVMFEIAGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL V TKF++R 
Sbjct: 121 ASHKLPVQTKFVKRE 135


>gi|158337817|ref|YP_001518993.1| 50S ribosomal protein L16 [Acaryochloris marina MBIC11017]
 gi|189041444|sp|B0C1E0|RL16_ACAM1 RecName: Full=50S ribosomal protein L16
 gi|158308058|gb|ABW29675.1| 50S ribosomal protein L16 [Acaryochloris marina MBIC11017]
          Length = 139

 Score =  200 bits (509), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 67/137 (48%), Positives = 95/137 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+ TK+ KQ +GR++G A  G+ + FG++ L+A E + I S +IEA RRA++R ++R
Sbjct: 1   MLSPRKTKFRKQHRGRMRGKATRGNTLSFGDYGLQALEPSWITSRQIEAGRRAMTRYVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVT +P E RMG GKG  E WV  VKPGRI++E++GV E  AR A RL
Sbjct: 61  GGKIWIRIFPDKPVTMRPAETRMGSGKGAPEYWVAVVKPGRIMYEMNGVPESTAREAMRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            A K+ + TKF+ R  E
Sbjct: 121 AAFKMPIKTKFVARPKE 137


>gi|114327225|ref|YP_744382.1| 50S ribosomal protein L16 [Granulibacter bethesdensis CGDNIH1]
 gi|122327796|sp|Q0BUP3|RL16_GRABC RecName: Full=50S ribosomal protein L16
 gi|114315399|gb|ABI61459.1| LSU ribosomal protein L16P [Granulibacter bethesdensis CGDNIH1]
          Length = 138

 Score =  199 bits (508), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 87/137 (63%), Positives = 103/137 (75%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY K  KGRI G AKGG+ + FG F LKA E  RI + +IEAARRAI+R MKR
Sbjct: 1   MLSPKRTKYRKAHKGRIHGNAKGGTTLNFGTFGLKALEPERITARQIEAARRAITRAMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AGRVWI +FPD+PV+ KP EVRMG GKG+ E WV RV PGR++FEIDGV+ E+AR A  L
Sbjct: 61  AGRVWIRIFPDLPVSTKPAEVRMGSGKGSPEYWVARVHPGRVMFEIDGVAPELAREALAL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
           GAAKL + TKFI R V+
Sbjct: 121 GAAKLPIKTKFIVRSVD 137


>gi|124024002|ref|YP_001018309.1| 50S ribosomal protein L16 [Prochlorococcus marinus str. MIT 9303]
 gi|166199703|sp|A2CC34|RL16_PROM3 RecName: Full=50S ribosomal protein L16
 gi|123964288|gb|ABM79044.1| 50S ribosomal protein L16 [Prochlorococcus marinus str. MIT 9303]
          Length = 158

 Score =  199 bits (508), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 74/134 (55%), Positives = 96/134 (71%), Gaps = 2/134 (1%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQ +GR++GVA  G+ I FG FAL+AQE   I S +IEA+RRA++R +KR
Sbjct: 1   MLSPKRVKFRKQQRGRMRGVATRGNTIAFGEFALQAQECGWITSRQIEASRRAMTRYVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDG--VSEEVARRAF 119
            G++WI +FPD PVT +P E RMG GKGN E WV  +KPGRILFE+ G  ++EE+AR A 
Sbjct: 61  GGKIWIRIFPDKPVTMRPAETRMGSGKGNPEFWVAVIKPGRILFEMGGEEITEEIAREAM 120

Query: 120 RLGAAKLSVVTKFI 133
           RL   KL + TKFI
Sbjct: 121 RLAQYKLPIKTKFI 134


>gi|158424171|ref|YP_001525463.1| 50S ribosomal protein L16 [Azorhizobium caulinodans ORS 571]
 gi|172047983|sp|A8IAR0|RL16_AZOC5 RecName: Full=50S ribosomal protein L16
 gi|158331060|dbj|BAF88545.1| ribosomal protein L16 [Azorhizobium caulinodans ORS 571]
          Length = 137

 Score =  199 bits (508), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 91/137 (66%), Positives = 108/137 (78%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQFKGRI GVAKGG+ + FG F LKA E  R+ + +IEAARRA++R MKR
Sbjct: 1   MLQPKRTKFRKQFKGRIHGVAKGGTELNFGEFGLKALEPERVTARQIEAARRALTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AGRVWI VFPDVPVT+KPTEVRMGKGKG  E W  +VKPGRI+FEIDGV  ++AR A  L
Sbjct: 61  AGRVWIRVFPDVPVTSKPTEVRMGKGKGAPEYWAAKVKPGRIMFEIDGVPVDLAREALTL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            AAKL + T+FIQR+ E
Sbjct: 121 AAAKLPIKTRFIQRIAE 137


>gi|56418648|ref|YP_145966.1| 50S ribosomal protein L16 [Geobacillus kaustophilus HTA426]
 gi|261417614|ref|YP_003251296.1| 50S ribosomal protein L16 [Geobacillus sp. Y412MC61]
 gi|297528489|ref|YP_003669764.1| ribosomal protein L16 [Geobacillus sp. C56-T3]
 gi|319765272|ref|YP_004130773.1| ribosomal protein L16 [Geobacillus sp. Y412MC52]
 gi|81558140|sp|Q5L416|RL16_GEOKA RecName: Full=50S ribosomal protein L16
 gi|56378490|dbj|BAD74398.1| 50S ribosomal protein L16 [Geobacillus kaustophilus HTA426]
 gi|261374071|gb|ACX76814.1| ribosomal protein L16 [Geobacillus sp. Y412MC61]
 gi|297251741|gb|ADI25187.1| ribosomal protein L16 [Geobacillus sp. C56-T3]
 gi|317110138|gb|ADU92630.1| ribosomal protein L16 [Geobacillus sp. Y412MC52]
          Length = 141

 Score =  199 bits (508), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 73/135 (54%), Positives = 97/135 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY ++ +GR+KG AKGG+ + FG F L+A E+  I + +IEAARRA++R M+R
Sbjct: 1   MLMPKRVKYRREHRGRMKGRAKGGTEVHFGEFGLQALESAWITNRQIEAARRAMTRYMRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP  P TAKP EVRMG GKG  E WV  VKPG+++FE+ GVSEEVAR A RL
Sbjct: 61  GGKVWIRIFPSKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKVMFEVGGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL +  KF++R 
Sbjct: 121 ASHKLPIKCKFVKRE 135


>gi|254486945|ref|ZP_05100150.1| ribosomal protein L16 [Roseobacter sp. GAI101]
 gi|214043814|gb|EEB84452.1| ribosomal protein L16 [Roseobacter sp. GAI101]
          Length = 137

 Score =  199 bits (508), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 84/135 (62%), Positives = 107/135 (79%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQ KG+IKG+AKGGS + FG F LKA E  R+ + +IEAARRA++R MKR
Sbjct: 1   MLQPKRTKFRKQHKGKIKGLAKGGSDLNFGTFGLKALEPERVTARQIEAARRAMTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPD+PVT+KPTEVRMGKGKG+V+ W CRVKPGR++FEIDGV+E++A  A RL
Sbjct: 61  QGRVWIRIFPDLPVTSKPTEVRMGKGKGSVDYWACRVKPGRVMFEIDGVNEDIAHEALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL + T+ + R 
Sbjct: 121 AAMKLPIKTRVVVRE 135


>gi|49474397|ref|YP_032439.1| 50S ribosomal protein L16 [Bartonella quintana str. Toulouse]
 gi|81646967|sp|Q6FZC9|RL16_BARQU RecName: Full=50S ribosomal protein L16
 gi|49239901|emb|CAF26299.1| 50s ribosomal protein l16 [Bartonella quintana str. Toulouse]
          Length = 137

 Score =  199 bits (508), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 92/137 (67%), Positives = 111/137 (81%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK T++ KQFKGRI GV+KGG+ + FG + LKA E  RI + +IEAARRAI+R MKR
Sbjct: 1   MLQPKRTRFRKQFKGRIHGVSKGGTDLNFGAYGLKAVEPERITARQIEAARRAITRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           +GRVWI +FPD+PVT+KPTEVRMGKGKG VE W  RV PGRI+FEIDGV E+VAR A RL
Sbjct: 61  SGRVWIRIFPDLPVTSKPTEVRMGKGKGGVEYWAARVAPGRIIFEIDGVLEDVAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
           GAAKL + T+FIQR+ E
Sbjct: 121 GAAKLPIKTRFIQRLAE 137


>gi|320094573|ref|ZP_08026339.1| 50S ribosomal protein L16 [Actinomyces sp. oral taxon 178 str.
           F0338]
 gi|319978488|gb|EFW10065.1| 50S ribosomal protein L16 [Actinomyces sp. oral taxon 178 str.
           F0338]
          Length = 139

 Score =  199 bits (508), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 65/135 (48%), Positives = 88/135 (65%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+ TKY KQ +    G A GG+ + FG++ ++A E   I + +IEAAR A++R +KR
Sbjct: 1   MLIPRRTKYRKQHRPHRTGFATGGTELAFGDYGIQALEGAYITNRQIEAARIAVTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T KP E RMG GKG  E WV  VKPGRILFE+ GV EE+AR A   
Sbjct: 61  GGKVWINIFPDRPLTKKPAETRMGSGKGAPEWWVAPVKPGRILFELSGVPEELAREALSR 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL + ++F+ R 
Sbjct: 121 AQHKLPIKSRFVVRE 135


>gi|116748997|ref|YP_845684.1| 50S ribosomal protein L16 [Syntrophobacter fumaroxidans MPOB]
 gi|166216118|sp|A0LIJ7|RL16_SYNFM RecName: Full=50S ribosomal protein L16
 gi|116698061|gb|ABK17249.1| LSU ribosomal protein L16P [Syntrophobacter fumaroxidans MPOB]
          Length = 138

 Score =  199 bits (507), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 72/135 (53%), Positives = 90/135 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQ KGR++G A  GS + FG+F LKA E   I S +IEAAR AI+R +KR
Sbjct: 1   MLAPKRVKFRKQQKGRMRGTAFRGSTLSFGDFGLKALECGYITSRQIEAARIAITRHVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI  FPD P T KP E RMGKGKG+ E W   +KPGR+L+EI GV E +AR A  L
Sbjct: 61  GGKVWIRFFPDKPFTKKPAETRMGKGKGSPEGWHAVIKPGRVLYEIKGVPETIAREALNL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL + T+F+ R 
Sbjct: 121 AAHKLPIPTRFVSRQ 135


>gi|153009293|ref|YP_001370508.1| 50S ribosomal protein L16 [Ochrobactrum anthropi ATCC 49188]
 gi|239832115|ref|ZP_04680444.1| ribosomal protein L16 [Ochrobactrum intermedium LMG 3301]
 gi|166199695|sp|A6X0C5|RL16_OCHA4 RecName: Full=50S ribosomal protein L16
 gi|151561181|gb|ABS14679.1| ribosomal protein L16 [Ochrobactrum anthropi ATCC 49188]
 gi|239824382|gb|EEQ95950.1| ribosomal protein L16 [Ochrobactrum intermedium LMG 3301]
          Length = 137

 Score =  199 bits (507), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 91/137 (66%), Positives = 112/137 (81%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQFKGRI G +KGG+ + FG F LKA E  R+ + +IEAARRAI+R MKR
Sbjct: 1   MMQPKRTKFRKQFKGRIHGNSKGGTDLNFGAFGLKAVEPERVTARQIEAARRAITRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AGRVWI +FPD+PVT+KPTEVRMGKGKG+V+ W CRV PGR++FE+DGV E+VAR A RL
Sbjct: 61  AGRVWIRIFPDLPVTSKPTEVRMGKGKGSVDYWACRVAPGRVMFELDGVPEDVAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
           GAAKL + T+FIQR+ E
Sbjct: 121 GAAKLPIKTRFIQRIAE 137


>gi|284049250|ref|YP_003399589.1| ribosomal protein L16 [Acidaminococcus fermentans DSM 20731]
 gi|283953471|gb|ADB48274.1| ribosomal protein L16 [Acidaminococcus fermentans DSM 20731]
          Length = 152

 Score =  199 bits (507), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 67/135 (49%), Positives = 92/135 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  ++ KQ +GR+KG A  G+R+  G F L A E + I + +IEAAR A++R +KR
Sbjct: 1   MLLPKRVQHRKQHRGRMKGRAMRGNRVAHGQFGLVALEPSWITNRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVTAK    RMG GKG+ E WV  VKPGR+LFE+ GV+EE+A+ A RL
Sbjct: 61  GGQVWIQIFPDKPVTAKAAGSRMGSGKGSPEYWVAVVKPGRVLFEMAGVTEEIAKEAMRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL + T+F+ + 
Sbjct: 121 AGNKLPIKTRFVTKE 135


>gi|291547989|emb|CBL21097.1| LSU ribosomal protein L16P [Ruminococcus sp. SR1/5]
          Length = 145

 Score =  199 bits (507), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 73/134 (54%), Positives = 91/134 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K  KQF+G ++G A  G+ I +G+F L A E   I S++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKRRKQFRGSMRGKALRGNVINYGDFGLVATEPCWIRSNQIEAARVAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVTAKP E RMG GKG +E WV  VKPGR++FEI GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPDKPVTAKPAETRMGSGKGALEYWVAVVKPGRVMFEIAGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL    K + R
Sbjct: 121 AMHKLPCKCKIVSR 134


>gi|315605906|ref|ZP_07880937.1| 50S ribosomal protein L16 [Actinomyces sp. oral taxon 180 str.
           F0310]
 gi|315312188|gb|EFU60274.1| 50S ribosomal protein L16 [Actinomyces sp. oral taxon 180 str.
           F0310]
          Length = 139

 Score =  199 bits (507), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 64/135 (47%), Positives = 89/135 (65%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+ TKY KQ +    G A GG+ + FG++ ++A E+  I + +IEAAR A++R +KR
Sbjct: 1   MLIPRRTKYRKQHRPHRTGFASGGTELAFGDYGIQALESAYITNRQIEAARIAVTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T KP E RMG GKG  E WV  VKPGR++FE+ GV EE+AR A   
Sbjct: 61  GGKVWINIFPDRPLTKKPAETRMGSGKGAPEWWVAPVKPGRVMFELAGVPEELAREALSR 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL + T+F+ R 
Sbjct: 121 AQHKLPIKTRFVVRE 135


>gi|138893792|ref|YP_001124245.1| 50S ribosomal protein L16 [Geobacillus thermodenitrificans NG80-2]
 gi|196251017|ref|ZP_03149699.1| ribosomal protein L16 [Geobacillus sp. G11MC16]
 gi|166234583|sp|A4IJJ6|RL16_GEOTN RecName: Full=50S ribosomal protein L16
 gi|134265305|gb|ABO65500.1| 50S ribosomal protein L16 [Geobacillus thermodenitrificans NG80-2]
 gi|196209489|gb|EDY04266.1| ribosomal protein L16 [Geobacillus sp. G11MC16]
          Length = 141

 Score =  199 bits (507), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 74/135 (54%), Positives = 97/135 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY ++ +GR+KG AKGG+ + FG F L+A E+  I + +IEAARRA++R MKR
Sbjct: 1   MLMPKRVKYRREHRGRMKGRAKGGTEVHFGEFGLQALESAWITNRQIEAARRAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP  P TAKP EVRMG GKG  E WV  VKPG+++FE+ GVSEEVAR A RL
Sbjct: 61  GGKVWIRIFPSKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKVMFEVAGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL +  KF++R 
Sbjct: 121 ASHKLPIKCKFVKRE 135


>gi|299143187|ref|ZP_07036267.1| ribosomal protein L16 [Peptoniphilus sp. oral taxon 386 str. F0131]
 gi|298517672|gb|EFI41411.1| ribosomal protein L16 [Peptoniphilus sp. oral taxon 386 str. F0131]
          Length = 143

 Score =  199 bits (507), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 70/135 (51%), Positives = 91/135 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +  +GR+KG A  G+ + +G + L+A E   I S++IEAARRA++R +KR
Sbjct: 1   MLMPKRVKYRRVHRGRMKGKALRGNTLTYGGYGLQALEPAWITSNQIEAARRAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G +WI +FPD PVT KP E RMG GKG    WV  VKPGRI+FE+DGV EE AR A RL
Sbjct: 61  GGNIWIKIFPDKPVTEKPAETRMGSGKGAPAYWVAVVKPGRIMFEMDGVDEETAREAMRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL + TKF+ + 
Sbjct: 121 AAMKLPIKTKFVMKE 135


>gi|114704491|ref|ZP_01437399.1| 50S ribosomal protein L16 [Fulvimarina pelagi HTCC2506]
 gi|114539276|gb|EAU42396.1| 50S ribosomal protein L16 [Fulvimarina pelagi HTCC2506]
          Length = 137

 Score =  199 bits (507), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 91/137 (66%), Positives = 108/137 (78%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TKY K FKGRI G AKGG+ + FG + LKA +  R+ + +IEAARRAI+R MKR
Sbjct: 1   MLQPKRTKYRKAFKGRIHGNAKGGTALNFGAYGLKAVDPERVTARQIEAARRAITRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPD+PVT+KPTEVRMGKGKG+V+ W  RV PGRI+FEIDGV E VAR A RL
Sbjct: 61  QGRVWIRIFPDLPVTSKPTEVRMGKGKGSVDYWAARVHPGRIMFEIDGVDELVAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
           GAAKL V T+FIQR+ E
Sbjct: 121 GAAKLPVRTRFIQRIAE 137


>gi|315320572|ref|YP_004072629.1| 50S ribosomal protein L16 [Thalassiosira oceanica CCMP1005]
 gi|283569045|gb|ADB27582.1| 50S ribosomal protein L16 [Thalassiosira oceanica CCMP1005]
          Length = 136

 Score =  199 bits (507), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 71/134 (52%), Positives = 87/134 (64%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY K  +GR++G A  G+ + FG + L+A E + I S +IEA RR I+R  KR
Sbjct: 1   MLSPKRTKYRKYHRGRMRGKATRGNEVTFGQYGLQALEPSWITSRQIEATRRTITRYTKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
              +WI +FPD  VTA+  E RMG GKG V+ WV  VKPG ILFEI  V EEVAR AF L
Sbjct: 61  GASLWIRIFPDKTVTARAAESRMGSGKGAVDYWVATVKPGTILFEISSVPEEVARAAFNL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + TKFI R
Sbjct: 121 AAYKLPIKTKFIIR 134


>gi|160942894|ref|ZP_02090133.1| hypothetical protein FAEPRAM212_00370 [Faecalibacterium prausnitzii
           M21/2]
 gi|158445795|gb|EDP22798.1| hypothetical protein FAEPRAM212_00370 [Faecalibacterium prausnitzii
           M21/2]
 gi|295103932|emb|CBL01476.1| LSU ribosomal protein L16P [Faecalibacterium prausnitzii SL3/3]
          Length = 146

 Score =  199 bits (507), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 66/135 (48%), Positives = 85/135 (62%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +  +GR+ G A  G+ +C G + L A E   I S +IEAAR A++R +KR
Sbjct: 1   MLLPKRVKYRRVQRGRMTGKATRGNVVCQGQYGLVALEPAWISSKQIEAARVAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT KP E RMG GKG+ E WV  VKPGR++FE+  V E  AR A RL
Sbjct: 61  GGKVWIKIFPDKPVTEKPAETRMGSGKGSPEYWVAVVKPGRVMFELADVDEATAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  KF+ R 
Sbjct: 121 AMHKLPIKCKFVVRE 135


>gi|257791917|ref|YP_003182523.1| 50S ribosomal protein L16 [Eggerthella lenta DSM 2243]
 gi|317489923|ref|ZP_07948415.1| ribosomal protein L16 [Eggerthella sp. 1_3_56FAA]
 gi|325829913|ref|ZP_08163371.1| ribosomal protein L16 [Eggerthella sp. HGA1]
 gi|257475814|gb|ACV56134.1| ribosomal protein L16 [Eggerthella lenta DSM 2243]
 gi|316910921|gb|EFV32538.1| ribosomal protein L16 [Eggerthella sp. 1_3_56FAA]
 gi|325488080|gb|EGC90517.1| ribosomal protein L16 [Eggerthella sp. HGA1]
          Length = 140

 Score =  199 bits (507), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 71/137 (51%), Positives = 91/137 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ K  +G +KG AKGG+R+  G + ++A EA  I + +IEAAR A++R MKR
Sbjct: 1   MLVPKRVKHRKVQRGSMKGKAKGGTRLNHGEYGIQALEAAWITNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T KP E RMG GKGN E WV  VKPGRI+FEI GV E VA+ A RL
Sbjct: 61  GGKVWITIFPDKPITKKPAETRMGSGKGNPEAWVAVVKPGRIMFEIGGVDEAVAKEALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
              KL +  K + R  E
Sbjct: 121 AINKLPIKCKIVSRETE 137


>gi|187776583|ref|ZP_02993056.1| hypothetical protein CLOSPO_00097 [Clostridium sporogenes ATCC
           15579]
 gi|187775242|gb|EDU39044.1| hypothetical protein CLOSPO_00097 [Clostridium sporogenes ATCC
           15579]
          Length = 145

 Score =  199 bits (507), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 75/132 (56%), Positives = 92/132 (69%)

Query: 4   QPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKRAG 63
            PK  K  K  +GR+KG A  G+ I +G+F ++A E   I S++IEAAR AI+R +KR G
Sbjct: 1   MPKRVKRRKVQRGRMKGKATRGNFIAYGDFGIQATECGWITSNQIEAARIAINRYVKRGG 60

Query: 64  RVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRLGA 123
           +VWI +FPD PVT KP E RMG GKG+ E WV  VKPGR+LFEI GVSE VAR A RL +
Sbjct: 61  KVWIKIFPDKPVTEKPAETRMGSGKGSPEYWVAVVKPGRVLFEISGVSETVAREAMRLAS 120

Query: 124 AKLSVVTKFIQR 135
            KL V TKF+ R
Sbjct: 121 HKLPVKTKFVTR 132


>gi|15612704|ref|NP_241007.1| 50S ribosomal protein L16 [Bacillus halodurans C-125]
 gi|7674215|sp|Q9Z9K7|RL16_BACHD RecName: Full=50S ribosomal protein L16
 gi|4512411|dbj|BAA75278.1| rplP homologue (identity of 92% to B. subtilis ) [Bacillus
           halodurans]
 gi|10172753|dbj|BAB03860.1| 50S ribosomal protein L16 [Bacillus halodurans C-125]
          Length = 144

 Score =  199 bits (507), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 72/135 (53%), Positives = 97/135 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ ++ +G+++G AKGG+ + FG + L+A EA+ I + +IEAAR A++R MKR
Sbjct: 1   MLMPKRVKFRREHRGKMRGRAKGGTEVHFGEYGLQALEASWITNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP  P TAKP EVRMG GKG  E WV  VKPG+++FEI GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPSKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKVMFEISGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL V  KF++R 
Sbjct: 121 ASHKLPVKCKFVKRE 135


>gi|295109484|emb|CBL23437.1| LSU ribosomal protein L16P [Ruminococcus obeum A2-162]
          Length = 145

 Score =  199 bits (507), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 72/134 (53%), Positives = 92/134 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K  KQF+G ++G A  G++I +G F L A E   I S++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKRRKQFRGSMRGKALRGNKINYGEFGLVATEPCWIRSNQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVTAKP E RMG GKG++E WV  VKPGR++FEI GVSEE+AR A RL
Sbjct: 61  GGQVWIKIFPDKPVTAKPAETRMGSGKGSLEYWVAVVKPGRVMFEIAGVSEEIAREALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL    K + R
Sbjct: 121 AMHKLPCKCKIVSR 134


>gi|78780028|ref|YP_398140.1| 50S ribosomal protein L16 [Prochlorococcus marinus str. MIT 9312]
 gi|115502775|sp|Q318J1|RL16_PROM9 RecName: Full=50S ribosomal protein L16
 gi|78713527|gb|ABB50704.1| LSU ribosomal protein L16P [Prochlorococcus marinus str. MIT 9312]
          Length = 160

 Score =  199 bits (507), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 73/135 (54%), Positives = 97/135 (71%), Gaps = 2/135 (1%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ KQ +GR++GVA  G+ I FG FAL+AQ+   + + +IEA+RRA++R +KR
Sbjct: 1   MLSPKRTKFRKQHRGRMRGVASKGNTIAFGQFALQAQDCGWVTARQIEASRRAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDG--VSEEVARRAF 119
            G++WI +FPD PVT +P E RMG GKGN E WV  VKPGRILFE+ G  ++EE+A+ A 
Sbjct: 61  GGQIWIRIFPDKPVTMRPAETRMGSGKGNPEFWVAVVKPGRILFEMGGDDITEEIAKEAM 120

Query: 120 RLGAAKLSVVTKFIQ 134
           RL   KL V TKFI 
Sbjct: 121 RLAQYKLPVKTKFIS 135


>gi|33864006|ref|NP_895566.1| 50S ribosomal protein L16 [Prochlorococcus marinus str. MIT 9313]
 gi|81576939|sp|Q7V536|RL16_PROMM RecName: Full=50S ribosomal protein L16
 gi|33635590|emb|CAE21914.1| 50S ribosomal protein L16 [Prochlorococcus marinus str. MIT 9313]
          Length = 158

 Score =  199 bits (506), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 72/134 (53%), Positives = 96/134 (71%), Gaps = 2/134 (1%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQ +GR++GVA  G+ I FG FAL+AQE   I S +IEA+RRA++R +KR
Sbjct: 1   MLSPKRVKFRKQQRGRMRGVATRGNTIAFGEFALQAQECGWITSRQIEASRRAMTRYVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDG--VSEEVARRAF 119
            G++WI +FPD PVT +P E RMG GKGN E WV  +KPGRILFE+ G  ++E++A+ A 
Sbjct: 61  GGKIWIRIFPDKPVTMRPAETRMGSGKGNPEFWVAVIKPGRILFEMGGAEITEDIAKEAM 120

Query: 120 RLGAAKLSVVTKFI 133
           RL   KL + TKFI
Sbjct: 121 RLAQYKLPIKTKFI 134


>gi|257067053|ref|YP_003153309.1| 50S ribosomal protein L16 [Anaerococcus prevotii DSM 20548]
 gi|256798933|gb|ACV29588.1| ribosomal protein L16 [Anaerococcus prevotii DSM 20548]
          Length = 142

 Score =  199 bits (506), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 75/134 (55%), Positives = 97/134 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +Q +GR+KG A  G+ + +G + L+A E+  + +++IEAARRA++R +KR
Sbjct: 1   MLMPKRVKYRRQHRGRMKGYAHKGNELTYGEYGLQAVESTWMTANQIEAARRAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G +WI VFPD PV+ KP EVRMG GKG  E WV  VKPGR+LFE+ GVSEEVAR A RL
Sbjct: 61  GGNIWIKVFPDKPVSKKPAEVRMGSGKGAPEYWVAVVKPGRVLFEMSGVSEEVAREAMRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + TKFIQR
Sbjct: 121 AAQKLPIKTKFIQR 134


>gi|167767796|ref|ZP_02439849.1| hypothetical protein CLOSS21_02331 [Clostridium sp. SS2/1]
 gi|317497088|ref|ZP_07955415.1| ribosomal protein L16 [Lachnospiraceae bacterium 5_1_63FAA]
 gi|167710535|gb|EDS21114.1| hypothetical protein CLOSS21_02331 [Clostridium sp. SS2/1]
 gi|291558867|emb|CBL37667.1| LSU ribosomal protein L16P [butyrate-producing bacterium SSC/2]
 gi|316895633|gb|EFV17788.1| ribosomal protein L16 [Lachnospiraceae bacterium 5_1_63FAA]
          Length = 145

 Score =  199 bits (506), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 69/136 (50%), Positives = 94/136 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K  KQF+G ++G A  G++I +G + + A E   I +++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKRRKQFRGSMRGKALRGNKITYGEYGIVATEPAWITANQIEAARVAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVTA+P E RMGKGKGN+E WV  VKPGR++FEI GVSEE+A+ A RL
Sbjct: 61  GGKVWIKIFPDKPVTAQPAETRMGKGKGNLEYWVAVVKPGRVMFEISGVSEEIAKEALRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
              KL +  K + R  
Sbjct: 121 AVHKLPIKCKIVSREA 136


>gi|162149167|ref|YP_001603628.1| 50S ribosomal protein L16 [Gluconacetobacter diazotrophicus PAl 5]
 gi|209545089|ref|YP_002277318.1| 50S ribosomal protein L16 [Gluconacetobacter diazotrophicus PAl 5]
 gi|189041464|sp|A9H3P2|RL16_GLUDA RecName: Full=50S ribosomal protein L16
 gi|161787744|emb|CAP57340.1| putative 50S ribosomal protein L16 [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209532766|gb|ACI52703.1| ribosomal protein L16 [Gluconacetobacter diazotrophicus PAl 5]
          Length = 138

 Score =  199 bits (506), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 86/137 (62%), Positives = 105/137 (76%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY K  KGRI G+AKGG+ + FG F LKA E  R+ + +IEA+RRAI+R MKR
Sbjct: 1   MLSPKRTKYRKAHKGRIHGLAKGGTTLNFGAFGLKALEPERVTARQIEASRRAITRAMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AGRVWI +FPD+PV+ KP EVRMG GKG+ E WV RVKPGRILFEI+GV  E+AR+A  L
Sbjct: 61  AGRVWIRIFPDLPVSTKPAEVRMGSGKGSPEYWVARVKPGRILFEIEGVPPELARQALAL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
           GAAKL + TKF+ R+ E
Sbjct: 121 GAAKLPIKTKFVTRIGE 137


>gi|291460725|ref|ZP_06600115.1| ribosomal protein L16 [Oribacterium sp. oral taxon 078 str. F0262]
 gi|291416684|gb|EFE90403.1| ribosomal protein L16 [Oribacterium sp. oral taxon 078 str. F0262]
          Length = 143

 Score =  199 bits (506), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 68/134 (50%), Positives = 91/134 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ KQ +GR+ G A  G+++  G F + A E   I +++IEAAR A++R +KR
Sbjct: 1   MLMPKRTKFRKQMRGRMTGKATRGNKVSHGEFGIVALEPCWIKANQIEAARVALTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P++AKP  VRMG GKG VE WV  VKPGR+LFEI GV EE+AR A RL
Sbjct: 61  GGQVWIDIFPDKPISAKPLGVRMGSGKGAVEFWVAVVKPGRVLFEIAGVPEELAREALRL 120

Query: 122 GAAKLSVVTKFIQR 135
            + KL    K + +
Sbjct: 121 ASHKLPCNCKIVAK 134


>gi|188584843|ref|YP_001916388.1| LSU ribosomal protein L16P [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|226712327|sp|B2A4E6|RL16_NATTJ RecName: Full=50S ribosomal protein L16
 gi|179349530|gb|ACB83800.1| LSU ribosomal protein L16P [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 144

 Score =  198 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 74/135 (54%), Positives = 94/135 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ +Q +GR+KG AKGG  I FG F L+A E   I S +IEAAR A++R +KR
Sbjct: 1   MLMPKRTKFRRQMRGRMKGKAKGGKEIAFGEFGLQALEPAWINSRQIEAARIALTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VW+ +FPD PVT KP E RMG GKG+ E W   VKPGRILFE+ GV +E AR A RL
Sbjct: 61  GGKVWVKIFPDKPVTQKPAETRMGGGKGSPEFWAAVVKPGRILFEVAGVPKETAREAMRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL + TKF++R 
Sbjct: 121 ASHKLPIKTKFVERE 135


>gi|87124969|ref|ZP_01080816.1| 50S ribosomal protein L16 [Synechococcus sp. RS9917]
 gi|86167289|gb|EAQ68549.1| 50S ribosomal protein L16 [Synechococcus sp. RS9917]
          Length = 158

 Score =  198 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 72/135 (53%), Positives = 95/135 (70%), Gaps = 2/135 (1%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQ +GR++GVA  G+ I FG FAL+AQE   I S +IEA+RRA++R +KR
Sbjct: 1   MLSPKRVKFRKQQRGRMRGVATRGNTIAFGQFALQAQECGWITSRQIEASRRAMTRHVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDG--VSEEVARRAF 119
            G++WI +FPD P+T +P E RMG GKGN E WV  +KPGR+LFE+ G  ++E +AR A 
Sbjct: 61  GGKIWIRIFPDKPITMRPAETRMGSGKGNPEFWVAVIKPGRVLFEMGGAEITESIAREAM 120

Query: 120 RLGAAKLSVVTKFIQ 134
           RL   KL V TKFI 
Sbjct: 121 RLAQYKLPVKTKFIS 135


>gi|238928148|ref|ZP_04659908.1| ribosomal protein L16 [Selenomonas flueggei ATCC 43531]
 gi|238884108|gb|EEQ47746.1| ribosomal protein L16 [Selenomonas flueggei ATCC 43531]
          Length = 145

 Score =  198 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 73/134 (54%), Positives = 93/134 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY KQF+GR+KG A+ G+ +  G + L A E   I + +IEAAR A++R +KR
Sbjct: 1   MLLPKRVKYRKQFRGRMKGKAQRGNTVSHGQYGLVALEPAWITNRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVTAKP E RMG GKG+ E WV  VKPGR+LFE+DGVS +VA  A RL
Sbjct: 61  GGKVWIKIFPDKPVTAKPAETRMGSGKGSPEYWVAVVKPGRVLFEMDGVSRDVAAEAMRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL + TKF+ R
Sbjct: 121 AGHKLPIKTKFVVR 134


>gi|169823859|ref|YP_001691470.1| 50S ribosomal protein L16 [Finegoldia magna ATCC 29328]
 gi|297588198|ref|ZP_06946842.1| 50S ribosomal protein L16 [Finegoldia magna ATCC 53516]
 gi|302379814|ref|ZP_07268298.1| ribosomal protein L16 [Finegoldia magna ACS-171-V-Col3]
 gi|303234738|ref|ZP_07321364.1| ribosomal protein L16 [Finegoldia magna BVS033A4]
 gi|215274787|sp|B0RZU7|RL16_FINM2 RecName: Full=50S ribosomal protein L16
 gi|167830664|dbj|BAG07580.1| 50S ribosomal protein L16 [Finegoldia magna ATCC 29328]
 gi|297574887|gb|EFH93607.1| 50S ribosomal protein L16 [Finegoldia magna ATCC 53516]
 gi|302312402|gb|EFK94399.1| ribosomal protein L16 [Finegoldia magna ACS-171-V-Col3]
 gi|302494079|gb|EFL53859.1| ribosomal protein L16 [Finegoldia magna BVS033A4]
          Length = 147

 Score =  198 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 65/135 (48%), Positives = 92/135 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +  +GR+KG A  G+ + +G++ ++A  +  + +++IEAARRA++R +KR
Sbjct: 1   MLMPKRVKYRRVHRGRMKGKALKGNTLTYGDYGIQALGSCWLTANQIEAARRAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G +WI VFPD PV+ KP  +RMG GKG  E WV  +KPGR+LFE+ GV E+VAR A RL
Sbjct: 61  GGNIWIKVFPDKPVSKKPIGIRMGSGKGAPEYWVAVIKPGRVLFEMAGVPEDVAREAMRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL + TKFI R 
Sbjct: 121 AQHKLPIKTKFIARE 135


>gi|154684641|ref|YP_001419802.1| 50S ribosomal protein L16 [Bacillus amyloliquefaciens FZB42]
 gi|157690907|ref|YP_001485369.1| 50S ribosomal protein L16 [Bacillus pumilus SAFR-032]
 gi|308172014|ref|YP_003918719.1| 50S ribosomal protein L16 [Bacillus amyloliquefaciens DSM 7]
 gi|311070770|ref|YP_003975693.1| 50S ribosomal protein L16 [Bacillus atrophaeus 1942]
 gi|166234547|sp|A7Z0P5|RL16_BACA2 RecName: Full=50S ribosomal protein L16
 gi|166983711|sp|A8F992|RL16_BACP2 RecName: Full=50S ribosomal protein L16
 gi|154350492|gb|ABS72571.1| RplP [Bacillus amyloliquefaciens FZB42]
 gi|157679665|gb|ABV60809.1| ribosomal protein L16 [Bacillus pumilus SAFR-032]
 gi|307604878|emb|CBI41249.1| ribosomal protein L16 [Bacillus amyloliquefaciens DSM 7]
 gi|310871287|gb|ADP34762.1| 50S ribosomal protein L16 [Bacillus atrophaeus 1942]
 gi|328551824|gb|AEB22316.1| 50S ribosomal protein L16 [Bacillus amyloliquefaciens TA208]
          Length = 144

 Score =  198 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 73/135 (54%), Positives = 98/135 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY ++ +G+++G AKGG+ + FG + ++A EA+ I + +IEAAR A++R MKR
Sbjct: 1   MLLPKRVKYRREHRGKMRGRAKGGTEVHFGEYGIQALEASWITNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP  P TAKP EVRMG GKG  E WV  VKPG++LFEI GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPSKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKVLFEISGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL + TKF++R 
Sbjct: 121 ASHKLPIKTKFVKRE 135


>gi|304405609|ref|ZP_07387268.1| ribosomal protein L16 [Paenibacillus curdlanolyticus YK9]
 gi|304345648|gb|EFM11483.1| ribosomal protein L16 [Paenibacillus curdlanolyticus YK9]
          Length = 144

 Score =  198 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 72/135 (53%), Positives = 98/135 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQ +G ++G AKGG+ + FG + L+A E + I + +IE+AR A++R +KR
Sbjct: 1   MLVPKRVKHRKQQRGNMRGKAKGGTEVAFGEYGLQALEPSWITNRQIESARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP  P+T KP EVRMG GKGNVEKWV  VKPG+++FE+ GV EE+AR A RL
Sbjct: 61  GGKVWIKIFPHKPITQKPLEVRMGSGKGNVEKWVAVVKPGKVMFELAGVPEEIAREAMRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL V TKF++R 
Sbjct: 121 AAHKLPVKTKFVKRE 135


>gi|304438369|ref|ZP_07398310.1| 50S ribosomal protein L16 [Selenomonas sp. oral taxon 149 str.
           67H29BP]
 gi|304368735|gb|EFM22419.1| 50S ribosomal protein L16 [Selenomonas sp. oral taxon 149 str.
           67H29BP]
          Length = 145

 Score =  198 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 74/134 (55%), Positives = 93/134 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY KQF+GR+KG A+ G+ +  G + L A E   I + +IEAAR A++R +KR
Sbjct: 1   MLLPKRVKYRKQFRGRMKGKAQRGNTVSHGQYGLVALEPAWITNRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVTAKP E RMG GKG+ E WV  VKPGR+LFE+DGVS EVA  A RL
Sbjct: 61  GGKVWIKIFPDKPVTAKPAETRMGSGKGSPEYWVAVVKPGRVLFEMDGVSREVAAEAMRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL + TKF+ R
Sbjct: 121 AGHKLPIKTKFVVR 134


>gi|118579126|ref|YP_900376.1| 50S ribosomal protein L16 [Pelobacter propionicus DSM 2379]
 gi|166199699|sp|A1ALU8|RL16_PELPD RecName: Full=50S ribosomal protein L16
 gi|118501836|gb|ABK98318.1| LSU ribosomal protein L16P [Pelobacter propionicus DSM 2379]
          Length = 140

 Score =  198 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 72/134 (53%), Positives = 93/134 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQ KGR+ G    G  + FG F L+A E   + S +IEAAR A++R +KR
Sbjct: 1   MLLPKRVKHRKQMKGRMTGKPCRGISLSFGEFGLQATECGWLDSRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T+KP E RMGKGKG+ + WV  +KPG IL+E++GVSEEVAR A RL
Sbjct: 61  GGKIWIRIFPDKPLTSKPAETRMGKGKGSPDSWVAVIKPGTILYEMEGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL V TKFI R
Sbjct: 121 AAHKLPVSTKFITR 134


>gi|209964047|ref|YP_002296962.1| 50S ribosomal protein L16 [Rhodospirillum centenum SW]
 gi|226712344|sp|B6IRR3|RL16_RHOCS RecName: Full=50S ribosomal protein L16
 gi|209957513|gb|ACI98149.1| ribosomal protein L16 [Rhodospirillum centenum SW]
          Length = 141

 Score =  198 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 79/137 (57%), Positives = 101/137 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY K  KGRI G AKGG+ + FG + LKA E  R+ + +IE+ARRAI+R +KR
Sbjct: 1   MLSPKRTKYRKAHKGRIHGTAKGGTSLNFGAYGLKAVEPMRVTARQIESARRAITRHLKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPD+PV+ KP EVRMG GKG+ E W  RV PGRI+FE+DGV  ++A+RAF L
Sbjct: 61  QGRVWIRIFPDLPVSTKPAEVRMGSGKGSPEFWAARVHPGRIMFEVDGVPLDLAKRAFEL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            AAKL + T+FI R+ E
Sbjct: 121 AAAKLPIKTRFITRLGE 137


>gi|315925249|ref|ZP_07921463.1| 50S ribosomal protein L16 [Pseudoramibacter alactolyticus ATCC
           23263]
 gi|315621483|gb|EFV01450.1| 50S ribosomal protein L16 [Pseudoramibacter alactolyticus ATCC
           23263]
          Length = 142

 Score =  198 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 70/134 (52%), Positives = 95/134 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K  KQ +GR+KG A  G+ I +G F ++A E   I S++IEAAR A++R ++R
Sbjct: 1   MLMPKRVKRRKQHRGRMKGKATRGNTITYGEFGIQALEPAWITSNQIEAARVAMTRYIRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVTA+P E RMGKGKG+ E WV  VKPGR++FEI G+SEE+AR A RL
Sbjct: 61  GGQVWIKIFPDKPVTAQPAETRMGKGKGSPEYWVAVVKPGRVMFEIGGISEEMAREALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL + TK +++
Sbjct: 121 AQHKLPIKTKIVKK 134


>gi|154507857|ref|ZP_02043499.1| hypothetical protein ACTODO_00339 [Actinomyces odontolyticus ATCC
           17982]
 gi|293190252|ref|ZP_06608748.1| ribosomal protein L16 [Actinomyces odontolyticus F0309]
 gi|153797491|gb|EDN79911.1| hypothetical protein ACTODO_00339 [Actinomyces odontolyticus ATCC
           17982]
 gi|292821068|gb|EFF80021.1| ribosomal protein L16 [Actinomyces odontolyticus F0309]
          Length = 139

 Score =  198 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 65/135 (48%), Positives = 89/135 (65%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+ TKY KQ +    G A GG+ + FG++ ++A EA  I + +IEAAR A++R +KR
Sbjct: 1   MLIPRRTKYRKQHRPHRTGFASGGTELAFGDYGIQALEAAYITNRQIEAARIAVTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T KP E RMG GKG  E WV  VKPGR++FE+ GV EE+AR A   
Sbjct: 61  GGKVWINIFPDRPLTKKPAETRMGSGKGAPEWWVAPVKPGRVMFELAGVPEELAREALSR 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL + T+F+ R 
Sbjct: 121 AQHKLPIKTRFVVRE 135


>gi|289450829|ref|YP_003475777.1| 50S ribosomal protein L16 [Clostridiales genomosp. BVAB3 str.
           UPII9-5]
 gi|289185376|gb|ADC91801.1| ribosomal protein L16 [Clostridiales genomosp. BVAB3 str. UPII9-5]
          Length = 139

 Score =  198 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 67/136 (49%), Positives = 92/136 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +  +GR+ G A  G+ + +G + L+A E   I S++IE+AR AI+R +KR
Sbjct: 1   MLLPKRVKYRRVHRGRMTGKATRGNFVSYGEYGLEALEPCWIKSNQIESARIAINRHLKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP  PVT KP EVRMG GKG+ E WV  VKPGRILFE+ GVS+E A+ A RL
Sbjct: 61  GGKVWIKIFPHKPVTKKPAEVRMGSGKGSPEFWVAVVKPGRILFEVAGVSDEDAKEALRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            + KL   T+ +++ V
Sbjct: 121 ASHKLPCKTRIVKKEV 136


>gi|52078616|ref|YP_077407.1| 50S ribosomal protein L16 [Bacillus licheniformis ATCC 14580]
 gi|52783978|ref|YP_089807.1| 50S ribosomal protein L16 [Bacillus licheniformis ATCC 14580]
 gi|319649109|ref|ZP_08003317.1| 50S ribosomal protein L16 [Bacillus sp. BT1B_CT2]
 gi|81667230|sp|Q65PA0|RL16_BACLD RecName: Full=50S ribosomal protein L16
 gi|52001827|gb|AAU21769.1| ribosomal protein L16 [Bacillus licheniformis ATCC 14580]
 gi|52346480|gb|AAU39114.1| RplP [Bacillus licheniformis ATCC 14580]
 gi|317388809|gb|EFV69628.1| 50S ribosomal protein L16 [Bacillus sp. BT1B_CT2]
          Length = 144

 Score =  198 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 73/135 (54%), Positives = 99/135 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY ++ +G+++G AKGG+ + FG + ++AQE++ I + +IEAAR A++R MKR
Sbjct: 1   MLMPKRVKYRREHRGKMRGRAKGGTEVHFGEYGIQAQESSWITNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP  P TAKP EVRMG GKG  E WV  VKPG++LFEI GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPSKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKVLFEISGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL + TKF++R 
Sbjct: 121 ASHKLPIKTKFVKRE 135


>gi|268609586|ref|ZP_06143313.1| 50S ribosomal protein L16 [Ruminococcus flavefaciens FD-1]
          Length = 141

 Score =  198 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 68/134 (50%), Positives = 93/134 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +  +GR+KG A  G+++ +G+F L+A E   I S++IE+AR A++R +KR
Sbjct: 1   MLLPKRVKYRRVHRGRLKGKAYRGNKVTYGDFGLQALEPAWITSNQIESARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T KP E RMG GKG+ E WV  VKPGR+LFEI GV+EE AR A RL
Sbjct: 61  GGQVWIKIFPDKPITEKPAETRMGSGKGSPEYWVAVVKPGRVLFEIKGVAEETAREAMRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL +  KF+ +
Sbjct: 121 AMHKLPIKCKFVTK 134


>gi|197104703|ref|YP_002130080.1| 50S ribosomal protein L16 [Phenylobacterium zucineum HLK1]
 gi|226712332|sp|B4R8M4|RL16_PHEZH RecName: Full=50S ribosomal protein L16
 gi|196478123|gb|ACG77651.1| 50S ribosomal protein L16 [Phenylobacterium zucineum HLK1]
          Length = 142

 Score =  198 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 88/135 (65%), Positives = 103/135 (76%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY KQFKGRI G AKGG  + FG++ LK+ E  RI + +IEAARRAI+R MKR
Sbjct: 1   MLSPKKTKYRKQFKGRIHGTAKGGFTLNFGSYGLKSMEPERITARQIEAARRAITRQMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI VFPDVPVT KP EVRMG GKG+VE W  RV PGRI+FEIDGV ++VAR A RL
Sbjct: 61  QGRVWIRVFPDVPVTGKPAEVRMGSGKGSVEYWAARVHPGRIMFEIDGVPDDVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
           GAAKL V T+ + R+
Sbjct: 121 GAAKLPVKTRIVTRI 135


>gi|251799635|ref|YP_003014366.1| ribosomal protein L16 [Paenibacillus sp. JDR-2]
 gi|247547261|gb|ACT04280.1| ribosomal protein L16 [Paenibacillus sp. JDR-2]
          Length = 144

 Score =  198 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 74/135 (54%), Positives = 98/135 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQ +G ++G AKGG+ + FG + L+A E   I + +IEAAR A++R +KR
Sbjct: 1   MLVPKRVKHRKQQRGNMRGRAKGGTEVAFGEYGLQALEPTWITNRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP  P+T KP EVRMG GKGNVEKWV  VKPG+I+FE+ GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPHKPITQKPLEVRMGSGKGNVEKWVAVVKPGKIMFELAGVSEEVAREAMRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL + TKF++R 
Sbjct: 121 ASHKLPIKTKFVKRE 135


>gi|322418371|ref|YP_004197594.1| 50S ribosomal protein L16 [Geobacter sp. M18]
 gi|320124758|gb|ADW12318.1| ribosomal protein L16 [Geobacter sp. M18]
          Length = 140

 Score =  198 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 73/135 (54%), Positives = 97/135 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQ KGR+ G    G  + FG+F L+A E   + S +IEAAR A++R +KR
Sbjct: 1   MLMPKKVKHRKQMKGRMTGTPTRGVSLAFGDFGLQATECGWLDSRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T+KP E RMGKGKG+ + WVC +KPGR+L+E++GV+EEVAR AFRL
Sbjct: 61  GGKIWIRIFPDKPLTSKPAETRMGKGKGSPDSWVCVIKPGRVLYEMEGVTEEVAREAFRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL V TKFI R 
Sbjct: 121 AAHKLPVATKFITRT 135


>gi|189501204|ref|YP_001960674.1| 50S ribosomal protein L16 [Chlorobium phaeobacteroides BS1]
 gi|226710697|sp|B3EP54|RL16_CHLPB RecName: Full=50S ribosomal protein L16
 gi|189496645|gb|ACE05193.1| ribosomal protein L16 [Chlorobium phaeobacteroides BS1]
          Length = 139

 Score =  198 bits (504), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 74/134 (55%), Positives = 92/134 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY K  +GR+KG A+ G+ I FG++ LKA E   I + +IEAAR A++R MKR
Sbjct: 1   MLMPKRVKYRKVQRGRMKGDAQRGTTISFGSYGLKALEPAWITNRQIEAARIAMNRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVT K  E RMG GKG+ E WV  VKPGRI+FE DGV  +VA  AFRL
Sbjct: 61  DGKIWIRIFPDKPVTKKAAETRMGSGKGSPEFWVSVVKPGRIMFEADGVPLDVATEAFRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + TKFI R
Sbjct: 121 AAKKLPIKTKFIVR 134


>gi|253580626|ref|ZP_04857890.1| 50S ribosomal protein L16 [Ruminococcus sp. 5_1_39B_FAA]
 gi|251847997|gb|EES75963.1| 50S ribosomal protein L16 [Ruminococcus sp. 5_1_39BFAA]
          Length = 145

 Score =  198 bits (504), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 72/134 (53%), Positives = 91/134 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K  KQF+G ++G A  G++I +G F L A E   I S++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKRRKQFRGSMRGKALRGNKINYGEFGLVATEPCWIRSNQIEAARVAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVTAKP E RMG GKG +E WV  VKPGR++FEI GVSEE+AR A RL
Sbjct: 61  GGQVWIKIFPDKPVTAKPAETRMGSGKGALEYWVAVVKPGRVMFEIAGVSEEIAREALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL    K + R
Sbjct: 121 AMHKLPCKCKIVSR 134


>gi|295106944|emb|CBL04487.1| LSU ribosomal protein L16P [Gordonibacter pamelaeae 7-10-1-b]
          Length = 140

 Score =  198 bits (504), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 71/137 (51%), Positives = 93/137 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ K  +G +KG AKGG+R+  G + ++A EA+ I + +IEAAR A++R MKR
Sbjct: 1   MLVPKRVKHRKVQRGSMKGKAKGGTRLNHGTWGIQALEAHWITNRQIEAARIAMTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T KP E RMG GKGN E WV  VKPGRI+FEIDGV EE A+ A RL
Sbjct: 61  GGKVWITIFPDKPITQKPAETRMGSGKGNPEAWVAVVKPGRIMFEIDGVDEETAKEALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
              KL +  K + +  E
Sbjct: 121 AINKLPIKCKIVSKETE 137


>gi|167748437|ref|ZP_02420564.1| hypothetical protein ANACAC_03181 [Anaerostipes caccae DSM 14662]
 gi|317472030|ref|ZP_07931362.1| ribosomal protein L16 [Anaerostipes sp. 3_2_56FAA]
 gi|167652429|gb|EDR96558.1| hypothetical protein ANACAC_03181 [Anaerostipes caccae DSM 14662]
 gi|316900434|gb|EFV22416.1| ribosomal protein L16 [Anaerostipes sp. 3_2_56FAA]
          Length = 145

 Score =  198 bits (504), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 74/136 (54%), Positives = 94/136 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K  KQF+G ++G A  G++I +G F + A E   I S++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKRRKQFRGSMRGKATRGNKITYGEFGIVATEPAWIRSNQIEAARVAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVTA+P E RMGKGKGN+E WV  VKPGR++FEI GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPDKPVTAQPAETRMGKGKGNLEYWVAVVKPGRVMFEISGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
              KL V  K + R  
Sbjct: 121 AVHKLPVKCKIVSREA 136


>gi|56695402|ref|YP_165750.1| 50S ribosomal protein L16 [Ruegeria pomeroyi DSS-3]
 gi|81558737|sp|Q5LW55|RL16_SILPO RecName: Full=50S ribosomal protein L16
 gi|56677139|gb|AAV93805.1| ribosomal protein L16 [Ruegeria pomeroyi DSS-3]
          Length = 137

 Score =  198 bits (504), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 83/135 (61%), Positives = 106/135 (78%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K FKGRI G+AKGGS + FG + LKA E  R+ + +IEAARRA++R MKR
Sbjct: 1   MLQPKRTKFRKMFKGRIHGLAKGGSDLNFGTYGLKALEPERVTARQIEAARRAMTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPD PVT+KPTEVRMGKGKG+V+ W C+VKPGR++FEIDGV++E+AR A RL
Sbjct: 61  QGRVWIRIFPDTPVTSKPTEVRMGKGKGSVDYWACKVKPGRVMFEIDGVNDEIAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL + T+ + R 
Sbjct: 121 AAMKLPIKTRVVVRE 135


>gi|163847930|ref|YP_001635974.1| 50S ribosomal protein L16 [Chloroflexus aurantiacus J-10-fl]
 gi|222525810|ref|YP_002570281.1| 50S ribosomal protein L16 [Chloroflexus sp. Y-400-fl]
 gi|189041451|sp|A9WH73|RL16_CHLAA RecName: Full=50S ribosomal protein L16
 gi|254799190|sp|B9LJD9|RL16_CHLSY RecName: Full=50S ribosomal protein L16
 gi|163669219|gb|ABY35585.1| ribosomal protein L16 [Chloroflexus aurantiacus J-10-fl]
 gi|222449689|gb|ACM53955.1| ribosomal protein L16 [Chloroflexus sp. Y-400-fl]
          Length = 151

 Score =  198 bits (504), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 71/135 (52%), Positives = 89/135 (65%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY K  KGR  G++  G+ + FG + L A E + I S +IEAARRAI+  +KR
Sbjct: 1   MLLPKRTKYRKMQKGRSPGLSYRGNNVVFGEYGLMALEPSWISSRQIEAARRAITNYVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT KP E RMG GKG+V+ WV  VKPGRI+FE+ GV E+VA  A R 
Sbjct: 61  GGKVWIRIFPDKPVTRKPAETRMGGGKGSVDHWVAVVKPGRIMFELAGVREDVAHEALRR 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL +  K I R 
Sbjct: 121 AAQKLPIKCKVIDRE 135


>gi|269217128|ref|ZP_06160982.1| ribosomal protein L16 [Slackia exigua ATCC 700122]
 gi|269129265|gb|EEZ60350.1| ribosomal protein L16 [Slackia exigua ATCC 700122]
          Length = 140

 Score =  198 bits (504), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 71/137 (51%), Positives = 93/137 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ K  +G +KG AKGG+R+  G + ++A EA+ I + +IEAAR A++R MKR
Sbjct: 1   MLAPKRVKHRKVQRGSMKGKAKGGTRLNHGEYGIQALEAHWITNRQIEAARIAMTREMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T KP E RMG GKGN E WV  VKPGRI+FEI GV +EVAR A RL
Sbjct: 61  GGKVWITIFPDKPITQKPAETRMGSGKGNPEGWVAVVKPGRIMFEIGGVEDEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
              KL +  K + +  E
Sbjct: 121 AINKLPIKCKIVTKETE 137


>gi|299830606|ref|YP_003735054.1| 50S ribosomal protein L16 [Durinskia baltica]
 gi|297384970|gb|ADI40269.1| 50S ribosomal protein L16 [Durinskia baltica]
          Length = 138

 Score =  198 bits (504), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 70/136 (51%), Positives = 89/136 (65%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY K  +GR+KG A  G+ ICFGNF L+A E   I S +IEAARR I+R  KR
Sbjct: 1   MLSPKRTKYRKYHRGRMKGTASRGNEICFGNFGLQALEPTWITSRQIEAARRTITRYTKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
             ++WI +FPD  VTA+  E RMG GKG V+ WV  V+PG I+FEI  V EE+A+ A  L
Sbjct: 61  GAKLWIRIFPDKTVTARAAESRMGSGKGAVDYWVAVVRPGTIIFEISSVPEEIAKAALNL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            + KL + TKFI +  
Sbjct: 121 ASYKLPLKTKFINKDS 136


>gi|167629474|ref|YP_001679973.1| 50S ribosomal protein l16 [Heliobacterium modesticaldum Ice1]
 gi|226710732|sp|B0TC63|RL16_HELMI RecName: Full=50S ribosomal protein L16
 gi|167592214|gb|ABZ83962.1| 50S ribosomal protein l16 [Heliobacterium modesticaldum Ice1]
          Length = 144

 Score =  198 bits (504), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 69/135 (51%), Positives = 94/135 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ +  +GR+KG +KGG+ + FG + L+A EA  I S +IEAAR A++R +KR
Sbjct: 1   MLLPKRVKWRRVQRGRLKGKSKGGNSVAFGEYGLQALEAAWITSRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+TAKP E RMG GKG+ E WV  VKPGRI+FE+ GV E+ A+ A RL
Sbjct: 61  GGKVWIKIFPDKPITAKPAETRMGSGKGSPEYWVAVVKPGRIMFELAGVPEDTAKEAMRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  KF++R 
Sbjct: 121 AMHKLPIKCKFVKRE 135


>gi|325479173|gb|EGC82270.1| ribosomal protein L16 [Anaerococcus prevotii ACS-065-V-Col13]
          Length = 142

 Score =  198 bits (504), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 76/134 (56%), Positives = 97/134 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +Q +GR+KG A  G+ + +G + L+A EA  + +++IEAARRA++R +KR
Sbjct: 1   MLMPKRVKYRRQHRGRMKGFAHKGNELAYGEYGLQATEATWMTANQIEAARRAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G +WI VFPD PV+ KP EVRMG GKG  E WV  VKPGR+LFE+ GVSEEVAR A RL
Sbjct: 61  GGNIWIKVFPDKPVSKKPAEVRMGSGKGAPEYWVAVVKPGRVLFEMSGVSEEVAREAMRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + TKFIQR
Sbjct: 121 AAQKLPIKTKFIQR 134


>gi|11467463|ref|NP_043609.1| ribosomal protein L16 [Odontella sinensis]
 gi|1350619|sp|P49553|RK16_ODOSI RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|1185158|emb|CAA91641.1| 50S ribosomal protein L16 [Odontella sinensis]
          Length = 137

 Score =  198 bits (504), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 68/135 (50%), Positives = 87/135 (64%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY K  +GR++G A  G+ + FG++ L+A E   I S +IEAARR I+R  KR
Sbjct: 1   MLSPKRTKYRKYHRGRMRGKATRGNEVTFGDYGLQALEPTWITSRQIEAARRTITRYTKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
              +WI +FPD  VTA+  E RMG GKG V+ WV  VKPG ILFEI  V EE+A  A  L
Sbjct: 61  GAALWIRIFPDKTVTARAAESRMGSGKGAVDYWVAVVKPGTILFEIASVPEEIAATALHL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL + TKFI R+
Sbjct: 121 ASYKLPIKTKFITRI 135


>gi|257440262|ref|ZP_05616017.1| ribosomal protein L16 [Faecalibacterium prausnitzii A2-165]
 gi|257197296|gb|EEU95580.1| ribosomal protein L16 [Faecalibacterium prausnitzii A2-165]
          Length = 146

 Score =  198 bits (504), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 67/135 (49%), Positives = 85/135 (62%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +  +GR+ G A  G+ +C G + L A E   I S++IEAAR A++R +KR
Sbjct: 1   MLLPKRVKYRRVQRGRMTGKATRGNVVCQGQYGLVALEPAWISSTQIEAARVAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT KP E RMG GKG+ E WV  VKPGR+LFE+  V E  AR A RL
Sbjct: 61  GGKVWIKIFPDKPVTEKPAETRMGSGKGSPEYWVAVVKPGRVLFELADVDEATAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  KF  R 
Sbjct: 121 AMHKLPIKCKFAVRE 135


>gi|227501141|ref|ZP_03931190.1| ribosomal protein L16 [Anaerococcus tetradius ATCC 35098]
 gi|227216726|gb|EEI82127.1| ribosomal protein L16 [Anaerococcus tetradius ATCC 35098]
          Length = 142

 Score =  198 bits (504), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 76/134 (56%), Positives = 98/134 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +Q +GR+KG A+ G+ + +G + L+A EA  + +++IEAARRA++R +KR
Sbjct: 1   MLMPKRVKYRRQHRGRMKGFAQKGNELAYGEYGLQATEATWMTANQIEAARRAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G +WI VFPD PV+ KP EVRMG GKG  E WV  VKPGR+LFE+ GVSEEVAR A RL
Sbjct: 61  GGNIWIKVFPDKPVSKKPAEVRMGSGKGAPEYWVAVVKPGRVLFEMSGVSEEVAREAMRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + TKFIQR
Sbjct: 121 AAQKLPIKTKFIQR 134


>gi|163760806|ref|ZP_02167885.1| 50S ribosomal protein L16 [Hoeflea phototrophica DFL-43]
 gi|162281850|gb|EDQ32142.1| 50S ribosomal protein L16 [Hoeflea phototrophica DFL-43]
          Length = 137

 Score =  198 bits (503), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 99/137 (72%), Positives = 119/137 (86%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TKY KQFKGRIKGVAKGGS + FG++ LKAQE +R+ + +IEAARRAI+R MKR
Sbjct: 1   MLQPKRTKYRKQFKGRIKGVAKGGSDLNFGSYGLKAQEPDRVNARQIEAARRAITRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AGRVWI +FPDVPVT+KPTEVRMGKGKG+V+ W  +VKPGRI+FEIDGVSEE+AR A RL
Sbjct: 61  AGRVWIRIFPDVPVTSKPTEVRMGKGKGSVDYWAAKVKPGRIMFEIDGVSEELAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
           GAAKLSV T+F+QR+ +
Sbjct: 121 GAAKLSVKTRFVQRIAD 137


>gi|304438900|ref|ZP_07398823.1| 50S ribosomal protein L16 [Peptoniphilus duerdenii ATCC BAA-1640]
 gi|304372566|gb|EFM26149.1| 50S ribosomal protein L16 [Peptoniphilus duerdenii ATCC BAA-1640]
          Length = 143

 Score =  198 bits (503), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 67/134 (50%), Positives = 93/134 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +  +GR+KG A+ G+ + +G + L+A +   I +++IEAARRA++R ++R
Sbjct: 1   MLMPKRVKYRRVHRGRMKGKAQKGNTLTYGEYGLQALDPAWITANQIEAARRAMTRYIRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G +WI +FPD PVT KP E RMG GKG    WV  VKPGR+LFE+ GVSEE+AR A RL
Sbjct: 61  GGNIWIKIFPDKPVTEKPAETRMGSGKGAPSYWVSVVKPGRVLFEMSGVSEEIAREAMRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + TKF+ +
Sbjct: 121 AAMKLPIKTKFVMK 134


>gi|153812871|ref|ZP_01965539.1| hypothetical protein RUMOBE_03278 [Ruminococcus obeum ATCC 29174]
 gi|149831083|gb|EDM86172.1| hypothetical protein RUMOBE_03278 [Ruminococcus obeum ATCC 29174]
          Length = 145

 Score =  198 bits (503), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 73/134 (54%), Positives = 92/134 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K  KQF+G +KG A  G++I +G F L A E   I S++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKRRKQFRGTMKGKALRGNKINYGEFGLVATEPCWIRSNQIEAARVAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVTAKP E RMG GKG++E WV  VKPGR++FEI GVSEE+AR A RL
Sbjct: 61  GGQVWIKIFPDKPVTAKPAETRMGSGKGSLEYWVAVVKPGRVMFEIAGVSEEIAREALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL    K + R
Sbjct: 121 AMHKLPCKCKIVSR 134


>gi|39997942|ref|NP_953893.1| 50S ribosomal protein L16 [Geobacter sulfurreducens PCA]
 gi|81701327|sp|Q748Z5|RL16_GEOSL RecName: Full=50S ribosomal protein L16
 gi|39984887|gb|AAR36243.1| ribosomal protein L16 [Geobacter sulfurreducens PCA]
 gi|298506881|gb|ADI85604.1| ribosomal protein L16 [Geobacter sulfurreducens KN400]
          Length = 140

 Score =  198 bits (503), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 74/134 (55%), Positives = 100/134 (74%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQ KGR+KG A+ G+ + FG F L+A E   + S +IEAAR A++R +KR
Sbjct: 1   MLMPKRVKHRKQMKGRMKGDAQRGASLAFGEFGLQATECGWVDSRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T+KP E RMGKGKG+ + WVC VKPG++L+E++GV+EE+AR AFRL
Sbjct: 61  GGKIWIRLFPDKPLTSKPAETRMGKGKGSPDSWVCVVKPGKVLYEMEGVTEEIAREAFRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL V TKFI R
Sbjct: 121 AAHKLPVGTKFISR 134


>gi|16077191|ref|NP_388004.1| 50S ribosomal protein L16 [Bacillus subtilis subsp. subtilis str.
           168]
 gi|221307935|ref|ZP_03589782.1| 50S ribosomal protein L16 [Bacillus subtilis subsp. subtilis str.
           168]
 gi|221312256|ref|ZP_03594061.1| 50S ribosomal protein L16 [Bacillus subtilis subsp. subtilis str.
           NCIB 3610]
 gi|221317190|ref|ZP_03598484.1| 50S ribosomal protein L16 [Bacillus subtilis subsp. subtilis str.
           JH642]
 gi|221321453|ref|ZP_03602747.1| 50S ribosomal protein L16 [Bacillus subtilis subsp. subtilis str.
           SMY]
 gi|296333120|ref|ZP_06875574.1| 50S ribosomal protein L16 [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305672822|ref|YP_003864493.1| 50S ribosomal protein L16 [Bacillus subtilis subsp. spizizenii str.
           W23]
 gi|321313794|ref|YP_004206081.1| 50S ribosomal protein L16 [Bacillus subtilis BSn5]
 gi|1172970|sp|P14577|RL16_BACSU RecName: Full=50S ribosomal protein L16
 gi|2632390|emb|CAB11899.1| ribosomal protein L16 [Bacillus subtilis subsp. subtilis str. 168]
 gi|291482495|dbj|BAI83570.1| 50S ribosomal protein L16 [Bacillus subtilis subsp. natto BEST195]
 gi|296149736|gb|EFG90631.1| 50S ribosomal protein L16 [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305411065|gb|ADM36183.1| 50S ribosomal protein L16 [Bacillus subtilis subsp. spizizenii str.
           W23]
 gi|320020068|gb|ADV95054.1| 50S ribosomal protein L16 [Bacillus subtilis BSn5]
          Length = 144

 Score =  198 bits (503), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 74/135 (54%), Positives = 98/135 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY ++ +G+++G AKGG+ + FG F ++A EA+ I + +IEAAR A++R MKR
Sbjct: 1   MLLPKRVKYRREHRGKMRGRAKGGTEVHFGEFGIQALEASWITNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP  P TAKP EVRMG GKG  E WV  VKPG++LFEI GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPSKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKVLFEISGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL + TKF++R 
Sbjct: 121 ASHKLPIKTKFVKRE 135


>gi|210611132|ref|ZP_03288746.1| hypothetical protein CLONEX_00936 [Clostridium nexile DSM 1787]
 gi|210152119|gb|EEA83126.1| hypothetical protein CLONEX_00936 [Clostridium nexile DSM 1787]
          Length = 145

 Score =  198 bits (503), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 69/135 (51%), Positives = 88/135 (65%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K  KQF+G +KG A  G++I  G + + A E   I S++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKRRKQFRGSMKGKALRGNKITNGEYGIVAMEPCWIRSNQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT KP E RMG GKG +E WV  VKPGR++FE+ GV EEVAR A RL
Sbjct: 61  GGKVWIKIFPDKPVTTKPAETRMGSGKGTLEYWVAVVKPGRVMFELSGVPEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL    K + R 
Sbjct: 121 AMHKLPCKCKIVSRE 135


>gi|110634023|ref|YP_674231.1| 50S ribosomal protein L16 [Mesorhizobium sp. BNC1]
 gi|115502760|sp|Q11HQ9|RL16_MESSB RecName: Full=50S ribosomal protein L16
 gi|110285007|gb|ABG63066.1| LSU ribosomal protein L16P [Chelativorans sp. BNC1]
          Length = 137

 Score =  198 bits (503), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 97/137 (70%), Positives = 113/137 (82%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQFKGRI G AKGG+ + FG F LKA E  R+ + +IEAARRAI+R MKR
Sbjct: 1   MLQPKRTKFRKQFKGRIHGAAKGGTDLNFGAFGLKALEPERVTARQIEAARRAITRQMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI VFPDVPVTAKPTEVRMGKGKG+VE W CRVKPGRI+FEIDGV+E++AR A RL
Sbjct: 61  QGRVWIRVFPDVPVTAKPTEVRMGKGKGSVEFWACRVKPGRIMFEIDGVAEDIAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
           GAAKL + T+FIQR+ E
Sbjct: 121 GAAKLPIKTRFIQRIAE 137


>gi|255282612|ref|ZP_05347167.1| ribosomal protein L16 [Bryantella formatexigens DSM 14469]
 gi|255266905|gb|EET60110.1| ribosomal protein L16 [Bryantella formatexigens DSM 14469]
          Length = 145

 Score =  198 bits (503), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 71/134 (52%), Positives = 88/134 (65%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K  KQF+G ++G A  G+ I  G + L A E   I S++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKRRKQFRGSMRGKALRGNTISNGEYGLVAIEPCWIKSNQIEAARVAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVTAKP E RMG GKG +E WV  VKPGR++FEI GV EEVAR A RL
Sbjct: 61  GGKVWIKIFPDKPVTAKPAETRMGSGKGTLEYWVAVVKPGRVMFEIAGVPEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL    K + R
Sbjct: 121 AMHKLPCKCKIVSR 134


>gi|83854970|ref|ZP_00948500.1| 50S ribosomal protein L16 [Sulfitobacter sp. NAS-14.1]
 gi|83941492|ref|ZP_00953954.1| 50S ribosomal protein L16 [Sulfitobacter sp. EE-36]
 gi|83842813|gb|EAP81980.1| 50S ribosomal protein L16 [Sulfitobacter sp. NAS-14.1]
 gi|83847312|gb|EAP85187.1| 50S ribosomal protein L16 [Sulfitobacter sp. EE-36]
          Length = 137

 Score =  198 bits (503), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 87/135 (64%), Positives = 109/135 (80%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQ KGRIKGVAKGGS + FG + LKA E  R+ + +IEAARRA++R MKR
Sbjct: 1   MLQPKRTKFRKQHKGRIKGVAKGGSDLNFGTYGLKALEPERVTARQIEAARRAMTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPDVPVTAKP EVRMGKGKG+V++WVC+VKPGR++FEIDGV+E+VA+ A RL
Sbjct: 61  QGRVWIRIFPDVPVTAKPIEVRMGKGKGSVDRWVCKVKPGRVMFEIDGVAEDVAQEALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL + T+ + R 
Sbjct: 121 AAMKLPIKTRVVVRE 135


>gi|291544467|emb|CBL17576.1| LSU ribosomal protein L16P [Ruminococcus sp. 18P13]
          Length = 141

 Score =  198 bits (503), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 66/134 (49%), Positives = 92/134 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +  +GR+ G A  G+++ +G++ L++ E   I S++IE+AR A++R +KR
Sbjct: 1   MLLPKRVKYRRVHRGRMTGKALRGNKVSYGDYGLQSLEPAWITSNQIESARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT+KP   RMGKGKG  E WV  VKPGR++FEI GV EE AR A RL
Sbjct: 61  GGQVWIKIFPDKPVTSKPLGTRMGKGKGAPEYWVAVVKPGRVMFEIAGVPEETAREALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL V  KF+++
Sbjct: 121 AMHKLPVKCKFVKK 134


>gi|222056698|ref|YP_002539060.1| ribosomal protein L16 [Geobacter sp. FRC-32]
 gi|254799203|sp|B9M6H1|RL16_GEOSF RecName: Full=50S ribosomal protein L16
 gi|221565987|gb|ACM21959.1| ribosomal protein L16 [Geobacter sp. FRC-32]
          Length = 140

 Score =  198 bits (503), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 72/134 (53%), Positives = 97/134 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQ KGR+ G  + G  + FG++ L+A E   + S +IEAAR A++R +KR
Sbjct: 1   MLMPKKVKHRKQMKGRMSGTPQRGVSLAFGDYGLQATECGWLDSRQIEAARIAMNRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+TAKP E RMGKGKG+ + WVC +KPGRIL+E++GV+EEVAR AFRL
Sbjct: 61  GGKIWIRIFPDKPLTAKPAETRMGKGKGSPDSWVCVIKPGRILYEMEGVTEEVAREAFRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + TKF  R
Sbjct: 121 AAHKLPIPTKFTSR 134


>gi|323490630|ref|ZP_08095835.1| 50S ribosomal protein L16 [Planococcus donghaensis MPA1U2]
 gi|323395722|gb|EGA88563.1| 50S ribosomal protein L16 [Planococcus donghaensis MPA1U2]
          Length = 144

 Score =  197 bits (502), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 72/135 (53%), Positives = 96/135 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY ++ +G+++G AKGG  I FG F L+A E++ I + +IEAAR +++R MKR
Sbjct: 1   MLMPKRVKYRREHRGKMRGEAKGGKEIAFGEFGLQALESSWITNRQIEAARISMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP  P T KP EVRMG GKG+ E WV  VK G+I+FE+ GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPHKPYTKKPLEVRMGSGKGSPEGWVAVVKTGKIMFELGGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL V TKF++R 
Sbjct: 121 ASHKLPVKTKFVKRE 135


>gi|297582457|ref|YP_003698237.1| 50S ribosomal protein L16 [Bacillus selenitireducens MLS10]
 gi|297140914|gb|ADH97671.1| ribosomal protein L16 [Bacillus selenitireducens MLS10]
          Length = 144

 Score =  197 bits (502), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 74/135 (54%), Positives = 98/135 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ ++ +G+++G AKGG  I FG + L+A EA+ I + +IE+AR A++R MKR
Sbjct: 1   MLMPKRVKFRREHRGKMRGRAKGGKEIAFGEYGLQALEASWITNRQIESARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P T+KP EVRMG GKG  E WV  VKPG+I+FEI GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPDKPYTSKPLEVRMGSGKGAPEGWVAVVKPGKIMFEIAGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL V TKF++R 
Sbjct: 121 ASHKLPVRTKFVKRE 135


>gi|149915851|ref|ZP_01904375.1| 50S ribosomal protein L16 [Roseobacter sp. AzwK-3b]
 gi|149810174|gb|EDM70020.1| 50S ribosomal protein L16 [Roseobacter sp. AzwK-3b]
          Length = 137

 Score =  197 bits (502), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 86/135 (63%), Positives = 105/135 (77%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQ KGRI GVAKGGS + FG F LKA +  R+ + +IEAARRA++R MKR
Sbjct: 1   MLQPKRTKFRKQHKGRIHGVAKGGSDLNFGTFGLKAAQPERVTARQIEAARRAMTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPD PVT+KPTEVRMGKGKG+V+ W CRVKPGRI+FEIDGVSE +A+ A RL
Sbjct: 61  QGRVWIRIFPDTPVTSKPTEVRMGKGKGSVDFWACRVKPGRIMFEIDGVSETIAKEALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL + T+ + R 
Sbjct: 121 AAMKLPIKTRIVVRE 135


>gi|118411066|ref|YP_874461.1| 50S ribosomal protein L16 [Phaeodactylum tricornutum]
 gi|125987539|sp|A0T0I6|RK16_PHATC RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|116739813|gb|ABK20684.1| 50S ribosomal protein L16 [Phaeodactylum tricornutum]
          Length = 138

 Score =  197 bits (502), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 70/134 (52%), Positives = 88/134 (65%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY K  +GR++G    G+ ICFGNF L+A E   I S +IEAARR I+R  KR
Sbjct: 1   MLSPKRTKYRKYHRGRMRGAKTRGNEICFGNFGLQALEPTWITSRQIEAARRTITRYTKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
             ++WI +FPD  VTA+  E RMG GKG V+ WV  VKPG I+FEI  V EE+A+ A  L
Sbjct: 61  GAKLWIRIFPDKTVTARAAESRMGSGKGAVDYWVAVVKPGTIIFEIGSVPEEIAKTALNL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + TKFI +
Sbjct: 121 AAYKLPIKTKFIIK 134


>gi|304321447|ref|YP_003855090.1| 50S ribosomal protein L16 [Parvularcula bermudensis HTCC2503]
 gi|303300349|gb|ADM09948.1| 50S ribosomal protein L16 [Parvularcula bermudensis HTCC2503]
          Length = 137

 Score =  197 bits (502), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 92/137 (67%), Positives = 113/137 (82%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TKY KQ KGRIKG+AKGG+ + FG++ LKA E  RI S +IEA RRAI+R MKR
Sbjct: 1   MLQPKRTKYRKQHKGRIKGLAKGGTDLNFGSYGLKAVEPERITSRQIEATRRAITRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AGRVWI +FPDVPVTAKPTEVRMGKGKG+V++WVC+VKPGRI+FEIDGV E +AR A  L
Sbjct: 61  AGRVWIRIFPDVPVTAKPTEVRMGKGKGSVDRWVCKVKPGRIMFEIDGVPEALAREALEL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
           GAAKL + T+ ++R+ +
Sbjct: 121 GAAKLPIKTRIVKRIGD 137


>gi|294496992|ref|YP_003560692.1| 50S ribosomal protein L16 [Bacillus megaterium QM B1551]
 gi|295702357|ref|YP_003595432.1| 50S ribosomal protein L16 [Bacillus megaterium DSM 319]
 gi|294346929|gb|ADE67258.1| 50S ribosomal protein L16 [Bacillus megaterium QM B1551]
 gi|294800016|gb|ADF37082.1| 50S ribosomal protein L16 [Bacillus megaterium DSM 319]
          Length = 144

 Score =  197 bits (502), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 75/135 (55%), Positives = 97/135 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY ++ +G+++G AKGG+ + FG F L+A EA+ I + +IEAAR A++R MKR
Sbjct: 1   MLLPKRVKYRREHRGKMRGRAKGGTEVHFGEFGLQATEASWITNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP  P TAKP EVRMG GKG  E WV  VKPG+++FEI GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPSKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKVMFEISGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL V  KF++R 
Sbjct: 121 AAHKLPVKCKFVKRE 135


>gi|269837073|ref|YP_003319301.1| 50S ribosomal protein L16 [Sphaerobacter thermophilus DSM 20745]
 gi|269786336|gb|ACZ38479.1| ribosomal protein L16 [Sphaerobacter thermophilus DSM 20745]
          Length = 150

 Score =  197 bits (502), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 63/136 (46%), Positives = 88/136 (64%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ K  +GR+ G A  G+ + FG + ++A E   + S +IEAARRAI+  ++R
Sbjct: 1   MLMPKRVKHRKVQRGRMTGQASRGNTVVFGEYGIQALEPAWVTSRQIEAARRAITNYVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT KP E RMG GKGN E WV  VKPGR++FE+ GV EE+A  A R 
Sbjct: 61  GGKVWIRIFPDKPVTQKPAETRMGSGKGNPEYWVAVVKPGRVMFELGGVREELALEALRR 120

Query: 122 GAAKLSVVTKFIQRVV 137
              K+ +  + ++R V
Sbjct: 121 AIHKMPMKCRVVRREV 136


>gi|225027485|ref|ZP_03716677.1| hypothetical protein EUBHAL_01741 [Eubacterium hallii DSM 3353]
 gi|224955220|gb|EEG36429.1| hypothetical protein EUBHAL_01741 [Eubacterium hallii DSM 3353]
          Length = 146

 Score =  197 bits (502), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 71/134 (52%), Positives = 90/134 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K  KQF+G + G A  G+ I +G+F L A +   I S++IEAAR A++R MKR
Sbjct: 1   MLMPKRVKRRKQFRGSMAGKATKGTAITYGDFGLVACDPCWIKSNQIEAARVAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVTAKP E RMG GKG++E WV  VKPGR++FE+ GV EE AR A RL
Sbjct: 61  GGKVWIKIFPDKPVTAKPAETRMGSGKGSLEYWVAVVKPGRVMFEVAGVPEETAREALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL V  K + R
Sbjct: 121 AMHKLPVKCKIVSR 134


>gi|225574708|ref|ZP_03783318.1| hypothetical protein RUMHYD_02785 [Blautia hydrogenotrophica DSM
           10507]
 gi|225038073|gb|EEG48319.1| hypothetical protein RUMHYD_02785 [Blautia hydrogenotrophica DSM
           10507]
          Length = 145

 Score =  197 bits (502), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 69/134 (51%), Positives = 89/134 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K  KQF+G ++G A  G++I +G + L A E   I S++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKRRKQFRGSMRGKALRGNKINYGEYGLVATEPCWIRSNQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVTAKP E RMG GKG++E WV  VKPGR++FEI GV E  AR A RL
Sbjct: 61  GGQVWIKIFPDKPVTAKPAETRMGSGKGSLEYWVAVVKPGRVMFEIAGVPEATAREALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL    K + R
Sbjct: 121 AMHKLPCKCKIVSR 134


>gi|168334345|ref|ZP_02692532.1| 50S ribosomal protein L16 [Epulopiscium sp. 'N.t. morphotype B']
          Length = 146

 Score =  197 bits (502), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 70/135 (51%), Positives = 94/135 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K  +QF+GR+KG A  G++I +G + + A E   I S++IE+AR A++R +KR
Sbjct: 1   MLMPKRVKRRRQFRGRMKGKATRGNKITYGEYGIVALEPGWIKSNQIESARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVTAKP E RMG GKG+ E WV  VKPGR++FE+ GV+EEVAR A RL
Sbjct: 61  GGKVWIKIFPDKPVTAKPAETRMGSGKGSPEYWVAVVKPGRVMFELSGVAEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  K + RV
Sbjct: 121 AVHKLPIKCKVVSRV 135


>gi|212697260|ref|ZP_03305388.1| hypothetical protein ANHYDRO_01828 [Anaerococcus hydrogenalis DSM
           7454]
 gi|325848900|ref|ZP_08170410.1| ribosomal protein L16 [Anaerococcus hydrogenalis ACS-025-V-Sch4]
 gi|212675709|gb|EEB35316.1| hypothetical protein ANHYDRO_01828 [Anaerococcus hydrogenalis DSM
           7454]
 gi|325480544|gb|EGC83606.1| ribosomal protein L16 [Anaerococcus hydrogenalis ACS-025-V-Sch4]
          Length = 143

 Score =  197 bits (502), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 73/134 (54%), Positives = 97/134 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +Q +GR+KG A+ G+ + +G + L+A  +  + +++IEAARRA++R +KR
Sbjct: 1   MLMPKRVKYRRQHRGRMKGKAQKGNTLAYGEYGLQALGSTWLTANQIEAARRAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G +WI VFPD PV+ KP EVRMG GKG  E WV  VKPGRILFE+ GVSEEVAR A RL
Sbjct: 61  GGNIWIKVFPDKPVSKKPAEVRMGSGKGAPEYWVAVVKPGRILFEMSGVSEEVAREAMRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + TKF++R
Sbjct: 121 AAQKLPIKTKFVKR 134


>gi|37523489|ref|NP_926866.1| 50S ribosomal protein L16 [Gloeobacter violaceus PCC 7421]
 gi|81708560|sp|Q7NEF9|RL16_GLOVI RecName: Full=50S ribosomal protein L16
 gi|35214493|dbj|BAC91861.1| 50S ribosomal protein L16 [Gloeobacter violaceus PCC 7421]
          Length = 148

 Score =  197 bits (502), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 74/134 (55%), Positives = 97/134 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ KQ +GR+ G A  G+ I FG +AL+A E   + S +IEAARRA++R ++R
Sbjct: 1   MLMPKRTKFRKQQRGRMNGAACRGNEIEFGTYALQALEPVWMTSRQIEAARRAMTRYIRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+++I VFPD PVT +  E RMG GKG  E WVC VKPGRILFEIDGV+EE+AR A RL
Sbjct: 61  GGKIYIRVFPDKPVTQRAAETRMGSGKGAPEYWVCVVKPGRILFEIDGVAEEIAREAMRL 120

Query: 122 GAAKLSVVTKFIQR 135
            AAKL + ++FI +
Sbjct: 121 AAAKLPIKSRFIVK 134


>gi|147676662|ref|YP_001210877.1| 50S ribosomal protein L16 [Pelotomaculum thermopropionicum SI]
 gi|189041471|sp|A5D5G2|RL16_PELTS RecName: Full=50S ribosomal protein L16
 gi|146272759|dbj|BAF58508.1| ribosomal protein L16/L10E [Pelotomaculum thermopropionicum SI]
          Length = 144

 Score =  197 bits (502), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 75/135 (55%), Positives = 94/135 (69%), Gaps = 1/135 (0%)

Query: 2   LRQPKNTKYPKQFKGRIKG-VAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMK 60
           +  PK  KY KQ +GR  G +AKGG  I FG + L A E   I + +IEAAR A++R +K
Sbjct: 1   MLIPKRVKYRKQHRGRPGGGMAKGGKEINFGEYGLMALEPAWITNRQIEAARIAMTRHIK 60

Query: 61  RAGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFR 120
           R G+VWI +FPD P+TAKP E RMG GKG  E WV  VKPGRI+FE+ GV+EEVAR A R
Sbjct: 61  RGGKVWIRIFPDKPITAKPAETRMGSGKGTPEYWVAVVKPGRIMFELAGVTEEVAREAMR 120

Query: 121 LGAAKLSVVTKFIQR 135
           L + KL + TKF++R
Sbjct: 121 LASHKLPIKTKFVKR 135


>gi|260589272|ref|ZP_05855185.1| ribosomal protein L16 [Blautia hansenii DSM 20583]
 gi|331082678|ref|ZP_08331801.1| 50S ribosomal protein L16 [Lachnospiraceae bacterium 6_1_63FAA]
 gi|260540353|gb|EEX20922.1| ribosomal protein L16 [Blautia hansenii DSM 20583]
 gi|330400297|gb|EGG79939.1| 50S ribosomal protein L16 [Lachnospiraceae bacterium 6_1_63FAA]
          Length = 145

 Score =  197 bits (502), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 72/134 (53%), Positives = 89/134 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K  KQF+G +KG A  G++I +G F L A E   I S++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKRRKQFRGSMKGKALRGNKINYGEFGLVATEPCWIRSNQIEAARVAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVTAKP E RMG GKG +E WV  VKPGR++FEI GV EE AR A RL
Sbjct: 61  GGKVWIKIFPDKPVTAKPAETRMGSGKGALEYWVAVVKPGRVMFEIAGVPEETAREALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL    K + R
Sbjct: 121 AMHKLPCKCKIVSR 134


>gi|215400765|ref|YP_002327526.1| ribosomal protein L16 [Vaucheria litorea]
 gi|194441215|gb|ACF70943.1| ribosomal protein L16 [Vaucheria litorea]
          Length = 140

 Score =  197 bits (502), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 64/134 (47%), Positives = 92/134 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY K+ +GR+KG A  G+++ FG++ L+A E   I S +IEA RR I+R  KR
Sbjct: 1   MLSPKRTKYRKEHRGRLKGKASRGNKLNFGDYGLQALEPIWITSRQIEATRRTITRYTKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FP+ PVTA+  E RMG GKG+V+ WV  VKPG ILFE+ GVS  +A+ A ++
Sbjct: 61  GGKLWITIFPNKPVTARAAESRMGSGKGSVDYWVAVVKPGTILFELSGVSPLIAKEALKI 120

Query: 122 GAAKLSVVTKFIQR 135
            ++KL +  K I +
Sbjct: 121 ASSKLPIKVKIIIK 134


>gi|33862107|ref|NP_893668.1| 50S ribosomal protein L16 [Prochlorococcus marinus subsp. pastoris
           str. CCMP1986]
 gi|81575583|sp|Q7UZV3|RL16_PROMP RecName: Full=50S ribosomal protein L16
 gi|33634325|emb|CAE20010.1| 50S ribosomal protein L16 [Prochlorococcus marinus subsp. pastoris
           str. CCMP1986]
          Length = 160

 Score =  197 bits (501), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 73/135 (54%), Positives = 97/135 (71%), Gaps = 2/135 (1%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ KQ +GR+KG+A  G+ I FG FAL+AQ+   + + +IEA+RRA++R +KR
Sbjct: 1   MLSPKRTKFRKQHRGRMKGIASKGNTIAFGQFALQAQDCGWVTARQIEASRRAMTRYVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDG--VSEEVARRAF 119
            G++WI +FPD PVT +P E RMG GKGN E WV  VKPGRILFE+ G  ++EE+A+ A 
Sbjct: 61  GGKIWIRIFPDKPVTMRPAETRMGSGKGNPEFWVAVVKPGRILFEMGGEEITEEIAKEAM 120

Query: 120 RLGAAKLSVVTKFIQ 134
           RL   KL V TKFI 
Sbjct: 121 RLAQYKLPVKTKFIS 135


>gi|317054773|ref|YP_004103240.1| 50S ribosomal protein L16 [Ruminococcus albus 7]
 gi|315447042|gb|ADU20606.1| ribosomal protein L16 [Ruminococcus albus 7]
          Length = 140

 Score =  197 bits (501), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 69/135 (51%), Positives = 90/135 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQ +GR+ G A  G+++ +G+F L+A E   I S++IEAAR A++R +KR
Sbjct: 1   MLLPKRVKFRKQHRGRMTGKALRGNKVSYGDFGLQALEPAWITSNQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P T KP   RMGKGKG  E WV  VKPGR++FEI GV EE AR A RL
Sbjct: 61  GGQVWIKIFPDKPATRKPLGTRMGKGKGAPEYWVAVVKPGRVMFEIAGVPEETAREAMRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  KFI + 
Sbjct: 121 AMHKLPIKCKFIVKE 135


>gi|298291445|ref|YP_003693384.1| ribosomal protein L16 [Starkeya novella DSM 506]
 gi|296927956|gb|ADH88765.1| ribosomal protein L16 [Starkeya novella DSM 506]
          Length = 137

 Score =  197 bits (501), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 89/137 (64%), Positives = 107/137 (78%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQFKGRI G AKGG+ + FG F LKA E  R+ + +IEAARRA++R MKR
Sbjct: 1   MLQPKRTKFRKQFKGRISGTAKGGTDLNFGQFGLKALEPERVTARQIEAARRALTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AGRVWI VFPDVPV+ KPTEVRMGKGKG  E W  +VKPGRI+FEIDGVS E+AR A  L
Sbjct: 61  AGRVWIRVFPDVPVSKKPTEVRMGKGKGAPEFWAAKVKPGRIMFEIDGVSHEIAREALTL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            AAKL + T+F++R+ E
Sbjct: 121 AAAKLPIKTRFVERIAE 137


>gi|325663055|ref|ZP_08151505.1| 50S ribosomal protein L16 [Lachnospiraceae bacterium 4_1_37FAA]
 gi|331086662|ref|ZP_08335739.1| 50S ribosomal protein L16 [Lachnospiraceae bacterium 9_1_43BFAA]
 gi|325470509|gb|EGC73739.1| 50S ribosomal protein L16 [Lachnospiraceae bacterium 4_1_37FAA]
 gi|330409828|gb|EGG89263.1| 50S ribosomal protein L16 [Lachnospiraceae bacterium 9_1_43BFAA]
          Length = 145

 Score =  197 bits (501), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 69/135 (51%), Positives = 88/135 (65%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K  KQF+G +KG A  G++I  G + + A E   I S++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKRRKQFRGSMKGKALRGNKITNGEYGIVAMEPCWIRSNQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT KP E RMG GKG +E WV  VKPGR++FE+ GV EEVAR A RL
Sbjct: 61  GGKVWIKIFPDKPVTTKPAETRMGSGKGTLEYWVAVVKPGRVMFELSGVPEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL    K + R 
Sbjct: 121 AMHKLPCKCKIVSRE 135


>gi|119511172|ref|ZP_01630289.1| 50S ribosomal protein L16 [Nodularia spumigena CCY9414]
 gi|119464160|gb|EAW45080.1| 50S ribosomal protein L16 [Nodularia spumigena CCY9414]
          Length = 141

 Score =  197 bits (501), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 73/134 (54%), Positives = 99/134 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+ TK+ KQ +GR++G+A  G  I FG+FAL+AQE + I + +IEA+RRA++R ++R
Sbjct: 1   MLSPRRTKFRKQQRGRMQGLATRGCNIDFGDFALQAQEPSWITARQIEASRRAMTRYIRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T +  E RMG GKGN E WV  VKPGRI+FEI GV+EE+AR A RL
Sbjct: 61  GGQIWIRIFPDKPITMRAAETRMGSGKGNPEYWVAVVKPGRIMFEIAGVTEEIAREAMRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + TKFI R
Sbjct: 121 AANKLPIKTKFIVR 134


>gi|294085965|ref|YP_003552725.1| 50S ribosomal protein L16 [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292665540|gb|ADE40641.1| Ribosomal protein L16 [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 139

 Score =  197 bits (501), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 81/137 (59%), Positives = 106/137 (77%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ K  KGRI G AKGG+++ FG++ LKA    R+ + +IEAARRAI+R ++R
Sbjct: 1   MLSPKRTKFRKAHKGRIHGNAKGGTQLNFGSYGLKAMSPERVTARQIEAARRAITRHLRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPDVPV++KP EVRMGKGKG+ E WV RVKPGRI+FEIDGV  E+A+ AFRL
Sbjct: 61  TGRVWIRIFPDVPVSSKPAEVRMGKGKGSPEFWVARVKPGRIMFEIDGVPWELAQEAFRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            AAKL + TK ++R+ +
Sbjct: 121 AAAKLPLDTKIVRRLGD 137


>gi|292669852|ref|ZP_06603278.1| 50S ribosomal protein L16 [Selenomonas noxia ATCC 43541]
 gi|292648649|gb|EFF66621.1| 50S ribosomal protein L16 [Selenomonas noxia ATCC 43541]
          Length = 145

 Score =  197 bits (501), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 72/134 (53%), Positives = 93/134 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY KQF+GR+KG A+ G+ +  G + L A E   I + +IEAAR A++R +KR
Sbjct: 1   MLLPKRVKYRKQFRGRMKGKAQRGNTVSHGQYGLVALEPAWITNRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVTAKP E RMG GKG+ E WV  VKPGR+LFE+DGV+ +VA  A RL
Sbjct: 61  GGKVWIKIFPDKPVTAKPAETRMGSGKGSPEYWVAVVKPGRVLFEMDGVARDVAAEAMRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL + TKF+ R
Sbjct: 121 AGHKLPIKTKFVVR 134


>gi|144900891|emb|CAM77755.1| 50S ribosomal protein L16 [Magnetospirillum gryphiswaldense MSR-1]
          Length = 137

 Score =  197 bits (501), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 86/137 (62%), Positives = 104/137 (75%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ KQ KGRI G AKGGS++ FG F LKA E  RI + +IEAARRA++R +KR
Sbjct: 1   MLSPKRTKFRKQHKGRIHGDAKGGSQLNFGAFGLKAMEPERITARQIEAARRALTRHLKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPDVPV+ KP EVRMG GKG  E WV RVKPGR++FE+DGV E++ARR F L
Sbjct: 61  QGRVWIRIFPDVPVSTKPAEVRMGSGKGTPEFWVARVKPGRVMFEVDGVPEDLARRGFEL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            AAKL + TKFI R+ E
Sbjct: 121 AAAKLPIKTKFIVRIGE 137


>gi|154245630|ref|YP_001416588.1| 50S ribosomal protein L16 [Xanthobacter autotrophicus Py2]
 gi|226712378|sp|A7IFY8|RL16_XANP2 RecName: Full=50S ribosomal protein L16
 gi|154159715|gb|ABS66931.1| ribosomal protein L16 [Xanthobacter autotrophicus Py2]
          Length = 137

 Score =  197 bits (501), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 93/137 (67%), Positives = 108/137 (78%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQFKGRI GVAKGG+ + FG F LKA E  R+ + +IEAARRA++R MKR
Sbjct: 1   MLQPKRTKFRKQFKGRIHGVAKGGTELNFGEFGLKAVEPERVTARQIEAARRALTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AGRVWI VFPDVPV+AKPTEVRMGKGKG  E W  R+KPGRI+FEIDGVS E AR A  L
Sbjct: 61  AGRVWIRVFPDVPVSAKPTEVRMGKGKGAPEYWAARIKPGRIMFEIDGVSVETAREALTL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            AAKL + T+FIQR+ E
Sbjct: 121 AAAKLPIKTRFIQRIAE 137


>gi|78221853|ref|YP_383600.1| 50S ribosomal protein L16 [Geobacter metallireducens GS-15]
 gi|115502752|sp|Q39XZ9|RL16_GEOMG RecName: Full=50S ribosomal protein L16
 gi|78193108|gb|ABB30875.1| LSU ribosomal protein L16P [Geobacter metallireducens GS-15]
          Length = 140

 Score =  196 bits (500), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 74/134 (55%), Positives = 99/134 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY KQ KGR+ G A  G+ + +G+F L+A E   + S +IEAAR A++R +KR
Sbjct: 1   MLMPKRVKYRKQMKGRMTGAAMRGATLSYGDFGLQATECGWVDSRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T+KP E RMGKGKG+ + WVC VKPG++L+E++GVSEE+AR AFRL
Sbjct: 61  GGKIWIRMFPDKPLTSKPAETRMGKGKGSPDSWVCVVKPGKVLYEMEGVSEEIAREAFRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL V TKFI R
Sbjct: 121 AANKLPVGTKFISR 134


>gi|222150452|ref|YP_002559605.1| 50S ribosomal protein L16 [Macrococcus caseolyticus JCSC5402]
 gi|254799208|sp|B9E9J8|RL16_MACCJ RecName: Full=50S ribosomal protein L16
 gi|222119574|dbj|BAH16909.1| 50S ribosomal protein L16 [Macrococcus caseolyticus JCSC5402]
          Length = 144

 Score =  196 bits (500), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 73/135 (54%), Positives = 92/135 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +Q + +  G +KGG+ + FG + L+A  A  I S +IE+AR A++R MKR
Sbjct: 1   MLLPKRVKYRRQHRPKTTGRSKGGNEVTFGEYGLQATTAAWITSRQIESARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP  P T KP EVRMG GKG VE WV  VKPGRI+FEI GV EEVAR A RL
Sbjct: 61  GGKVWIKIFPHTPYTKKPLEVRMGSGKGAVEGWVAVVKPGRIMFEIAGVPEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL V TKF++R 
Sbjct: 121 ASHKLPVKTKFVKRE 135


>gi|194017497|ref|ZP_03056108.1| ribosomal protein L16 [Bacillus pumilus ATCC 7061]
 gi|194010769|gb|EDW20340.1| ribosomal protein L16 [Bacillus pumilus ATCC 7061]
          Length = 144

 Score =  196 bits (500), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 74/135 (54%), Positives = 99/135 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY ++ +G+++G AKGG+ + FG + ++AQEA+ I + +IEAAR A++R MKR
Sbjct: 1   MLLPKRVKYRREHRGKMRGRAKGGTEVHFGEYGIQAQEASWITNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP  P TAKP EVRMG GKG  E WV  VKPG++LFEI GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPSKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKVLFEISGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL + TKF++R 
Sbjct: 121 ASHKLPIKTKFVKRE 135


>gi|254465857|ref|ZP_05079268.1| ribosomal protein L16 [Rhodobacterales bacterium Y4I]
 gi|206686765|gb|EDZ47247.1| ribosomal protein L16 [Rhodobacterales bacterium Y4I]
          Length = 137

 Score =  196 bits (500), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 83/135 (61%), Positives = 104/135 (77%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGRI G+AKGGS + FG + LKA +  R+ + +IEAARRA++R MKR
Sbjct: 1   MLQPKRTKFRKMHKGRIHGLAKGGSDLNFGTYGLKATQPERVTARQIEAARRAMTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPD PVT+KPTEVRMGKGKG+V+ W  +VKPGR++FEIDGVS+EVAR A RL
Sbjct: 61  QGRVWIRIFPDTPVTSKPTEVRMGKGKGSVDYWAAKVKPGRVMFEIDGVSDEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL V T+ + R 
Sbjct: 121 AAMKLPVKTRVVVRE 135


>gi|116075760|ref|ZP_01473019.1| 50S ribosomal protein L16 [Synechococcus sp. RS9916]
 gi|116067075|gb|EAU72830.1| 50S ribosomal protein L16 [Synechococcus sp. RS9916]
          Length = 158

 Score =  196 bits (500), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 73/135 (54%), Positives = 95/135 (70%), Gaps = 2/135 (1%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQ +GR++GVA  G+ I FG FAL+AQE   I S +IEA+RRA++R +KR
Sbjct: 1   MLSPKRVKFRKQQRGRMRGVATRGNTIAFGQFALQAQECGWITSRQIEASRRAMTRYVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDG--VSEEVARRAF 119
            G++WI +FPD P+T +P E RMG GKGN E WV  +KPGRILFE+ G  ++ E+AR A 
Sbjct: 61  GGKIWIRIFPDKPITMRPAETRMGSGKGNPEFWVAVIKPGRILFEMGGDEITPEIAREAM 120

Query: 120 RLGAAKLSVVTKFIQ 134
           RL   KL V TKFI 
Sbjct: 121 RLAQYKLPVKTKFIT 135


>gi|229825314|ref|ZP_04451383.1| hypothetical protein GCWU000182_00668 [Abiotrophia defectiva ATCC
           49176]
 gi|229790686|gb|EEP26800.1| hypothetical protein GCWU000182_00668 [Abiotrophia defectiva ATCC
           49176]
          Length = 142

 Score =  196 bits (500), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 66/134 (49%), Positives = 91/134 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQF+G +KG A  G+ I  G F + A E + + S++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKHRKQFRGSMKGAAHRGNTITNGEFGIVATEPSWVKSNQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT +P E RMG GKG+++ WV  VKPGR++FEI GV EE+AR A RL
Sbjct: 61  GGKVWIKIFPDKPVTIQPAETRMGSGKGSLDYWVAVVKPGRVMFEIGGVDEEIAREALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL +  K + +
Sbjct: 121 AMHKLPLKCKVVSK 134


>gi|331091660|ref|ZP_08340494.1| 50S ribosomal protein L16 [Lachnospiraceae bacterium 2_1_46FAA]
 gi|330403417|gb|EGG82976.1| 50S ribosomal protein L16 [Lachnospiraceae bacterium 2_1_46FAA]
          Length = 145

 Score =  196 bits (500), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 68/135 (50%), Positives = 87/135 (64%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K  KQF+G +KG A  G++I  G + + A E   I S++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKRRKQFRGSMKGKALRGNKITNGEYGIVATEPCWIRSNQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT KP E RMG GKG +E WV  VKPGR++FE+ GV EE AR A RL
Sbjct: 61  GGKVWIKIFPDKPVTTKPAETRMGSGKGTLEYWVAVVKPGRVMFELAGVPEETAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL    K + R 
Sbjct: 121 AMHKLPCKCKIVSRE 135


>gi|148263147|ref|YP_001229853.1| 50S ribosomal protein L16 [Geobacter uraniireducens Rf4]
 gi|189041463|sp|A5GAX2|RL16_GEOUR RecName: Full=50S ribosomal protein L16
 gi|146396647|gb|ABQ25280.1| LSU ribosomal protein L16P [Geobacter uraniireducens Rf4]
          Length = 140

 Score =  196 bits (500), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 73/134 (54%), Positives = 96/134 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY KQ KGR+ G  + G  + FG F L+A E   + S +IEAAR A++R +KR
Sbjct: 1   MLMPKKVKYRKQMKGRMSGTPQRGVSLAFGEFGLQATECGWLDSRQIEAARIAMNRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+TAKP E RMGKGKG+ + WVC +KPGRIL+E++GV+EE+AR AFRL
Sbjct: 61  GGKIWIRIFPDKPLTAKPAETRMGKGKGSPDSWVCVIKPGRILYEMEGVTEEIAREAFRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + TKF  R
Sbjct: 121 AAHKLPIPTKFTSR 134


>gi|254454068|ref|ZP_05067505.1| ribosomal protein L16 [Octadecabacter antarcticus 238]
 gi|198268474|gb|EDY92744.1| ribosomal protein L16 [Octadecabacter antarcticus 238]
          Length = 137

 Score =  196 bits (500), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 88/135 (65%), Positives = 107/135 (79%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQ KGRIKG AKGGS + FG + LKA E  R+ + +IEAARRA++R MKR
Sbjct: 1   MLQPKRTKFRKQHKGRIKGEAKGGSDLTFGTYGLKATEPERVTARQIEAARRAMTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPDVPVT+KPTEVRMGKGKG+V+ W C+VKPGRI+FEIDGVSE++AR A RL
Sbjct: 61  QGRVWIRIFPDVPVTSKPTEVRMGKGKGSVDYWACKVKPGRIMFEIDGVSEDIAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL V T+ + R 
Sbjct: 121 AAMKLPVKTRTVLRE 135


>gi|197117330|ref|YP_002137757.1| 50S ribosomal protein L16 [Geobacter bemidjiensis Bem]
 gi|253701915|ref|YP_003023104.1| 50S ribosomal protein L16 [Geobacter sp. M21]
 gi|226710730|sp|B5EFQ7|RL16_GEOBB RecName: Full=50S ribosomal protein L16
 gi|259645653|sp|C6E4Q0|RL16_GEOSM RecName: Full=50S ribosomal protein L16
 gi|197086690|gb|ACH37961.1| ribosomal protein L16 [Geobacter bemidjiensis Bem]
 gi|251776765|gb|ACT19346.1| ribosomal protein L16 [Geobacter sp. M21]
          Length = 140

 Score =  196 bits (500), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 74/135 (54%), Positives = 98/135 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY KQ KGR+ G  + G  + FG+F L+A E   + S +IEAAR A++R +KR
Sbjct: 1   MLMPKKVKYRKQMKGRMTGTPQRGVELAFGDFGLQATECGWLDSRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T+KP E RMGKGKG+ + WVC +KPGRIL+E++GV+EEVAR AFRL
Sbjct: 61  GGKIWIRIFPDKPLTSKPAETRMGKGKGSPDSWVCVIKPGRILYEMEGVTEEVAREAFRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL V +KFI R 
Sbjct: 121 AAHKLPVASKFITRT 135


>gi|268316415|ref|YP_003290134.1| 50S ribosomal protein L16 [Rhodothermus marinus DSM 4252]
 gi|262333949|gb|ACY47746.1| ribosomal protein L16 [Rhodothermus marinus DSM 4252]
          Length = 144

 Score =  196 bits (500), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 80/134 (59%), Positives = 102/134 (76%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+ TKY KQ KGRIKG+A  G++I FG+F +KA E  RI S +IEAAR AI+R ++R
Sbjct: 1   MLMPRRTKYRKQQKGRIKGLASRGTQIEFGDFGIKALEPARITSRQIEAARVAITRKLRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+V+I +FPD PVT KP EVRMGKGKG+VE WV  V+PGRILFE+ GV EE+AR A RL
Sbjct: 61  TGKVYIRIFPDKPVTKKPAEVRMGKGKGSVEFWVAVVEPGRILFEVGGVPEELAREALRL 120

Query: 122 GAAKLSVVTKFIQR 135
            + KL + TKF++R
Sbjct: 121 ASHKLPIKTKFVKR 134


>gi|154483180|ref|ZP_02025628.1| hypothetical protein EUBVEN_00881 [Eubacterium ventriosum ATCC
           27560]
 gi|149735988|gb|EDM51874.1| hypothetical protein EUBVEN_00881 [Eubacterium ventriosum ATCC
           27560]
          Length = 145

 Score =  196 bits (499), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 68/134 (50%), Positives = 90/134 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K  KQF+G ++G A  G++I +G + + A E   I S++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKRRKQFRGSMRGKATRGNKISYGEYGIVAMEPGWIKSNQIEAARIAMTRYVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVTA P E RMGKGKG +E WV  VKPGR++FEI GV EE A+ A RL
Sbjct: 61  GGKVWIKIFPDKPVTATPAETRMGKGKGALEYWVAVVKPGRVMFEIAGVPEETAKEALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL +  K + R
Sbjct: 121 ATHKLPIKCKVVSR 134


>gi|172056147|ref|YP_001812607.1| 50S ribosomal protein L16 [Exiguobacterium sibiricum 255-15]
 gi|226710727|sp|B1YGV7|RL16_EXIS2 RecName: Full=50S ribosomal protein L16
 gi|171988668|gb|ACB59590.1| ribosomal protein L16 [Exiguobacterium sibiricum 255-15]
          Length = 145

 Score =  196 bits (499), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 71/135 (52%), Positives = 94/135 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +  +G ++G AK G+ + FG F ++AQEA+ I S +IE+AR A++R MKR
Sbjct: 1   MLLPKRVKYRRVHRGNMRGKAKRGTTVHFGEFGIQAQEASWITSRQIESARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP  P T KP EVRMG GKG  E WV  VKPG+++FEI GVSEE+AR A RL
Sbjct: 61  GGKVWIKIFPHKPYTKKPLEVRMGSGKGAPEGWVAVVKPGKVMFEIAGVSEEIAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL V  KF++R 
Sbjct: 121 ASHKLPVKCKFVKRE 135


>gi|123969290|ref|YP_001010148.1| 50S ribosomal protein L16 [Prochlorococcus marinus str. AS9601]
 gi|166199705|sp|A2BTD0|RL16_PROMS RecName: Full=50S ribosomal protein L16
 gi|123199400|gb|ABM71041.1| 50S ribosomal protein L16 [Prochlorococcus marinus str. AS9601]
          Length = 160

 Score =  196 bits (499), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 73/135 (54%), Positives = 96/135 (71%), Gaps = 2/135 (1%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ KQ +GR++GVA  G+ I FG FAL+AQ+   + + +IEA+RRA++R +KR
Sbjct: 1   MLSPKRTKFRKQHRGRMRGVASKGNTIAFGQFALQAQDCGWVTARQIEASRRAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDG--VSEEVARRAF 119
            G++WI +FPD PVT +P E RMG GKGN E WV  VKPGRILFE+ G  ++EE A+ A 
Sbjct: 61  GGQIWIRIFPDKPVTMRPAETRMGSGKGNPEFWVAVVKPGRILFEMGGEDITEETAKEAM 120

Query: 120 RLGAAKLSVVTKFIQ 134
           RL   KL V TKFI 
Sbjct: 121 RLAQYKLPVKTKFIS 135


>gi|283796552|ref|ZP_06345705.1| ribosomal protein L16 [Clostridium sp. M62/1]
 gi|291075966|gb|EFE13330.1| ribosomal protein L16 [Clostridium sp. M62/1]
 gi|295092554|emb|CBK78661.1| LSU ribosomal protein L16P [Clostridium cf. saccharolyticum K10]
          Length = 145

 Score =  196 bits (499), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 72/134 (53%), Positives = 88/134 (65%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K  KQF+G ++G A  G+ IC+G F L A E   I S++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKRRKQFRGSMRGKATRGNVICYGEFGLVATEPCWIRSNQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVTAKP E RMG GKG +E WV  VKPGR+LFEI GV EE AR A RL
Sbjct: 61  GGKVWIKIFPDKPVTAKPAETRMGSGKGALEYWVAVVKPGRVLFEIAGVPEETAREALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL    K   +
Sbjct: 121 AMHKLPCKCKIASK 134


>gi|296116725|ref|ZP_06835335.1| 50S ribosomal protein L16 [Gluconacetobacter hansenii ATCC 23769]
 gi|295976937|gb|EFG83705.1| 50S ribosomal protein L16 [Gluconacetobacter hansenii ATCC 23769]
          Length = 138

 Score =  196 bits (499), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 86/137 (62%), Positives = 104/137 (75%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ K  KGRI G+AKGG+ + FG F LKA +  RI + +IEAARRAI+R MKR
Sbjct: 1   MLSPKRTKFRKAHKGRIHGLAKGGTTLNFGAFGLKALQPERITARQIEAARRAITRAMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AGRVWI +FPD+PV+ KP EVRMG GKG+ E WV RVK GRILFEI+GVS EVAR A  L
Sbjct: 61  AGRVWIRIFPDLPVSTKPAEVRMGSGKGSPEYWVARVKSGRILFEIEGVSPEVAREALAL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
           GAAKL + TKF+ R+ +
Sbjct: 121 GAAKLPIKTKFVTRIGD 137


>gi|260432437|ref|ZP_05786408.1| ribosomal protein L16 [Silicibacter lacuscaerulensis ITI-1157]
 gi|260416265|gb|EEX09524.1| ribosomal protein L16 [Silicibacter lacuscaerulensis ITI-1157]
          Length = 137

 Score =  196 bits (499), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 81/135 (60%), Positives = 104/135 (77%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGRIKG AKGGS + FG + LKA +  R+ + +IEAARRA++R MKR
Sbjct: 1   MLQPKRTKFRKMHKGRIKGEAKGGSDLNFGTYGLKALQPERVTARQIEAARRAMTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPD PVT+KPTEVRMGKGKG+V+ W  +VKPGR++FEIDGV++E+AR A RL
Sbjct: 61  QGRVWIRIFPDTPVTSKPTEVRMGKGKGSVDYWAAKVKPGRVMFEIDGVNDEIAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL + T+ + R 
Sbjct: 121 AAMKLPIKTRVVVRE 135


>gi|325678565|ref|ZP_08158175.1| ribosomal protein L16 [Ruminococcus albus 8]
 gi|324109615|gb|EGC03821.1| ribosomal protein L16 [Ruminococcus albus 8]
          Length = 140

 Score =  196 bits (499), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 69/135 (51%), Positives = 90/135 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQ +GR+ G A  G+++ +G+F L+A E   I S++IEAAR A++R +KR
Sbjct: 1   MLLPKRVKFRKQHRGRMTGKALRGNKVSYGDFGLQALEPAWITSNQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P T KP   RMGKGKG  E WV  VKPGR++FEI GV EE AR A RL
Sbjct: 61  GGQVWIKLFPDKPATRKPLGTRMGKGKGAPEYWVAVVKPGRVMFEIAGVPEETAREAMRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  KFI + 
Sbjct: 121 AMHKLPIKCKFIVKE 135


>gi|167465560|ref|ZP_02330649.1| 50S ribosomal protein L16 [Paenibacillus larvae subsp. larvae
           BRL-230010]
 gi|322381119|ref|ZP_08055122.1| 50S ribosomal protein L16-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
 gi|321154695|gb|EFX46966.1| 50S ribosomal protein L16-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
          Length = 144

 Score =  196 bits (499), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 74/135 (54%), Positives = 97/135 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ K+ +G +KG AKGG+ + FG + L+A E   + + +IEAAR A++R +KR
Sbjct: 1   MLMPKRVKHRKEHRGSMKGRAKGGTEVAFGEYGLQALEPAWVTNRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP  P+T KP EVRMG GKGNVEKWV  VKPG+I+FE+ GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPSKPITQKPFEVRMGSGKGNVEKWVSVVKPGKIMFELAGVSEEVAREAMRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL V  KF++R 
Sbjct: 121 AAHKLPVKCKFVKRE 135


>gi|258542034|ref|YP_003187467.1| 50S ribosomal protein L16 [Acetobacter pasteurianus IFO 3283-01]
 gi|256633112|dbj|BAH99087.1| LSU ribosomal protein L16P [Acetobacter pasteurianus IFO 3283-01]
 gi|256636169|dbj|BAI02138.1| LSU ribosomal protein L16P [Acetobacter pasteurianus IFO 3283-03]
 gi|256639224|dbj|BAI05186.1| LSU ribosomal protein L16P [Acetobacter pasteurianus IFO 3283-07]
 gi|256642278|dbj|BAI08233.1| LSU ribosomal protein L16P [Acetobacter pasteurianus IFO 3283-22]
 gi|256645333|dbj|BAI11281.1| LSU ribosomal protein L16P [Acetobacter pasteurianus IFO 3283-26]
 gi|256648388|dbj|BAI14329.1| LSU ribosomal protein L16P [Acetobacter pasteurianus IFO 3283-32]
 gi|256651441|dbj|BAI17375.1| LSU ribosomal protein L16P [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256654432|dbj|BAI20359.1| LSU ribosomal protein L16P [Acetobacter pasteurianus IFO 3283-12]
          Length = 138

 Score =  196 bits (499), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 83/137 (60%), Positives = 103/137 (75%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ K  KGRI G+AK G+ + FG F LKA +  RI + +IEA+RRAI+R MKR
Sbjct: 1   MLSPKRTKFRKAHKGRIHGLAKSGTTLNFGTFGLKALQPERITARQIEASRRAITRAMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AGRVWI +FPD+PV+ KP EVRMG GKG+ E WV RVKPGRILFEI+GV  E+AR A  L
Sbjct: 61  AGRVWIRIFPDLPVSTKPAEVRMGSGKGSPEFWVARVKPGRILFEIEGVPPELAREALAL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
           GAAKL + TKF+ R+ +
Sbjct: 121 GAAKLPIKTKFVTRIGD 137


>gi|99080097|ref|YP_612251.1| 50S ribosomal protein L16 [Ruegeria sp. TM1040]
 gi|259416880|ref|ZP_05740800.1| ribosomal protein L16 [Silicibacter sp. TrichCH4B]
 gi|115502792|sp|Q1GK27|RL16_SILST RecName: Full=50S ribosomal protein L16
 gi|99036377|gb|ABF62989.1| LSU ribosomal protein L16P [Ruegeria sp. TM1040]
 gi|259348319|gb|EEW60096.1| ribosomal protein L16 [Silicibacter sp. TrichCH4B]
          Length = 137

 Score =  196 bits (499), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 82/135 (60%), Positives = 104/135 (77%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGRIKG+AKGGS + FG + LKA    R+ + +IEAARRA++R MKR
Sbjct: 1   MLQPKRTKFRKMHKGRIKGLAKGGSDLNFGTYGLKAVTPERVTARQIEAARRAMTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPD PVT+KP EVRMGKGKG+V+ W C+VKPGR++FEIDGV+E++AR A RL
Sbjct: 61  QGRVWIRIFPDTPVTSKPVEVRMGKGKGSVDFWACKVKPGRVMFEIDGVNEDIAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL V T+ + R 
Sbjct: 121 AAMKLPVQTRIVVRE 135


>gi|291518038|emb|CBK73259.1| LSU ribosomal protein L16P [Butyrivibrio fibrisolvens 16/4]
          Length = 142

 Score =  196 bits (499), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 72/135 (53%), Positives = 91/135 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQF+G + G A  G++I +G + + A E   I S++IEAAR A++R +KR
Sbjct: 1   MLMPKRAKHRKQFRGNMAGKASRGNKIAYGEYGIVAMEPAWIKSNQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVTAKP E RMG GKG +E WV  VKPGR+LFEI GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPDKPVTAKPAETRMGSGKGTLEYWVAVVKPGRVLFEISGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL    K + R 
Sbjct: 121 ATHKLPCKCKIVSRE 135


>gi|226323017|ref|ZP_03798535.1| hypothetical protein COPCOM_00789 [Coprococcus comes ATCC 27758]
 gi|225208584|gb|EEG90938.1| hypothetical protein COPCOM_00789 [Coprococcus comes ATCC 27758]
          Length = 145

 Score =  196 bits (499), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 69/134 (51%), Positives = 88/134 (65%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K  KQF+G +KG A  G++I  G + L A E   I S++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKRRKQFRGSMKGKALRGNKITNGEYGLVAMEPCWIRSNQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT KP E RMG GKG +E WV  VKPGR++FE+ GV EEVA+ A RL
Sbjct: 61  GGKVWIKIFPDKPVTTKPAETRMGSGKGTLEYWVAVVKPGRVMFELAGVPEEVAKEALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL    K + R
Sbjct: 121 AMHKLPCKCKIVSR 134


>gi|256544513|ref|ZP_05471886.1| 50S ribosomal protein L16 [Anaerococcus vaginalis ATCC 51170]
 gi|256399838|gb|EEU13442.1| 50S ribosomal protein L16 [Anaerococcus vaginalis ATCC 51170]
          Length = 143

 Score =  196 bits (499), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 71/134 (52%), Positives = 97/134 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +Q +GR+KG A+ G+ + +G + L++  +  + +++IEAARRA++R +KR
Sbjct: 1   MLMPKRVKYRRQHRGRMKGKAQKGNTLSYGEYGLQSLGSTWLTANQIEAARRAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G +WI VFPD PV+ KP EVRMG GKG  E WV  VKPGR+LFE+ GVSEEVAR A RL
Sbjct: 61  GGNIWIKVFPDKPVSKKPAEVRMGSGKGAPEYWVAVVKPGRMLFEMSGVSEEVAREAMRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + TKF++R
Sbjct: 121 AAQKLPIKTKFVKR 134


>gi|88807891|ref|ZP_01123402.1| 50S ribosomal protein L16 [Synechococcus sp. WH 7805]
 gi|88787930|gb|EAR19086.1| 50S ribosomal protein L16 [Synechococcus sp. WH 7805]
          Length = 157

 Score =  196 bits (499), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 72/135 (53%), Positives = 94/135 (69%), Gaps = 2/135 (1%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQ +GR++GVA  G+ I FG FAL+AQE   I S +IEA+RRA++R +KR
Sbjct: 1   MLSPKRVKFRKQQRGRMRGVATRGNTIAFGQFALQAQECGWITSRQIEASRRAMTRYVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDG--VSEEVARRAF 119
            G++WI +FPD PVT +  E RMG GKGN E WV  +KPGRILFE+ G  ++ E+A+ A 
Sbjct: 61  GGKIWIRIFPDKPVTMRAAETRMGSGKGNPEFWVAVIKPGRILFEMGGDEITPEIAKEAM 120

Query: 120 RLGAAKLSVVTKFIQ 134
           RL   KL V TKFI 
Sbjct: 121 RLAQYKLPVKTKFIS 135


>gi|240145871|ref|ZP_04744472.1| ribosomal protein L16 [Roseburia intestinalis L1-82]
 gi|257202020|gb|EEV00305.1| ribosomal protein L16 [Roseburia intestinalis L1-82]
 gi|291535437|emb|CBL08549.1| LSU ribosomal protein L16P [Roseburia intestinalis M50/1]
 gi|291537919|emb|CBL11030.1| LSU ribosomal protein L16P [Roseburia intestinalis XB6B4]
          Length = 145

 Score =  196 bits (498), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 65/134 (48%), Positives = 88/134 (65%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQF+G + G A  G+ I +G + + + E   I +++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKHRKQFRGSMSGKATRGNTITYGEYGIISTEPCWIKANQIEAARVAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP+ P+T KP  VRMGKGKG  E WV  VKPGR+LFEI GV E+VA+ A RL
Sbjct: 61  GGKVWIKIFPEKPITHKPMGVRMGKGKGAPEYWVAVVKPGRVLFEISGVPEDVAKEALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL    K + R
Sbjct: 121 ATHKLPCKCKVVSR 134


>gi|134298100|ref|YP_001111596.1| 50S ribosomal protein L16 [Desulfotomaculum reducens MI-1]
 gi|172044224|sp|A4J118|RL16_DESRM RecName: Full=50S ribosomal protein L16
 gi|134050800|gb|ABO48771.1| LSU ribosomal protein L16P [Desulfotomaculum reducens MI-1]
          Length = 144

 Score =  196 bits (498), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 69/135 (51%), Positives = 88/135 (65%), Gaps = 1/135 (0%)

Query: 2   LRQPKNTKYPKQFKGR-IKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMK 60
           +  PK  KY KQ + R   GV+KGG  + FG + ++A EA  I + +IEAAR A++R +K
Sbjct: 1   MLIPKRVKYRKQHRPRGNGGVSKGGREVSFGEYGIQALEAGWITNRQIEAARIAMTRYIK 60

Query: 61  RAGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFR 120
           R G+VWI +FPD P+T KP E RMG GKG  E WV  VKPGR++FE+ GV E  AR A R
Sbjct: 61  RGGKVWIRIFPDKPITQKPAETRMGSGKGAPEHWVAVVKPGRVMFEVAGVPEATAREAMR 120

Query: 121 LGAAKLSVVTKFIQR 135
           L   KL V  KF+ R
Sbjct: 121 LAMHKLPVKCKFVVR 135


>gi|83858559|ref|ZP_00952081.1| 50S ribosomal protein L16 [Oceanicaulis alexandrii HTCC2633]
 gi|83853382|gb|EAP91234.1| 50S ribosomal protein L16 [Oceanicaulis alexandrii HTCC2633]
          Length = 137

 Score =  196 bits (498), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 88/137 (64%), Positives = 105/137 (76%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGRI G AKGG  + FG++ LKA E  RI + +IEA RRAI+R MKR
Sbjct: 1   MLQPKRTKFRKAHKGRIHGQAKGGFTLTFGSYGLKAVEPERITARQIEATRRAITRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AGRVWI VFPD+PV+ KPTEVRMGKGKG+ E WV +VKPGRI+FEIDGV ++VAR A RL
Sbjct: 61  AGRVWIRVFPDLPVSKKPTEVRMGKGKGSPEYWVAKVKPGRIIFEIDGVPDDVAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
           GAAKL + TK + R  E
Sbjct: 121 GAAKLPIKTKVVTRPGE 137


>gi|227497188|ref|ZP_03927436.1| ribosomal protein L16 [Actinomyces urogenitalis DSM 15434]
 gi|226833319|gb|EEH65702.1| ribosomal protein L16 [Actinomyces urogenitalis DSM 15434]
          Length = 139

 Score =  196 bits (498), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 65/135 (48%), Positives = 91/135 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+ TK+ KQ +    G++KGG++I FG++ ++A E   I + +IEAAR A++R +KR
Sbjct: 1   MLIPRRTKFRKQHRPHRSGLSKGGNQIAFGDYGIQALEPAYITNRQIEAARIAMTRHVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T KP E RMG GKG  E W+  VKPGRILFE+ GV E +AR A R 
Sbjct: 61  GGKVWINIFPDRPLTKKPAETRMGSGKGAPEWWIANVKPGRILFELGGVDEALAREAMRR 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL + T+F+ R 
Sbjct: 121 AQHKLPMKTRFVTRE 135


>gi|323703541|ref|ZP_08115187.1| ribosomal protein L16 [Desulfotomaculum nigrificans DSM 574]
 gi|323531532|gb|EGB21425.1| ribosomal protein L16 [Desulfotomaculum nigrificans DSM 574]
          Length = 144

 Score =  196 bits (498), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 67/135 (49%), Positives = 88/135 (65%), Gaps = 1/135 (0%)

Query: 2   LRQPKNTKYPKQFKGR-IKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMK 60
           +  PK  KY KQ + R   GV KGG+ + FG + ++A EA  I + +IEAAR A++R +K
Sbjct: 1   MLIPKRVKYRKQHRPRGNGGVTKGGAEVSFGEYGIQALEAGWITNRQIEAARIAMTRYIK 60

Query: 61  RAGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFR 120
           R G+VWI ++PD P+T KP E RMG GKG  E WV  VKPGR++FE+ GV E  AR A R
Sbjct: 61  RGGKVWIRIYPDKPITQKPAETRMGSGKGAPEHWVAVVKPGRVMFEVAGVPEATAREALR 120

Query: 121 LGAAKLSVVTKFIQR 135
           L   KL V  K ++R
Sbjct: 121 LATHKLPVKCKIVKR 135


>gi|153854977|ref|ZP_01996190.1| hypothetical protein DORLON_02196 [Dorea longicatena DSM 13814]
 gi|149752474|gb|EDM62405.1| hypothetical protein DORLON_02196 [Dorea longicatena DSM 13814]
          Length = 145

 Score =  196 bits (498), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 70/134 (52%), Positives = 88/134 (65%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K  KQF+G +KG A  G++I  G + + A E   I S++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKRRKQFRGTMKGKALRGNQITNGEYGIVATEPCWIRSNQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT KP E RMG GKG +E WV  VKPGR+LFEI GV EEVA+ A RL
Sbjct: 61  GGKVWIKIFPDKPVTTKPAETRMGSGKGTLEYWVAVVKPGRVLFEIAGVPEEVAKEALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL    K + R
Sbjct: 121 ATHKLPCKCKVVSR 134


>gi|260428512|ref|ZP_05782491.1| ribosomal protein L16 [Citreicella sp. SE45]
 gi|260423004|gb|EEX16255.1| ribosomal protein L16 [Citreicella sp. SE45]
          Length = 137

 Score =  196 bits (498), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 83/135 (61%), Positives = 106/135 (78%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K FKGRI G AKGGS + FG++ LKA +  R+ + +IEAARRA++R MKR
Sbjct: 1   MLQPKRTKFRKMFKGRISGEAKGGSDLNFGHYGLKALQPERVTARQIEAARRAMTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPD PVT+KPTEVRMGKGKG+V+ W C+VKPGR++FEIDGVSE++AR A RL
Sbjct: 61  QGRVWIRIFPDTPVTSKPTEVRMGKGKGSVDYWACKVKPGRVMFEIDGVSEDIAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL + T+ + R 
Sbjct: 121 AAMKLPIKTRVVVRE 135


>gi|254294433|ref|YP_003060456.1| 50S ribosomal protein L16 [Hirschia baltica ATCC 49814]
 gi|254042964|gb|ACT59759.1| ribosomal protein L16 [Hirschia baltica ATCC 49814]
          Length = 137

 Score =  196 bits (498), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 89/137 (64%), Positives = 110/137 (80%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQFKGRIKG AKGG+ + FG++ LKA E  R+ S +IEA RRAI+R MKR
Sbjct: 1   MLQPKRTKFRKQFKGRIKGNAKGGATLTFGSYGLKALEPERVTSRQIEATRRAITRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPDVPV+AKPTEVRMGKGKG+ E W  +VKPGRI+FEIDGV+EE+AR A  L
Sbjct: 61  VGKVWIRIFPDVPVSAKPTEVRMGKGKGSPEFWAAKVKPGRIMFEIDGVTEEIAREALSL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
           GAAKL + TK ++R+ E
Sbjct: 121 GAAKLPIKTKIVKRLGE 137


>gi|325261501|ref|ZP_08128239.1| ribosomal protein L16 [Clostridium sp. D5]
 gi|324032955|gb|EGB94232.1| ribosomal protein L16 [Clostridium sp. D5]
          Length = 145

 Score =  196 bits (498), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 71/134 (52%), Positives = 90/134 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K  KQF+G +KG A  G+ I +G + + A E   I S++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKRRKQFRGNMKGKALRGNTISYGEYGIVAMEPCWIRSNQIEAARVAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVTAKP E RMGKGKG +E WV  VKPGR++FEI GV EE+AR A RL
Sbjct: 61  GGKVWIKIFPDKPVTAKPAETRMGKGKGALEYWVAVVKPGRVMFEIAGVPEEIAREALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL    K + R
Sbjct: 121 AMHKLPCKCKIVSR 134


>gi|163739445|ref|ZP_02146855.1| ribosomal protein L16 [Phaeobacter gallaeciensis BS107]
 gi|163740239|ref|ZP_02147633.1| 50S ribosomal protein L16 [Phaeobacter gallaeciensis 2.10]
 gi|161386097|gb|EDQ10472.1| 50S ribosomal protein L16 [Phaeobacter gallaeciensis 2.10]
 gi|161387198|gb|EDQ11557.1| ribosomal protein L16 [Phaeobacter gallaeciensis BS107]
          Length = 137

 Score =  196 bits (498), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 80/135 (59%), Positives = 103/135 (76%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGRI G+AKGGS + FG + LKA    R+ + +IEAARRA++R MKR
Sbjct: 1   MLQPKRTKFRKMHKGRISGLAKGGSDLNFGTYGLKATTPERVTARQIEAARRAMTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPD PVT+KP EVRMGKGKG+V+ W C+VKPGR++FEIDGV++++AR A RL
Sbjct: 61  QGRVWIRIFPDTPVTSKPVEVRMGKGKGSVDYWACKVKPGRVMFEIDGVNDDIAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL V T+ + R 
Sbjct: 121 AAMKLPVKTRVVVRE 135


>gi|118411198|ref|YP_874592.1| 50S ribosomal protein L16 [Thalassiosira pseudonana]
 gi|125987541|sp|A0T0Y0|RK16_THAPS RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|116739945|gb|ABK20815.1| 50S ribosomal protein L16 [Thalassiosira pseudonana]
          Length = 137

 Score =  196 bits (498), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 71/134 (52%), Positives = 87/134 (64%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY K  +GR++G A  G+ + FG + L+A E + I S +IEA RR I+R  KR
Sbjct: 1   MLSPKRTKYRKYHRGRMRGKATRGNEVSFGKYGLQALEPSWITSRQIEATRRTITRYTKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
              +WI +FPD  VTA+  E RMG GKG V+ WV  VKPG ILFEI  V EEVAR AF L
Sbjct: 61  GASLWIRIFPDKTVTARAAESRMGSGKGAVDYWVATVKPGTILFEISAVPEEVARAAFNL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + TKFI R
Sbjct: 121 AAYKLPIKTKFIIR 134


>gi|90417758|ref|ZP_01225670.1| ribosomal protein L16 [Aurantimonas manganoxydans SI85-9A1]
 gi|90337430|gb|EAS51081.1| ribosomal protein L16 [Aurantimonas manganoxydans SI85-9A1]
          Length = 137

 Score =  196 bits (498), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 90/137 (65%), Positives = 107/137 (78%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TKY K FKGRI G AKGG+ + FG F LKA E  R+ + +IEAARRAI+R MKR
Sbjct: 1   MLQPKRTKYRKAFKGRIHGTAKGGTGLNFGAFGLKAMEPERVTARQIEAARRAITRQMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPD+PVT+KPTEVRMGKGKG+V+ W  RV PGR++FEIDGV E  AR A RL
Sbjct: 61  QGRVWIRIFPDLPVTSKPTEVRMGKGKGSVDYWAARVHPGRVVFEIDGVDETTAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
           GAAKL + T+FIQR+ E
Sbjct: 121 GAAKLPIRTRFIQRIAE 137


>gi|328953151|ref|YP_004370485.1| 50S ribosomal protein L16 [Desulfobacca acetoxidans DSM 11109]
 gi|328453475|gb|AEB09304.1| 50S ribosomal protein L16 [Desulfobacca acetoxidans DSM 11109]
          Length = 137

 Score =  196 bits (498), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 66/135 (48%), Positives = 96/135 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  +Y KQ KGR++G A  G+++ FG F L+AQ+   + + +IEAAR A++R +KR
Sbjct: 1   MLSPKRVRYRKQQKGRMRGQATRGNKVAFGAFGLQAQDCGYLTAQQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P T KP E RMGKGKG+ E W+  ++PGRIL+E++G+ EEVAR A RL
Sbjct: 61  GGKIWIRIFPDKPFTRKPAETRMGKGKGSPEGWLAVIRPGRILYEMEGIPEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL + T+F+ R 
Sbjct: 121 ASHKLPIKTRFVIRE 135


>gi|330752355|emb|CBL87308.1| ribosomal protein L16 [uncultured Sphingobacteria bacterium]
          Length = 139

 Score =  195 bits (497), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 77/134 (57%), Positives = 96/134 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY K+ KGRIKG A  G RI FG+F LK+ E   I S +IEA+R A++R MKR
Sbjct: 1   MLSPKRIKYRKRQKGRIKGTAARGHRIDFGDFGLKSLEPGWITSRQIEASRIALNRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T KP EVRMGKGKG+ E WV  ++PG I+FE+DGV  EVA+ A RL
Sbjct: 61  EGKVWIRIFPDKPITKKPAEVRMGKGKGSPEYWVAVIRPGTIIFEVDGVPHEVAQEALRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL V+TKF+ R
Sbjct: 121 AAQKLPVLTKFVVR 134


>gi|226356890|ref|YP_002786630.1| 50S ribosomal protein L16 [Deinococcus deserti VCD115]
 gi|226318880|gb|ACO46876.1| putative 50S ribosomal protein L16 [Deinococcus deserti VCD115]
          Length = 142

 Score =  195 bits (497), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 73/137 (53%), Positives = 95/137 (69%)

Query: 1   MLRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMK 60
           M+  PK TKY KQ +GR+ G AKGG  + FG++ L A E   I S++IEA R  +SR  +
Sbjct: 1   MMLLPKRTKYRKQHRGRMTGDAKGGDYVAFGDYGLIALEPAWIRSNQIEACRIVMSRHFR 60

Query: 61  RAGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFR 120
           R G+++I +FPD PVT KP E RMGKGKG VE WV  VKPGR++FE+ GV+EE A+ AFR
Sbjct: 61  RGGKIYIRIFPDKPVTKKPAETRMGKGKGAVEFWVSVVKPGRVMFEVAGVTEEQAKEAFR 120

Query: 121 LGAAKLSVVTKFIQRVV 137
           L   KL + TK ++R V
Sbjct: 121 LAGHKLPIQTKMVKREV 137


>gi|148260932|ref|YP_001235059.1| 50S ribosomal protein L16 [Acidiphilium cryptum JF-5]
 gi|326404330|ref|YP_004284412.1| 50S ribosomal protein L16 [Acidiphilium multivorum AIU301]
 gi|166234538|sp|A5FZV8|RL16_ACICJ RecName: Full=50S ribosomal protein L16
 gi|146402613|gb|ABQ31140.1| LSU ribosomal protein L16P [Acidiphilium cryptum JF-5]
 gi|325051192|dbj|BAJ81530.1| 50S ribosomal protein L16 [Acidiphilium multivorum AIU301]
          Length = 138

 Score =  195 bits (497), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 83/137 (60%), Positives = 103/137 (75%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ K  KGRI G AKG +++ FG F LKA E  RI + +IE+ARRAI+R MKR
Sbjct: 1   MLSPKRTKFRKAHKGRIHGTAKGNTQLNFGQFGLKALEPERITARQIESARRAITRQMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AGRVWI +FPD+PV+ KP EVRMG GKG  E WV RV+PGRI+FEIDGV+E +AR A +L
Sbjct: 61  AGRVWIRIFPDLPVSTKPAEVRMGSGKGAPEYWVARVQPGRIMFEIDGVAEGIAREALKL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
           GAAKL + TK + R+ E
Sbjct: 121 GAAKLPIKTKIVTRIGE 137


>gi|194335452|ref|YP_002017246.1| ribosomal protein L16 [Pelodictyon phaeoclathratiforme BU-1]
 gi|226712331|sp|B4SBV4|RL16_PELPB RecName: Full=50S ribosomal protein L16
 gi|194307929|gb|ACF42629.1| ribosomal protein L16 [Pelodictyon phaeoclathratiforme BU-1]
          Length = 139

 Score =  195 bits (497), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 75/134 (55%), Positives = 93/134 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY K  +GR+KG +  G+ + FG+F LKA E   I S +IEAAR A++R MKR
Sbjct: 1   MLMPKRVKYRKTQRGRMKGNSGRGTDVSFGSFGLKAIEPAWITSRQIEAARVAMTRFMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVT KP E RMG GKG+ E WV  VKPGRI+FE DGV +EVA  AFRL
Sbjct: 61  DGKIWIRIFPDKPVTKKPAETRMGSGKGSPEFWVAVVKPGRIMFEADGVPKEVATEAFRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + T+FI R
Sbjct: 121 AAKKLPIKTRFIVR 134


>gi|227538711|ref|ZP_03968760.1| ribosomal protein L16 [Sphingobacterium spiritivorum ATCC 33300]
 gi|300770244|ref|ZP_07080123.1| 50S ribosomal protein L16 [Sphingobacterium spiritivorum ATCC
           33861]
 gi|227241630|gb|EEI91645.1| ribosomal protein L16 [Sphingobacterium spiritivorum ATCC 33300]
 gi|300762720|gb|EFK59537.1| 50S ribosomal protein L16 [Sphingobacterium spiritivorum ATCC
           33861]
          Length = 140

 Score =  195 bits (497), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 77/134 (57%), Positives = 95/134 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGR+KG A  G+ + FG+F +K+ E   I S +IEAAR A++R MKR
Sbjct: 1   MLQPKRTKFRKMQKGRMKGNASRGAELAFGSFGIKSLEPAWITSRQIEAARIAVTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT KP EVRMGKGKG  E WV  V+PGR+LFE +GV  EVA+ A RL
Sbjct: 61  EGQVWIRIFPDKPVTKKPAEVRMGKGKGAPEYWVAVVRPGRMLFEAEGVPLEVAKEALRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL V TKF+ R
Sbjct: 121 AAQKLPVQTKFVIR 134


>gi|119383518|ref|YP_914574.1| 50S ribosomal protein L16 [Paracoccus denitrificans PD1222]
 gi|166199698|sp|A1B034|RL16_PARDP RecName: Full=50S ribosomal protein L16
 gi|119373285|gb|ABL68878.1| LSU ribosomal protein L16P [Paracoccus denitrificans PD1222]
          Length = 137

 Score =  195 bits (497), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 85/135 (62%), Positives = 106/135 (78%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQ KGRI G AKGG  + FG++ALKA E  R+ + +IEAARRAI+R MKR
Sbjct: 1   MLQPKRTKFRKQHKGRIHGEAKGGFNLNFGSYALKAIEPERVTARQIEAARRAITRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPDVPV++KPTEVRMGKGKG+V+ W  RV PGRI+FEIDGV++ +AR A RL
Sbjct: 61  QGRVWIRIFPDVPVSSKPTEVRMGKGKGSVDYWAARVHPGRIMFEIDGVNDTIAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
           GA KL V+T+ + R 
Sbjct: 121 GAQKLPVLTRIVARE 135


>gi|228470718|ref|ZP_04055569.1| ribosomal protein L16 [Porphyromonas uenonis 60-3]
 gi|228307575|gb|EEK16571.1| ribosomal protein L16 [Porphyromonas uenonis 60-3]
          Length = 144

 Score =  195 bits (497), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 74/134 (55%), Positives = 99/134 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ +Q KGR+KG A+ G+++ FG+F +K+ E+  I   +IEAAR A++R M+R
Sbjct: 1   MLQPKKTKFRRQQKGRMKGNAQRGNQLAFGSFGIKSLESKWITGRQIEAARIAVTRYMQR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VW  +FPD P+TAKP EVRMGKGKGN E +V  V PGR+LFE++GV  EVA+ A RL
Sbjct: 61  QGQVWCRIFPDKPITAKPAEVRMGKGKGNPEGFVAPVTPGRMLFEVEGVPYEVAKEALRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL V TKF+ R
Sbjct: 121 AAQKLPVTTKFVVR 134


>gi|126697080|ref|YP_001091966.1| 50S ribosomal protein L16 [Prochlorococcus marinus str. MIT 9301]
 gi|166199701|sp|A3PF40|RL16_PROM0 RecName: Full=50S ribosomal protein L16
 gi|126544123|gb|ABO18365.1| 50S ribosomal protein L16 [Prochlorococcus marinus str. MIT 9301]
          Length = 160

 Score =  195 bits (497), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 73/135 (54%), Positives = 96/135 (71%), Gaps = 2/135 (1%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ KQ +GR++GVA  G+ I FG FAL+AQ+   + + +IEA+RRA++R +KR
Sbjct: 1   MLSPKRTKFRKQHRGRMRGVASKGNTIAFGQFALQAQDCGWVTARQIEASRRAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDG--VSEEVARRAF 119
            G++WI +FPD PVT +P E RMG GKGN E WV  VKPGRILFE+ G  ++EE A+ A 
Sbjct: 61  GGQIWIRIFPDKPVTMRPAETRMGSGKGNPEFWVAVVKPGRILFEMGGEDITEETAKEAM 120

Query: 120 RLGAAKLSVVTKFIQ 134
           RL   KL V TKFI 
Sbjct: 121 RLAQYKLPVKTKFIS 135


>gi|154505162|ref|ZP_02041900.1| hypothetical protein RUMGNA_02675 [Ruminococcus gnavus ATCC 29149]
 gi|153794641|gb|EDN77061.1| hypothetical protein RUMGNA_02675 [Ruminococcus gnavus ATCC 29149]
          Length = 145

 Score =  195 bits (497), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 69/134 (51%), Positives = 87/134 (64%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K  KQF+G +KG A  G+ I +G + + A E   I S++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKRRKQFRGTMKGKALRGNTISYGEYGIVATEPCWIRSNQIEAARVAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVTAKP E RMG GKG +E W   VKPGR++FEI GV EE AR A RL
Sbjct: 61  GGKVWIKIFPDKPVTAKPAETRMGSGKGTLEYWAAVVKPGRVMFEIAGVPEETAREALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL    K + R
Sbjct: 121 AMHKLPCKCKIVSR 134


>gi|223931039|ref|YP_002586899.1| ribosomal protein L16 [Syntrichia ruralis]
 gi|219562253|gb|ACL27584.1| ribosomal protein L16 [Syntrichia ruralis]
          Length = 146

 Score =  195 bits (497), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 72/136 (52%), Positives = 95/136 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ KQ +GR+KG++  G+ ICFG FAL+A E   I S +IEA RRAI+R  +R
Sbjct: 1   MLSPKRTKFRKQHRGRMKGISTRGNSICFGKFALQALEPAWITSRQIEAGRRAITRYARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T +P E RMG GKG+ E WV  VKPGRIL+EI GV E VAR A R+
Sbjct: 61  GGKLWIRIFPDKPITMRPAETRMGSGKGSPEYWVSVVKPGRILYEISGVPETVARAAMRI 120

Query: 122 GAAKLSVVTKFIQRVV 137
            A K+ + T+FI   +
Sbjct: 121 AAYKMPIRTQFITSTI 136


>gi|148238763|ref|YP_001224150.1| 50S ribosomal protein L16 [Synechococcus sp. WH 7803]
 gi|166216119|sp|A5GIT8|RL16_SYNPW RecName: Full=50S ribosomal protein L16
 gi|147847302|emb|CAK22853.1| 50S ribosomal protein L16 [Synechococcus sp. WH 7803]
          Length = 157

 Score =  195 bits (497), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 73/135 (54%), Positives = 94/135 (69%), Gaps = 2/135 (1%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQ +GR++GVA  G+ I FG FAL+AQE   I S +IEA+RRA++R +KR
Sbjct: 1   MLSPKRVKFRKQQRGRMRGVATRGNTIAFGQFALQAQECGWITSRQIEASRRAMTRYVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDG--VSEEVARRAF 119
            G++WI +FPD PVT +  E RMG GKGN E WV  +KPGRILFE+ G  ++ E+AR A 
Sbjct: 61  GGKIWIRIFPDKPVTMRAAETRMGSGKGNPEFWVAVIKPGRILFEMGGDEITPEIAREAM 120

Query: 120 RLGAAKLSVVTKFIQ 134
           RL   KL V TKFI 
Sbjct: 121 RLAQYKLPVKTKFIS 135


>gi|163938125|ref|YP_001643009.1| 50S ribosomal protein L16 [Bacillus weihenstephanensis KBAB4]
 gi|229053963|ref|ZP_04195397.1| 50S ribosomal protein L16 [Bacillus cereus AH603]
 gi|226710679|sp|A9VP84|RL16_BACWK RecName: Full=50S ribosomal protein L16
 gi|163860322|gb|ABY41381.1| ribosomal protein L16 [Bacillus weihenstephanensis KBAB4]
 gi|228721381|gb|EEL72902.1| 50S ribosomal protein L16 [Bacillus cereus AH603]
          Length = 144

 Score =  195 bits (497), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 77/135 (57%), Positives = 97/135 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY ++ +G+++G AKGG+ I FG F L+A  A+ I + +IEAARRA++R MKR
Sbjct: 1   MLMPKRVKYRREHRGKMRGRAKGGTEIAFGEFGLQALAASWITNRQIEAARRAMTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP  P TAKP EVRMG GKG  E WV  VKPG+I+FEI GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPSKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKIMFEIAGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL V  KF++R 
Sbjct: 121 AAHKLPVKCKFVKRE 135


>gi|160941062|ref|ZP_02088400.1| hypothetical protein CLOBOL_05955 [Clostridium bolteae ATCC
           BAA-613]
 gi|158436011|gb|EDP13778.1| hypothetical protein CLOBOL_05955 [Clostridium bolteae ATCC
           BAA-613]
          Length = 145

 Score =  195 bits (497), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 69/134 (51%), Positives = 86/134 (64%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K  KQF+G + G A  G+ I  G + L + E   I S++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKRRKQFRGSMAGKALRGNTISNGEYGLVSTEPCWIKSNQIEAARVAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVTAKP E RMG GKG +E WV  VKPGR+LFEI GV EE AR A RL
Sbjct: 61  GGKVWIKIFPDKPVTAKPAETRMGSGKGALEYWVAVVKPGRVLFEIAGVPEETAREALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL    K + +
Sbjct: 121 AMHKLPCKCKIVSK 134


>gi|260436431|ref|ZP_05790401.1| ribosomal protein L16 [Synechococcus sp. WH 8109]
 gi|260414305|gb|EEX07601.1| ribosomal protein L16 [Synechococcus sp. WH 8109]
          Length = 158

 Score =  195 bits (497), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 73/135 (54%), Positives = 95/135 (70%), Gaps = 2/135 (1%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQ +GR++GVA  G+ I FG FAL+AQE   I S +IEA+RRA++R +KR
Sbjct: 1   MLSPKRVKFRKQQRGRMRGVATRGNTIAFGQFALQAQECGWITSRQIEASRRAMTRYVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDG--VSEEVARRAF 119
            G++WI +FPD PVT +  E RMG GKGN E WV  +KPGRILFE+ G  ++ E+A+ A 
Sbjct: 61  GGKIWIRIFPDKPVTMRAAETRMGSGKGNPEFWVAVIKPGRILFEMGGDEITPEIAKEAM 120

Query: 120 RLGAAKLSVVTKFIQ 134
           RL   KL V TKFIQ
Sbjct: 121 RLAQYKLPVKTKFIQ 135


>gi|313887075|ref|ZP_07820774.1| ribosomal protein L16 [Porphyromonas asaccharolytica PR426713P-I]
 gi|312923486|gb|EFR34296.1| ribosomal protein L16 [Porphyromonas asaccharolytica PR426713P-I]
 gi|332176626|gb|AEE12316.1| 50S ribosomal protein L16 [Porphyromonas asaccharolytica DSM 20707]
          Length = 144

 Score =  195 bits (496), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 74/134 (55%), Positives = 99/134 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ +Q KGR+KG A+ G+++ FG+F +K+ E+  I   +IEAAR A++R M+R
Sbjct: 1   MLQPKKTKFRRQQKGRMKGNAQRGNQLAFGSFGIKSLESKWITGRQIEAARIAVTRYMQR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VW  +FPD P+TAKP EVRMGKGKGN E +V  V PGR+LFE++GV  EVA+ A RL
Sbjct: 61  QGQVWCRIFPDKPITAKPAEVRMGKGKGNPEGFVAPVTPGRMLFEVEGVPYEVAKEALRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL V TKF+ R
Sbjct: 121 AAQKLPVTTKFVVR 134


>gi|331004128|ref|ZP_08327608.1| 50S ribosomal protein L16 [Lachnospiraceae oral taxon 107 str.
           F0167]
 gi|330411538|gb|EGG90948.1| 50S ribosomal protein L16 [Lachnospiraceae oral taxon 107 str.
           F0167]
          Length = 145

 Score =  195 bits (496), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 69/134 (51%), Positives = 89/134 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K  KQF+G + G A  G++I +G + L + +   I S++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKRRKQFRGSMAGKALRGNKITYGEYGLVSLDPCWIKSNQIEAARVAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVTAKP E RMG GKG+ E WV  VKPGR+LFEI GV EEVAR A RL
Sbjct: 61  GGKVWIKIFPDKPVTAKPAETRMGSGKGSTEYWVAVVKPGRVLFEIAGVPEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL    K + +
Sbjct: 121 AMHKLPCRCKIVSK 134


>gi|319893193|ref|YP_004150068.1| LSU ribosomal protein L16p/L10e [Staphylococcus pseudintermedius
           HKU10-03]
 gi|317162889|gb|ADV06432.1| LSU ribosomal protein L16p/L10e [Staphylococcus pseudintermedius
           HKU10-03]
 gi|323463759|gb|ADX75912.1| ribosomal protein L16 [Staphylococcus pseudintermedius ED99]
          Length = 144

 Score =  195 bits (496), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 72/135 (53%), Positives = 93/135 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +Q +   KG +KGG+ + FG + ++A   + I S +IE+AR A++R MKR
Sbjct: 1   MLLPKRVKYRRQHRPDTKGRSKGGNFVTFGEYGIQATTTSWITSRQIESARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP  P T KP EVRMG GKG VE W+  VKPGRILFE+ GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPHTPYTQKPLEVRMGAGKGAVEGWIAVVKPGRILFEVAGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL V TKF++R 
Sbjct: 121 ASHKLPVKTKFVKRE 135


>gi|254475303|ref|ZP_05088689.1| ribosomal protein L16 [Ruegeria sp. R11]
 gi|214029546|gb|EEB70381.1| ribosomal protein L16 [Ruegeria sp. R11]
          Length = 137

 Score =  195 bits (496), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 80/135 (59%), Positives = 102/135 (75%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGRI G AKGGS + FG + LKA    R+ + +IEAARRA++R MKR
Sbjct: 1   MLQPKRTKFRKMHKGRISGEAKGGSDLNFGTYGLKATTPERVTARQIEAARRAMTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPD PVT+KP EVRMGKGKG+V+ W C+VKPGR++FEIDGV++++AR A RL
Sbjct: 61  QGRVWIRIFPDTPVTSKPVEVRMGKGKGSVDYWACKVKPGRVMFEIDGVNDDIAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL V T+ + R 
Sbjct: 121 AAMKLPVKTRVVVRE 135


>gi|85703996|ref|ZP_01035099.1| 50S ribosomal protein L16 [Roseovarius sp. 217]
 gi|85671316|gb|EAQ26174.1| 50S ribosomal protein L16 [Roseovarius sp. 217]
          Length = 137

 Score =  195 bits (496), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 85/135 (62%), Positives = 104/135 (77%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGRIKG AKGGS + FG F LKA +  RI + +IEAARRA++R MKR
Sbjct: 1   MLQPKRTKFRKMHKGRIKGEAKGGSDLNFGTFGLKATQPERITARQIEAARRAMTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPD PV++KPTEVRMGKGKG+V+ W CRVKPGR++FEIDGVSEE+A  A RL
Sbjct: 61  QGRVWIRIFPDTPVSSKPTEVRMGKGKGSVDYWACRVKPGRVMFEIDGVSEEIAFEALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL + T+ + R 
Sbjct: 121 AAMKLPIKTRVVVRE 135


>gi|169335636|ref|ZP_02862829.1| hypothetical protein ANASTE_02056 [Anaerofustis stercorihominis DSM
           17244]
 gi|169258374|gb|EDS72340.1| hypothetical protein ANASTE_02056 [Anaerofustis stercorihominis DSM
           17244]
          Length = 143

 Score =  195 bits (496), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 67/132 (50%), Positives = 90/132 (68%)

Query: 4   QPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKRAG 63
            PK  K+ K  +GR+ G A  G+++ +G++ ++A E   I S++IEAAR A++R +KR G
Sbjct: 1   MPKRVKHRKVHRGRMTGKATRGNKVTYGDYGIQALEPAWITSNQIEAARIAMTRYIKRGG 60

Query: 64  RVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRLGA 123
           +VWI +FPD  VT KP E RMGKGKG  E WV  VKPGR++FE+ GV EE AR A RL  
Sbjct: 61  QVWIKIFPDKSVTKKPAETRMGKGKGAPEYWVAVVKPGRVMFELAGVDEETAREAMRLAQ 120

Query: 124 AKLSVVTKFIQR 135
            KL + TKFI +
Sbjct: 121 HKLPIKTKFITK 132


>gi|167759855|ref|ZP_02431982.1| hypothetical protein CLOSCI_02218 [Clostridium scindens ATCC 35704]
 gi|167662474|gb|EDS06604.1| hypothetical protein CLOSCI_02218 [Clostridium scindens ATCC 35704]
          Length = 145

 Score =  195 bits (496), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 70/134 (52%), Positives = 89/134 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K  KQF+G +KG A  G++I  G + + A E   I S++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKRRKQFRGSMKGKALRGNKITNGEYGIVAMEPCWIRSNQIEAARVAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT KP E RMG GKG +E WV  VKPGR++FEI GVSEEVA+ A RL
Sbjct: 61  GGKVWIKIFPDKPVTTKPAETRMGSGKGTLEYWVAVVKPGRVMFEIAGVSEEVAKEALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL    K + R
Sbjct: 121 ATHKLPCKCKIVSR 134


>gi|78211921|ref|YP_380700.1| 50S ribosomal protein L16 [Synechococcus sp. CC9605]
 gi|115504861|sp|Q3AMN7|RL16_SYNSC RecName: Full=50S ribosomal protein L16
 gi|78196380|gb|ABB34145.1| ribosomal protein L16 [Synechococcus sp. CC9605]
          Length = 158

 Score =  195 bits (496), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 73/135 (54%), Positives = 95/135 (70%), Gaps = 2/135 (1%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQ +GR++GVA  G+ I FG FAL+AQE   I S +IEA+RRA++R +KR
Sbjct: 1   MLSPKRVKFRKQQRGRMRGVATRGNTIAFGQFALQAQECGWITSRQIEASRRAMTRYVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDG--VSEEVARRAF 119
            G++WI +FPD PVT +  E RMG GKGN E WV  +KPGRILFE+ G  ++ E+A+ A 
Sbjct: 61  GGKIWIRIFPDKPVTMRAAETRMGSGKGNPEFWVAVIKPGRILFEMGGDEITPEIAKEAM 120

Query: 120 RLGAAKLSVVTKFIQ 134
           RL   KL V TKFIQ
Sbjct: 121 RLAQYKLPVKTKFIQ 135


>gi|332187787|ref|ZP_08389521.1| ribosomal protein L16 [Sphingomonas sp. S17]
 gi|332012137|gb|EGI54208.1| ribosomal protein L16 [Sphingomonas sp. S17]
          Length = 144

 Score =  195 bits (496), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 79/137 (57%), Positives = 100/137 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K FKGRI G AKGG+ + FG++ LKA E  RI + +IEAARRAI+R +KR
Sbjct: 1   MLQPKRTKFRKAFKGRIHGDAKGGTSLNFGSYGLKAMEPERITARQIEAARRAITRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI +FPDVPV++KP EVRMG GKG+ E W  RVKPGRILFE+DGV   +A  AF  
Sbjct: 61  QGRLWIRIFPDVPVSSKPAEVRMGSGKGSPEFWAARVKPGRILFELDGVDGPLAAEAFER 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            A KL + TK + R+ +
Sbjct: 121 AAMKLPIKTKVVARLGD 137


>gi|116072557|ref|ZP_01469823.1| 50S ribosomal protein L16 [Synechococcus sp. BL107]
 gi|116064444|gb|EAU70204.1| 50S ribosomal protein L16 [Synechococcus sp. BL107]
          Length = 158

 Score =  195 bits (496), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 72/134 (53%), Positives = 94/134 (70%), Gaps = 2/134 (1%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQ +GR++GVA  G+ I FG FAL+AQE   I S +IEA+RRA++R +KR
Sbjct: 1   MLSPKRVKFRKQQRGRMRGVATRGNTIAFGEFALQAQECGWITSRQIEASRRAMTRYVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDG--VSEEVARRAF 119
            G++WI +FPD PVT +  E RMG GKGN E WV  +KPGRILFE+ G  ++ E+A+ A 
Sbjct: 61  GGKIWIRIFPDKPVTMRAAETRMGSGKGNPEFWVAVIKPGRILFEMGGEEITPEIAKEAM 120

Query: 120 RLGAAKLSVVTKFI 133
           RL   KL V TKFI
Sbjct: 121 RLAQYKLPVKTKFI 134


>gi|77918322|ref|YP_356137.1| 50S ribosomal protein L16 [Pelobacter carbinolicus DSM 2380]
 gi|85541812|sp|Q3A6P0|RL16_PELCD RecName: Full=50S ribosomal protein L16
 gi|77544405|gb|ABA87967.1| LSU ribosomal protein L16P [Pelobacter carbinolicus DSM 2380]
          Length = 141

 Score =  195 bits (496), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 69/135 (51%), Positives = 94/135 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQFKGR+KGVA  GS + FG++ LKA E   + S +IE+ARRA++R +KR
Sbjct: 1   MLMPKKVKHRKQFKGRMKGVAYRGSDLNFGDYGLKAVECGWLSSRQIESARRAMTRHVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD  +T KP E RMGKGKG+ + WV  +KPG +L+E+ GV +EVA  A RL
Sbjct: 61  GGKIWIRIFPDKSLTKKPAETRMGKGKGSPDSWVAVIKPGMMLYEMQGVDKEVACEALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL + TK + R 
Sbjct: 121 AAHKLPMKTKIVVRE 135


>gi|113953227|ref|YP_729660.1| 50S ribosomal protein L16 [Synechococcus sp. CC9311]
 gi|123327981|sp|Q0ID12|RL16_SYNS3 RecName: Full=50S ribosomal protein L16
 gi|113880578|gb|ABI45536.1| ribosomal protein L16 [Synechococcus sp. CC9311]
          Length = 155

 Score =  195 bits (496), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 72/134 (53%), Positives = 95/134 (70%), Gaps = 2/134 (1%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQ +GR++GVA  G+ I FG FAL+AQE   I S +IEA+RRA++R +KR
Sbjct: 1   MLSPKRVKFRKQQRGRMRGVATRGNTIAFGQFALQAQECGWITSRQIEASRRAMTRYVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDG--VSEEVARRAF 119
            G++WI +FPD PVT +P E RMG GKGN E WV  +KPGRILFE+ G  ++ E+A+ A 
Sbjct: 61  GGKIWIRIFPDKPVTMRPAETRMGSGKGNPEFWVAVIKPGRILFEMGGEEITPEIAKEAM 120

Query: 120 RLGAAKLSVVTKFI 133
           RL   KL + TKFI
Sbjct: 121 RLAQYKLPLKTKFI 134


>gi|86135770|ref|ZP_01054349.1| 50S ribosomal protein L16 [Roseobacter sp. MED193]
 gi|126739683|ref|ZP_01755375.1| 50S ribosomal protein L16 [Roseobacter sp. SK209-2-6]
 gi|85826644|gb|EAQ46840.1| 50S ribosomal protein L16 [Roseobacter sp. MED193]
 gi|126719329|gb|EBA16039.1| 50S ribosomal protein L16 [Roseobacter sp. SK209-2-6]
          Length = 137

 Score =  195 bits (496), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 81/135 (60%), Positives = 103/135 (76%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGRIKG AKGGS + FG + LKA    R+ + +IEAARRA++R MKR
Sbjct: 1   MLQPKRTKFRKMHKGRIKGEAKGGSDLNFGTYGLKATTPERVTARQIEAARRAMTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPD PVT+KP EVRMGKGKG+V+ W C+VKPGR++FEIDGV++++AR A RL
Sbjct: 61  QGRVWIRIFPDTPVTSKPVEVRMGKGKGSVDYWACKVKPGRVMFEIDGVNDDIAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL V T+ + R 
Sbjct: 121 AAMKLPVKTRVVVRE 135


>gi|254418402|ref|ZP_05032126.1| ribosomal protein L16 [Brevundimonas sp. BAL3]
 gi|196184579|gb|EDX79555.1| ribosomal protein L16 [Brevundimonas sp. BAL3]
          Length = 146

 Score =  194 bits (495), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 89/135 (65%), Positives = 102/135 (75%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TKY K FKGRI G AKGG  + FG++ LK  E  RI + +IEAARRAI+R MKR
Sbjct: 1   MLQPKKTKYRKAFKGRIHGSAKGGFSLNFGSYGLKTLEPERITARQIEAARRAITRQMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI VFPD+PVT KP EVRMGKGKG V+ W  R  PGRILFEIDGV++EVAR A RL
Sbjct: 61  QGRVWIRVFPDLPVTGKPAEVRMGKGKGAVDHWAARCHPGRILFEIDGVTDEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
           GAAKL V TK + R+
Sbjct: 121 GAAKLPVRTKVVTRI 135


>gi|123966966|ref|YP_001012047.1| 50S ribosomal protein L16 [Prochlorococcus marinus str. MIT 9515]
 gi|166199704|sp|A2BYS9|RL16_PROM5 RecName: Full=50S ribosomal protein L16
 gi|123201332|gb|ABM72940.1| 50S ribosomal protein L16 [Prochlorococcus marinus str. MIT 9515]
          Length = 160

 Score =  194 bits (495), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 73/135 (54%), Positives = 97/135 (71%), Gaps = 2/135 (1%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ KQ +GR+KG+A  G+ I FG FAL+AQ+   + + +IEA+RRA++R +KR
Sbjct: 1   MLSPKRTKFRKQHRGRMKGIASKGNTIAFGQFALQAQDCGWVTARQIEASRRAMTRYVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDG--VSEEVARRAF 119
            G++WI +FPD PVT +P E RMG GKGN E WV  VKPGRILFE+ G  ++EE+A+ A 
Sbjct: 61  GGKIWIRIFPDKPVTMRPAETRMGSGKGNPEFWVAVVKPGRILFEMGGEEITEEIAKEAM 120

Query: 120 RLGAAKLSVVTKFIQ 134
           RL   KL V TKFI 
Sbjct: 121 RLAQYKLPVKTKFIS 135


>gi|254439310|ref|ZP_05052804.1| ribosomal protein L16 [Octadecabacter antarcticus 307]
 gi|198254756|gb|EDY79070.1| ribosomal protein L16 [Octadecabacter antarcticus 307]
          Length = 137

 Score =  194 bits (495), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 87/135 (64%), Positives = 107/135 (79%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQ KGRIKG AKGGS + FG + LKA +  R+ + +IEAARRA++R MKR
Sbjct: 1   MLQPKRTKFRKQHKGRIKGEAKGGSDLTFGTYGLKATQPERVTARQIEAARRAMTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPDVPVT+KPTEVRMGKGKG+V+ W C+VKPGRI+FEIDGV+E++AR A RL
Sbjct: 61  QGRVWIRIFPDVPVTSKPTEVRMGKGKGSVDYWACKVKPGRIMFEIDGVNEDIAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL V T+ I R 
Sbjct: 121 AAMKLPVKTRTIVRE 135


>gi|84515641|ref|ZP_01003002.1| 50S ribosomal protein L16 [Loktanella vestfoldensis SKA53]
 gi|84510083|gb|EAQ06539.1| 50S ribosomal protein L16 [Loktanella vestfoldensis SKA53]
          Length = 137

 Score =  194 bits (495), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 83/135 (61%), Positives = 105/135 (77%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGRI+G AKGGS + FG + LKA E  RI + +IEAARRA++R MKR
Sbjct: 1   MLQPKRTKHRKLHKGRIRGEAKGGSDLNFGTYGLKATEPERITARQIEAARRAMTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPD+PVT+KP EVRMGKGKG+++ W C+VKPGR++FEIDGVSEE+AR A RL
Sbjct: 61  QGRVWIRIFPDLPVTSKPIEVRMGKGKGSIDFWACKVKPGRVMFEIDGVSEEIAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL + T+ + R 
Sbjct: 121 AAMKLPIKTRTVVRE 135


>gi|58038848|ref|YP_190812.1| 50S ribosomal protein L16 [Gluconobacter oxydans 621H]
 gi|81557184|sp|Q5FTZ0|RL16_GLUOX RecName: Full=50S ribosomal protein L16
 gi|58001262|gb|AAW60156.1| LSU ribosomal protein L16P [Gluconobacter oxydans 621H]
          Length = 138

 Score =  194 bits (495), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 85/137 (62%), Positives = 103/137 (75%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ K  KGRI G+AK G+++ FG F LKA E  RI + +IEA+RRAI+R MKR
Sbjct: 1   MLSPKRTKFRKAHKGRIHGLAKSGTQLNFGAFGLKALEPERITARQIEASRRAITRAMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AGRVWI +FPD PV+ KP EVRMG GKGN E W  RVKPGRILFEI+GV  EVA+ A  L
Sbjct: 61  AGRVWIRIFPDTPVSTKPAEVRMGSGKGNPEYWAARVKPGRILFEIEGVPPEVAKLALSL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
           GAAKL + TKF+QR+ +
Sbjct: 121 GAAKLPIKTKFVQRIGD 137


>gi|56551419|ref|YP_162258.1| 50S ribosomal protein L16 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241761067|ref|ZP_04759156.1| ribosomal protein L16 [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|260752967|ref|YP_003225860.1| 50S ribosomal protein L16 [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
 gi|81598313|sp|Q5NQ58|RL16_ZYMMO RecName: Full=50S ribosomal protein L16
 gi|56542993|gb|AAV89147.1| ribosomal protein L16 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241374686|gb|EER64147.1| ribosomal protein L16 [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|258552330|gb|ACV75276.1| ribosomal protein L16 [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
          Length = 143

 Score =  194 bits (495), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 79/137 (57%), Positives = 100/137 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGRI G A GG+ + FG + LKA E +RI + +IEAARRAI+R ++R
Sbjct: 1   MLQPKRTKFRKAHKGRIHGNAPGGATLNFGAYGLKAMEPDRITARQIEAARRAITRHIRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI +FPDVPV++KP EVRMG GKG+ E WV RVKPGRILFE+DGV   +AR AF  
Sbjct: 61  QGRLWIRIFPDVPVSSKPAEVRMGSGKGSPEFWVARVKPGRILFELDGVPGPIARVAFER 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            AAKL +  K + R+ E
Sbjct: 121 AAAKLPIKVKVVARLGE 137


>gi|320533195|ref|ZP_08033911.1| ribosomal protein L16 [Actinomyces sp. oral taxon 171 str. F0337]
 gi|325068038|ref|ZP_08126711.1| 50S ribosomal protein L16 [Actinomyces oris K20]
 gi|326773970|ref|ZP_08233252.1| ribosomal protein L16 [Actinomyces viscosus C505]
 gi|329945735|ref|ZP_08293422.1| ribosomal protein L16 [Actinomyces sp. oral taxon 170 str. F0386]
 gi|320134579|gb|EFW26811.1| ribosomal protein L16 [Actinomyces sp. oral taxon 171 str. F0337]
 gi|326636109|gb|EGE37013.1| ribosomal protein L16 [Actinomyces viscosus C505]
 gi|328528183|gb|EGF55161.1| ribosomal protein L16 [Actinomyces sp. oral taxon 170 str. F0386]
          Length = 139

 Score =  194 bits (495), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 65/135 (48%), Positives = 90/135 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+ TK+ KQ +    G++KGG++I FG + ++A E   I + +IEAAR A++R +KR
Sbjct: 1   MLIPRRTKFRKQHRPHRTGLSKGGNQIAFGEYGIQALEPAYITNRQIEAARIAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T KP E RMG GKG  E W+  VKPGRILFE+ GV E +AR A R 
Sbjct: 61  GGKVWINIFPDRPLTKKPAETRMGSGKGAPEWWIANVKPGRILFELGGVDEALAREAMRR 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL + T+F+ R 
Sbjct: 121 AQHKLPMKTRFVTRE 135


>gi|291521891|emb|CBK80184.1| LSU ribosomal protein L16P [Coprococcus catus GD/7]
          Length = 145

 Score =  194 bits (495), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 69/134 (51%), Positives = 90/134 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K  KQF+G + G A+ G++I +G + + A E   I S++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKRRKQFRGSMAGKAQRGNKISYGEYGIVAMEPAWIKSNQIEAARVAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT KP E RMG GKG +E WV  VKPGR++FEI GV EEVA+ A RL
Sbjct: 61  GGKVWIKIFPDKPVTTKPAETRMGSGKGTLEYWVAVVKPGRVMFEIAGVPEEVAKEALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL V  K + R
Sbjct: 121 ATHKLPVKCKIVSR 134


>gi|160932194|ref|ZP_02079585.1| hypothetical protein CLOLEP_01029 [Clostridium leptum DSM 753]
 gi|156868796|gb|EDO62168.1| hypothetical protein CLOLEP_01029 [Clostridium leptum DSM 753]
          Length = 141

 Score =  194 bits (495), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 67/135 (49%), Positives = 92/135 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +  +GR+ G A  G+++ +G F L+A E   I S++IEAAR A++R  KR
Sbjct: 1   MLLPKRVKYRRVHRGRLTGKAMRGNKVTYGQFGLQALEPAWITSNQIEAARVAMTRYTKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T KP E RMG GKG+ E WV  VKPGR++FEI G++EE AR A RL
Sbjct: 61  FGQVWIKIFPDKPITEKPAETRMGSGKGSPEYWVAVVKPGRVMFEIGGIAEETAREAMRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL +  KF+++ 
Sbjct: 121 AANKLPIKCKFVKKE 135


>gi|16125504|ref|NP_420068.1| 50S ribosomal protein L16 [Caulobacter crescentus CB15]
 gi|221234250|ref|YP_002516686.1| 50S ribosomal protein L16 [Caulobacter crescentus NA1000]
 gi|81621170|sp|Q9A8U6|RL16_CAUCR RecName: Full=50S ribosomal protein L16
 gi|254799188|sp|B8H4E1|RL16_CAUCN RecName: Full=50S ribosomal protein L16
 gi|13422586|gb|AAK23236.1| ribosomal protein L16 [Caulobacter crescentus CB15]
 gi|220963422|gb|ACL94778.1| LSU ribosomal protein L16P [Caulobacter crescentus NA1000]
          Length = 143

 Score =  194 bits (495), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 84/135 (62%), Positives = 104/135 (77%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ KQFKGRI G +KGG+ + FG++ LKA E  RI + +IEAARRAI+R MKR
Sbjct: 1   MLSPKKTKFRKQFKGRIHGTSKGGTLLNFGSYGLKAVEPERITARQIEAARRAITRQMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPDVPVT KP EVRMGKGKG V+ W  RV PGRI+FEIDGV +++AR A RL
Sbjct: 61  QGRVWIRIFPDVPVTGKPAEVRMGKGKGAVDYWAARVAPGRIMFEIDGVPDDIAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
           GAAKL + T+ + R+
Sbjct: 121 GAAKLPIRTRVVTRI 135


>gi|157414155|ref|YP_001485021.1| 50S ribosomal protein L16 [Prochlorococcus marinus str. MIT 9215]
 gi|166983716|sp|A8G754|RL16_PROM2 RecName: Full=50S ribosomal protein L16
 gi|157388730|gb|ABV51435.1| 50S ribosomal protein L16 [Prochlorococcus marinus str. MIT 9215]
          Length = 160

 Score =  194 bits (495), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 74/135 (54%), Positives = 97/135 (71%), Gaps = 2/135 (1%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ KQ +GR++GVA  G+ I FG FAL+AQ+   + + +IEA+RRA++R +KR
Sbjct: 1   MLSPKRTKFRKQHRGRMRGVASKGNTIAFGQFALQAQDCGWVTARQIEASRRAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDG--VSEEVARRAF 119
            G++WI +FPD PVT +P E RMG GKGN E WV  VKPGRILFE+ G  ++EEVA+ A 
Sbjct: 61  GGQIWIRIFPDKPVTMRPAETRMGSGKGNPEFWVAVVKPGRILFEMGGEDITEEVAKEAM 120

Query: 120 RLGAAKLSVVTKFIQ 134
           RL   KL V TKFI 
Sbjct: 121 RLAQYKLPVKTKFIS 135


>gi|78189800|ref|YP_380138.1| 50S ribosomal protein L16 [Chlorobium chlorochromatii CaD3]
 gi|115502740|sp|Q3API0|RL16_CHLCH RecName: Full=50S ribosomal protein L16
 gi|78171999|gb|ABB29095.1| LSU ribosomal protein L16P [Chlorobium chlorochromatii CaD3]
          Length = 139

 Score =  194 bits (495), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 77/134 (57%), Positives = 94/134 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY K  +GR+KG A  G+ + FG+F LKA E   I S +IEAAR A++R MKR
Sbjct: 1   MLMPKRVKYRKTQRGRMKGNAGRGTSVAFGSFGLKAMEPAWITSRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT KP E RMG GKG+ E WV  VKPGR++FE DGVS+E+A  AFRL
Sbjct: 61  DGKVWIRIFPDKPVTQKPAETRMGSGKGSPEFWVAVVKPGRVMFEADGVSKEIATEAFRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + TKFI R
Sbjct: 121 AAKKLPIKTKFIIR 134


>gi|327402776|ref|YP_004343614.1| 50S ribosomal protein L16P [Fluviicola taffensis DSM 16823]
 gi|327318284|gb|AEA42776.1| LSU ribosomal protein L16P [Fluviicola taffensis DSM 16823]
          Length = 142

 Score =  194 bits (494), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 75/134 (55%), Positives = 92/134 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ +  KGR +G A+ GS I FG+F LK  E   I S +IEA+R A++R MKR
Sbjct: 1   MLSPKRTKFRRVQKGRNRGEAQRGSTIAFGSFGLKTLEPGWITSRQIEASRIAVTRFMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T+KP EVRMGKGKG    WV  V+PGRI+FE DGV  EVA+ A RL
Sbjct: 61  EGKVWIRIFPDKPITSKPAEVRMGKGKGAPSHWVAVVRPGRIMFEADGVPYEVAKEALRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL V  KFI R
Sbjct: 121 AAQKLPVKCKFIVR 134


>gi|197303819|ref|ZP_03168855.1| hypothetical protein RUMLAC_02558 [Ruminococcus lactaris ATCC
           29176]
 gi|197297112|gb|EDY31676.1| hypothetical protein RUMLAC_02558 [Ruminococcus lactaris ATCC
           29176]
 gi|291549409|emb|CBL25671.1| LSU ribosomal protein L16P [Ruminococcus torques L2-14]
          Length = 145

 Score =  194 bits (494), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 69/134 (51%), Positives = 88/134 (65%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K  KQF+G +KG A  G++I +G + + A E   I S++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKRRKQFRGTMKGKALRGNKISYGEYGIVAMEPCWIRSNQIEAARVAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+TAKP E RMG GKG VE W   VKPGR++FEI GV EE AR A RL
Sbjct: 61  GGKVWIKIFPDKPITAKPAETRMGSGKGTVEYWAAVVKPGRVMFEIAGVPEETAREALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL    K + R
Sbjct: 121 AMHKLPCKCKIVSR 134


>gi|153816245|ref|ZP_01968913.1| hypothetical protein RUMTOR_02494 [Ruminococcus torques ATCC 27756]
 gi|317501781|ref|ZP_07959967.1| 50S ribosomal protein L16 [Lachnospiraceae bacterium 8_1_57FAA]
 gi|331088698|ref|ZP_08337608.1| 50S ribosomal protein L16 [Lachnospiraceae bacterium 3_1_46FAA]
 gi|145846428|gb|EDK23346.1| hypothetical protein RUMTOR_02494 [Ruminococcus torques ATCC 27756]
 gi|316896814|gb|EFV18899.1| 50S ribosomal protein L16 [Lachnospiraceae bacterium 8_1_57FAA]
 gi|330407221|gb|EGG86724.1| 50S ribosomal protein L16 [Lachnospiraceae bacterium 3_1_46FAA]
          Length = 145

 Score =  194 bits (494), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 69/134 (51%), Positives = 87/134 (64%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K  KQF+G +KG A  G+ I +G + + A E   I S++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKRRKQFRGTMKGKALRGNTIAYGEYGIVAAEPCWIRSNQIEAARVAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+TAKP E RMG GKG VE W   VKPGR++FEI GV EE AR A RL
Sbjct: 61  GGKVWIKIFPDKPITAKPAETRMGSGKGTVEYWAAVVKPGRVMFEIAGVPEETAREALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL    K + R
Sbjct: 121 AMHKLPCKCKIVSR 134


>gi|34501442|ref|NP_904229.1| ribosomal protein L16 [Physcomitrella patens subsp. patens]
 gi|75294053|sp|Q6YXK9|RK16_PHYPA RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|34494812|dbj|BAC85079.1| ribosomal protein L16 [Physcomitrella patens subsp. patens]
          Length = 138

 Score =  194 bits (494), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 72/133 (54%), Positives = 94/133 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ KQ +GR+KG+A  G+ I FG FAL+A E + I S +IEA RRAI+R  +R
Sbjct: 1   MLSPKRTKFRKQHRGRMKGIATRGNSIAFGKFALQALEPSWITSRQIEAGRRAITRYARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T +P E RMG GKG+ E WV  VKPGRIL+EI GV E VAR A R+
Sbjct: 61  GGKLWIRIFPDKPITMRPAETRMGSGKGSPEYWVSVVKPGRILYEISGVPESVARAAMRI 120

Query: 122 GAAKLSVVTKFIQ 134
            A K+ + T+FI 
Sbjct: 121 AAYKMPIRTQFIT 133


>gi|225571560|ref|ZP_03780556.1| hypothetical protein CLOHYLEM_07658 [Clostridium hylemonae DSM
           15053]
 gi|225159637|gb|EEG72256.1| hypothetical protein CLOHYLEM_07658 [Clostridium hylemonae DSM
           15053]
          Length = 145

 Score =  194 bits (494), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 71/134 (52%), Positives = 89/134 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K  KQF+G +KG A  G++I  G + + A E   I S++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKRRKQFRGSMKGKALRGNKITNGEYGIVAMEPCWIRSNQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT KP E RMG GKG +E WV  VKPGR++FEI GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPDKPVTTKPAETRMGSGKGTLEYWVAVVKPGRVMFEIAGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL    K + R
Sbjct: 121 ATHKLPCKCKVVSR 134


>gi|163745547|ref|ZP_02152907.1| 50S ribosomal protein L16 [Oceanibulbus indolifex HEL-45]
 gi|161382365|gb|EDQ06774.1| 50S ribosomal protein L16 [Oceanibulbus indolifex HEL-45]
          Length = 137

 Score =  194 bits (494), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 84/135 (62%), Positives = 105/135 (77%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQFKG IKG+AKGGS + FG + LKA +  R+ + +IEAARRA++R MKR
Sbjct: 1   MLQPKRTKFRKQFKGSIKGLAKGGSDLNFGTYGLKALQPERVTARQIEAARRAMTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPDVPVT+KP EVRMGKGKG+V+ W  +VKPGRI+FEIDGV E+VAR A RL
Sbjct: 61  QGRVWIRIFPDVPVTSKPVEVRMGKGKGSVDFWAAKVKPGRIMFEIDGVGEDVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL + T+ + R 
Sbjct: 121 AAMKLPIKTRVVVRE 135


>gi|146278561|ref|YP_001168720.1| 50S ribosomal protein L16 [Rhodobacter sphaeroides ATCC 17025]
 gi|166215169|sp|A4WVK1|RL16_RHOS5 RecName: Full=50S ribosomal protein L16
 gi|145556802|gb|ABP71415.1| LSU ribosomal protein L16P [Rhodobacter sphaeroides ATCC 17025]
          Length = 137

 Score =  194 bits (494), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 86/135 (63%), Positives = 103/135 (76%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQ KGRI G AKGG  + FG F LKA E  R+ + +IEAARRAI+R MKR
Sbjct: 1   MLQPKRTKFRKQHKGRIHGEAKGGFLLNFGGFGLKATEPERVTARQIEAARRAITRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPD PVT+KPTEVRMGKGKG+V+ W  +VKPGRI+FEIDGVSE +AR A RL
Sbjct: 61  QGRVWIRIFPDTPVTSKPTEVRMGKGKGSVDFWAAKVKPGRIMFEIDGVSETIAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
           GA KL + T+ + R 
Sbjct: 121 GAMKLPITTRIVVRE 135


>gi|326799134|ref|YP_004316953.1| 50S ribosomal protein L16 [Sphingobacterium sp. 21]
 gi|326549898|gb|ADZ78283.1| 50S ribosomal protein L16 [Sphingobacterium sp. 21]
          Length = 140

 Score =  194 bits (494), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 77/134 (57%), Positives = 95/134 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGR+KG A  G+ + FG+F +K+ E   I S +IEAAR A++R MKR
Sbjct: 1   MLQPKRTKFRKMQKGRMKGNAGRGAELAFGSFGIKSLEPAWITSRQIEAARIAVTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT KP EVRMGKGKG  E WV  V+PGR+LFE +GV  EVA+ A RL
Sbjct: 61  EGQVWIRIFPDKPVTKKPAEVRMGKGKGAPEYWVAVVRPGRMLFEAEGVPLEVAKEALRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL V TKF+ R
Sbjct: 121 AAQKLPVQTKFVIR 134


>gi|298345465|ref|YP_003718152.1| 50S ribosomal protein L16 [Mobiluncus curtisii ATCC 43063]
 gi|304391021|ref|ZP_07372973.1| 50S ribosomal protein L16 [Mobiluncus curtisii subsp. curtisii ATCC
           35241]
 gi|315655874|ref|ZP_07908772.1| 50S ribosomal protein L16 [Mobiluncus curtisii ATCC 51333]
 gi|315656200|ref|ZP_07909091.1| 50S ribosomal protein L16 [Mobiluncus curtisii subsp. holmesii ATCC
           35242]
 gi|298235526|gb|ADI66658.1| 50S ribosomal protein L16 [Mobiluncus curtisii ATCC 43063]
 gi|304325904|gb|EFL93150.1| 50S ribosomal protein L16 [Mobiluncus curtisii subsp. curtisii ATCC
           35241]
 gi|315489938|gb|EFU79565.1| 50S ribosomal protein L16 [Mobiluncus curtisii ATCC 51333]
 gi|315493202|gb|EFU82802.1| 50S ribosomal protein L16 [Mobiluncus curtisii subsp. holmesii ATCC
           35242]
          Length = 138

 Score =  194 bits (494), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 66/135 (48%), Positives = 93/135 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+ TK+ +Q +   +G AKGG+ I FG+F ++A E+  + + +IEAAR A++R +KR
Sbjct: 1   MLIPRRTKWRRQHRPGRRGYAKGGTEIAFGDFGIQALESAYLTNRQIEAARIAVTRHVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T KP E RMG GKG+ E WV  VKPGR+LFEI GVSEE+AR A   
Sbjct: 61  GGKIWINIFPDRPLTKKPAETRMGSGKGSPEWWVAPVKPGRVLFEIAGVSEELAREALSR 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL + T+F+ R 
Sbjct: 121 AQHKLPIKTRFVSRE 135


>gi|152973963|ref|YP_001373480.1| 50S ribosomal protein L16 [Bacillus cereus subsp. cytotoxis NVH
           391-98]
 gi|189041446|sp|A7GK27|RL16_BACCN RecName: Full=50S ribosomal protein L16
 gi|152022715|gb|ABS20485.1| ribosomal protein L16 [Bacillus cytotoxicus NVH 391-98]
          Length = 144

 Score =  194 bits (494), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 76/135 (56%), Positives = 98/135 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY ++ +G+++G AKGG+ + FG F L+AQ A+ I + +IEAARRA++R MKR
Sbjct: 1   MLMPKRVKYRREHRGKMRGRAKGGTEVTFGEFGLQAQNASWITNRQIEAARRAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP  P TAKP EVRMG GKG  E WV  VKPG+++FEI GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPSKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKVMFEIAGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL V  KF++R 
Sbjct: 121 AAHKLPVKCKFVKRE 135


>gi|311029056|ref|ZP_07707146.1| 50S ribosomal protein L16 [Bacillus sp. m3-13]
          Length = 144

 Score =  194 bits (494), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 74/135 (54%), Positives = 97/135 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY ++ +G+++G AKGG+ + FG F L++ EA+ I + +IEAARRA++R MKR
Sbjct: 1   MLLPKRVKYRREHRGKMRGKAKGGTEVHFGEFGLQSLEASWITNRQIEAARRAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP  P TAKP EVRMG GKG  E WV  VKPG+++FEI GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPSKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKVMFEISGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL V  KF++R 
Sbjct: 121 AMHKLPVKCKFVKRE 135


>gi|315652347|ref|ZP_07905339.1| 50S ribosomal protein L16 [Eubacterium saburreum DSM 3986]
 gi|315485470|gb|EFU75860.1| 50S ribosomal protein L16 [Eubacterium saburreum DSM 3986]
          Length = 145

 Score =  194 bits (494), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 70/134 (52%), Positives = 89/134 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K  KQF+G + G A  G++I +G + L + +   I S++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKRRKQFRGSMAGKALRGNKITYGEYGLVSLDPCWIKSNQIEAARVAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVTAKP E RMG GKG  E WV  VKPGRILFEI GVSEE+AR A RL
Sbjct: 61  GGKVWIKIFPDKPVTAKPAETRMGSGKGATEYWVAVVKPGRILFEIAGVSEEIAREALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL    K + +
Sbjct: 121 AMHKLPCRCKIVSK 134


>gi|313183893|ref|YP_004021747.1| ribosomal protein L16 [Equisetum arvense]
 gi|281371613|gb|ADA63546.1| ribosomal protein L16 [Equisetum arvense]
          Length = 140

 Score =  194 bits (494), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 71/133 (53%), Positives = 95/133 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+ ICFG FAL+A E   I + +IEA RRAI+R  +R
Sbjct: 1   MLSPKRTRFRKQHRGRLKGLSTRGNTICFGKFALQALEPTWITARQIEAGRRAITRYARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVT +P E RMG GKG+ E WV  VKPGRI++EI GVSE VA+ A +L
Sbjct: 61  GGKLWIRIFPDKPVTMRPAETRMGSGKGSPEFWVSVVKPGRIIYEISGVSENVAQAAMKL 120

Query: 122 GAAKLSVVTKFIQ 134
            A KL + T+FI 
Sbjct: 121 AAYKLPIRTQFIT 133


>gi|95931436|ref|ZP_01314142.1| ribosomal protein L16 [Desulfuromonas acetoxidans DSM 684]
 gi|95132504|gb|EAT14197.1| ribosomal protein L16 [Desulfuromonas acetoxidans DSM 684]
          Length = 141

 Score =  194 bits (494), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 71/135 (52%), Positives = 94/135 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQFKGR+KG AKG + I FG++ L+A     + S +IEAARRA++R +KR
Sbjct: 1   MLMPKKVKHRKQFKGRMKGAAKGATNINFGDYGLQATNRGWLSSRQIEAARRAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD  +T K  E RMGKGKG+ + WV  V+PG +L+E+ GV EEVAR A RL
Sbjct: 61  GGKIWIRVFPDKSLTRKAAETRMGKGKGSPDSWVAVVRPGMVLYEMQGVPEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL + TKF+ R 
Sbjct: 121 AAHKLPISTKFVARE 135


>gi|119358184|ref|YP_912828.1| 50S ribosomal protein L16 [Chlorobium phaeobacteroides DSM 266]
 gi|166234567|sp|A1BJ27|RL16_CHLPD RecName: Full=50S ribosomal protein L16
 gi|119355533|gb|ABL66404.1| LSU ribosomal protein L16P [Chlorobium phaeobacteroides DSM 266]
          Length = 139

 Score =  194 bits (494), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 75/134 (55%), Positives = 91/134 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY K  +GR+KG +  G+ + FG+F LKA E   I S +IEAAR A++R MKR
Sbjct: 1   MLMPKRVKYRKTMRGRMKGNSGRGTSVDFGSFGLKALEPAWITSRQIEAARVAMTRFMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVT K  E RMG GKG+ E WV  VKPGRI+FE DGV  EVA  AFRL
Sbjct: 61  DGKIWIRIFPDKPVTKKAAETRMGSGKGSPEFWVAVVKPGRIMFEADGVPREVATEAFRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + TKFI R
Sbjct: 121 AAQKLPIKTKFIVR 134


>gi|70725810|ref|YP_252724.1| 50S ribosomal protein L16 [Staphylococcus haemolyticus JCSC1435]
 gi|223042673|ref|ZP_03612722.1| ribosomal protein L16 [Staphylococcus capitis SK14]
 gi|242371890|ref|ZP_04817464.1| 50S ribosomal protein L16 [Staphylococcus epidermidis M23864:W1]
 gi|314934290|ref|ZP_07841649.1| ribosomal protein L16 [Staphylococcus caprae C87]
 gi|85541822|sp|Q4L8A7|RL16_STAHJ RecName: Full=50S ribosomal protein L16
 gi|68446534|dbj|BAE04118.1| 50S ribosomal protein L16 [Staphylococcus haemolyticus JCSC1435]
 gi|222444336|gb|EEE50432.1| ribosomal protein L16 [Staphylococcus capitis SK14]
 gi|242350397|gb|EES41998.1| 50S ribosomal protein L16 [Staphylococcus epidermidis M23864:W1]
 gi|313652220|gb|EFS15983.1| ribosomal protein L16 [Staphylococcus caprae C87]
          Length = 144

 Score =  194 bits (494), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 72/135 (53%), Positives = 93/135 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +Q + +  G +KGG+ + FG + L+A   + I S +IE+AR A++R MKR
Sbjct: 1   MLLPKRVKYRRQHRPKTTGRSKGGNYVTFGEYGLQATTTSWITSRQIESARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP  P T KP EVRMG GKG VE W+  VKPGRILFE+ GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPHTPYTKKPLEVRMGAGKGAVEGWIAVVKPGRILFEVAGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL V TKF++R 
Sbjct: 121 ASHKLPVKTKFVKRE 135


>gi|325294403|ref|YP_004280917.1| 50S ribosomal protein L16 [Desulfurobacterium thermolithotrophum
           DSM 11699]
 gi|325064851|gb|ADY72858.1| 50S ribosomal protein L16 [Desulfurobacterium thermolithotrophum
           DSM 11699]
          Length = 142

 Score =  194 bits (494), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 69/135 (51%), Positives = 95/135 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ KQ +GR+KG +  G+++ FG++ ++A E   I +++IEAAR A++R MKR
Sbjct: 1   MLMPKRTKFRKQQRGRLKGKSYRGNKLAFGDYGIQALEPGYITTNQIEAARVAMTRTMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P T KP E RMGKGKGNVE WV +V PGRI+FE+ GV EEVA  A RL
Sbjct: 61  GGKVWIRIFPDKPYTKKPLETRMGKGKGNVETWVAKVLPGRIMFEVAGVGEEVALEALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  + ++R 
Sbjct: 121 AVHKLPIKCRIVKRE 135


>gi|163851592|ref|YP_001639635.1| 50S ribosomal protein L16 [Methylobacterium extorquens PA1]
 gi|188581382|ref|YP_001924827.1| 50S ribosomal protein L16 [Methylobacterium populi BJ001]
 gi|218530401|ref|YP_002421217.1| 50S ribosomal protein L16 [Methylobacterium chloromethanicum CM4]
 gi|240138760|ref|YP_002963232.1| 50S ribosomal subunit protein L16 [Methylobacterium extorquens AM1]
 gi|254561360|ref|YP_003068455.1| 50S ribosomal subunit protein L16 [Methylobacterium extorquens DM4]
 gi|226712320|sp|A9W4Q8|RL16_METEP RecName: Full=50S ribosomal protein L16
 gi|226712321|sp|B1Z759|RL16_METPB RecName: Full=50S ribosomal protein L16
 gi|254799209|sp|B7L0R8|RL16_METC4 RecName: Full=50S ribosomal protein L16
 gi|163663197|gb|ABY30564.1| ribosomal protein L16 [Methylobacterium extorquens PA1]
 gi|179344880|gb|ACB80292.1| ribosomal protein L16 [Methylobacterium populi BJ001]
 gi|218522704|gb|ACK83289.1| ribosomal protein L16 [Methylobacterium chloromethanicum CM4]
 gi|240008729|gb|ACS39955.1| 50S ribosomal subunit protein L16 [Methylobacterium extorquens AM1]
 gi|254268638|emb|CAX24597.1| 50S ribosomal subunit protein L16 [Methylobacterium extorquens DM4]
          Length = 137

 Score =  194 bits (494), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 90/137 (65%), Positives = 105/137 (76%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQFKGRI G AKGG  + FG F LK  E  RI + +IEAARRAI+R MKR
Sbjct: 1   MLQPKKTKFRKQFKGRISGAAKGGFELNFGQFGLKCLEPERITARQIEAARRAITREMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI VFPD+PVTAKPTEVRMG GKG  E W  RV PGRI+FE+DGV+E++AR A RL
Sbjct: 61  QGRVWIRVFPDLPVTAKPTEVRMGSGKGAPEYWAARVHPGRIMFEVDGVAEDIAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
           GAAKL V T+ IQR+ +
Sbjct: 121 GAAKLPVRTRVIQRIAD 137


>gi|84503635|ref|ZP_01001673.1| 50S ribosomal protein L16 [Oceanicola batsensis HTCC2597]
 gi|84387932|gb|EAQ00984.1| 50S ribosomal protein L16 [Oceanicola batsensis HTCC2597]
          Length = 137

 Score =  194 bits (494), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 87/135 (64%), Positives = 109/135 (80%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQFKGRIKG AKGGS + FG + LKA +  R+ + +IEAARRA++R MKR
Sbjct: 1   MLQPKRTKFRKQFKGRIKGDAKGGSDLNFGTYGLKATQPERVSARQIEAARRAMTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPDVPVTAKP EVRMGKGKG+V++WVC+VKPGR++FEIDGV+E++AR A RL
Sbjct: 61  QGRVWIRIFPDVPVTAKPIEVRMGKGKGSVDRWVCKVKPGRVMFEIDGVNEDIAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL V T+ + R 
Sbjct: 121 AAMKLPVKTRVVVRE 135


>gi|323691208|ref|ZP_08105484.1| 50S ribosomal protein L16 [Clostridium symbiosum WAL-14673]
 gi|323504727|gb|EGB20513.1| 50S ribosomal protein L16 [Clostridium symbiosum WAL-14673]
          Length = 145

 Score =  194 bits (494), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 71/134 (52%), Positives = 87/134 (64%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K  KQF+G + G A  G+ IC+G F L + E   I S++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKRRKQFRGSMAGKATRGNVICYGEFGLVSTEPCWIRSNQIEAARVAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVTAKP E RMG GKG +E WV  VKPGR+LFEI GV EE AR A RL
Sbjct: 61  GGKVWIKIFPDKPVTAKPAETRMGSGKGALEYWVAVVKPGRVLFEIAGVPEETAREALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL    K   +
Sbjct: 121 AMHKLPCKCKIASK 134


>gi|149279657|ref|ZP_01885786.1| 50S ribosomal protein L16 [Pedobacter sp. BAL39]
 gi|255530521|ref|YP_003090893.1| 50S ribosomal protein L16 [Pedobacter heparinus DSM 2366]
 gi|149229693|gb|EDM35083.1| 50S ribosomal protein L16 [Pedobacter sp. BAL39]
 gi|255343505|gb|ACU02831.1| ribosomal protein L16 [Pedobacter heparinus DSM 2366]
          Length = 140

 Score =  194 bits (494), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 75/134 (55%), Positives = 97/134 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGR+KG+A  G+ + FG+F +K+ E+  I S +IEAAR A++R MKR
Sbjct: 1   MLQPKRTKFRKMQKGRMKGLATRGAELSFGSFGIKSLESTWITSRQIEAARIAVTRFMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT KP EVRMGKGKG  E WV  V+PGRI+FE +GV  E+A+ A RL
Sbjct: 61  EGQVWIRIFPDKPVTKKPAEVRMGKGKGAPEYWVAVVRPGRIIFEAEGVPLEIAKEAMRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + TKF+ R
Sbjct: 121 AAQKLPIQTKFVVR 134


>gi|89070550|ref|ZP_01157839.1| 50S ribosomal protein L16 [Oceanicola granulosus HTCC2516]
 gi|89043857|gb|EAR50055.1| 50S ribosomal protein L16 [Oceanicola granulosus HTCC2516]
          Length = 137

 Score =  194 bits (494), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 83/135 (61%), Positives = 104/135 (77%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGRI G AKGGS + FG + LKA E  RI + +IEAARRA++R MKR
Sbjct: 1   MLQPKRTKFRKLHKGRIHGEAKGGSDLNFGTYGLKALEPERITARQIEAARRAMTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPD+PVTAKP EVRMGKGKG+V++W  +VKPGR++FEIDGV+EE+AR A RL
Sbjct: 61  QGRVWIRIFPDLPVTAKPIEVRMGKGKGSVDRWTAKVKPGRVMFEIDGVNEEIAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL + T+ + R 
Sbjct: 121 AAMKLPIKTRTVVRE 135


>gi|258646045|ref|ZP_05733514.1| ribosomal protein L16 [Dialister invisus DSM 15470]
 gi|260403416|gb|EEW96963.1| ribosomal protein L16 [Dialister invisus DSM 15470]
          Length = 141

 Score =  194 bits (493), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 70/137 (51%), Positives = 93/137 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY KQF+GR+KG A  G+ + +G F L A E + I S +IEAAR A++R  KR
Sbjct: 1   MLIPKRTKYRKQFRGRMKGRAHRGNTVTYGEFGLVAMEPSWITSRQIEAARIAMTRYTKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT+KP   R G GKG+VE WV  VKPGR++FE+ G+  E A+ A RL
Sbjct: 61  GGKVWIKIFPDKPVTSKPIGTRQGSGKGSVEYWVAVVKPGRVMFEMGGIPAEAAKEAMRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            + KL + TKF+ +  E
Sbjct: 121 ASNKLPIKTKFVVKGQE 137


>gi|163733818|ref|ZP_02141260.1| 50S ribosomal protein L16 [Roseobacter litoralis Och 149]
 gi|161392929|gb|EDQ17256.1| 50S ribosomal protein L16 [Roseobacter litoralis Och 149]
          Length = 137

 Score =  194 bits (493), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 84/135 (62%), Positives = 107/135 (79%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQFKG IKG+AKGGS + FG + LKA E  R+ + +IEAARRA++R MKR
Sbjct: 1   MLQPKRTKFRKQFKGSIKGLAKGGSDLNFGTYGLKATEPERVTARQIEAARRAMTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPDVPVTAKP EVRMGKGKG+V++W  +VKPGR++FEIDGV+++VAR A RL
Sbjct: 61  QGRVWIRIFPDVPVTAKPIEVRMGKGKGSVDRWAAKVKPGRVMFEIDGVNDDVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL + T+ + R 
Sbjct: 121 AAMKLPIKTRVVVRE 135


>gi|110678728|ref|YP_681735.1| 50S ribosomal protein L16 [Roseobacter denitrificans OCh 114]
 gi|115502788|sp|Q16AE4|RL16_ROSDO RecName: Full=50S ribosomal protein L16
 gi|109454844|gb|ABG31049.1| ribosomal protein L16 [Roseobacter denitrificans OCh 114]
          Length = 137

 Score =  194 bits (493), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 85/135 (62%), Positives = 107/135 (79%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQFKG IKG+AKGGS + FG + LKA E  RI + +IEAARRA++R MKR
Sbjct: 1   MLQPKRTKFRKQFKGSIKGLAKGGSDLNFGTYGLKAIEPERITARQIEAARRAMTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPDVPVTAKP EVRMGKGKG+V++W  +VKPGR++FEIDGV+++VAR A RL
Sbjct: 61  QGRVWIRIFPDVPVTAKPIEVRMGKGKGSVDRWAAKVKPGRVMFEIDGVNDDVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL + T+ + R 
Sbjct: 121 AAMKLPIKTRVVVRE 135


>gi|295688913|ref|YP_003592606.1| 50S 50S ribosomal protein L16 [Caulobacter segnis ATCC 21756]
 gi|295430816|gb|ADG09988.1| ribosomal protein L16 [Caulobacter segnis ATCC 21756]
          Length = 143

 Score =  194 bits (493), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 84/135 (62%), Positives = 104/135 (77%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ KQFKGRI G +KGG+ + FG++ LKA E  RI + +IEAARRAI+R MKR
Sbjct: 1   MLSPKKTKFRKQFKGRIHGASKGGTLLNFGSYGLKAVEPERITARQIEAARRAITRQMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPDVPVT KP EVRMGKGKG V+ W  RV PGRI+FEIDGV +++AR A RL
Sbjct: 61  QGRVWIRIFPDVPVTGKPAEVRMGKGKGAVDYWAARVAPGRIMFEIDGVPDDIAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
           GAAKL + T+ + R+
Sbjct: 121 GAAKLPIRTRVVTRI 135


>gi|246880720|gb|ACS95032.1| ribosomal protein L16 [Dunaliella salina]
          Length = 137

 Score =  194 bits (493), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 67/136 (49%), Positives = 94/136 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ KQ +GR+KG A  G+ I FG+FAL+A E   I S +IE+ RR ++R ++R
Sbjct: 1   MLSPKRTKFRKQHRGRLKGKAYRGNTIAFGDFALQALEPCWITSRQIESGRRVLTRYVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+TA+P   RMG GKG  E WV  VKPG+I++EI GV+E VAR A R+
Sbjct: 61  GGKLWIRIFPDKPITARPAGTRMGSGKGAPEYWVAVVKPGKIIYEIRGVNEIVARHALRI 120

Query: 122 GAAKLSVVTKFIQRVV 137
            + K+ + TKF+ R  
Sbjct: 121 ASYKMPIKTKFLGRTS 136


>gi|114766892|ref|ZP_01445814.1| 50S ribosomal protein L16 [Pelagibaca bermudensis HTCC2601]
 gi|114540938|gb|EAU43998.1| 50S ribosomal protein L16 [Roseovarius sp. HTCC2601]
          Length = 137

 Score =  194 bits (493), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 84/135 (62%), Positives = 107/135 (79%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K FKGRIKG AKGGS + FG++ LKA +  R+ + +IEAARRA++R MKR
Sbjct: 1   MLQPKRTKFRKMFKGRIKGEAKGGSDLNFGHYGLKALQPERVTARQIEAARRAMTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPD PVT+KPTEVRMGKGKG+V+ W C+VKPGR++FEIDGV+E+VAR A RL
Sbjct: 61  QGRVWIRIFPDTPVTSKPTEVRMGKGKGSVDYWACKVKPGRVMFEIDGVAEDVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL + T+ + R 
Sbjct: 121 AAMKLPIKTRVVVRE 135


>gi|159042845|ref|YP_001531639.1| 50S ribosomal protein L16 [Dinoroseobacter shibae DFL 12]
 gi|189041459|sp|A8LM61|RL16_DINSH RecName: Full=50S ribosomal protein L16
 gi|157910605|gb|ABV92038.1| 50S ribosomal protein L16 [Dinoroseobacter shibae DFL 12]
          Length = 137

 Score =  194 bits (493), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 86/135 (63%), Positives = 106/135 (78%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQFKGRI+G AKGGS + FG + LKA +  RI + +IEAARRA++R MKR
Sbjct: 1   MLQPKRTKFRKQFKGRIRGEAKGGSDLNFGTYGLKALQPERITARQIEAARRAMTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPD+PVT+KP EVRMGKGKG+V+ W C+VKPGRI+FEIDGVSE VAR A RL
Sbjct: 61  QGRVWIRIFPDLPVTSKPVEVRMGKGKGSVDFWACKVKPGRIMFEIDGVSEPVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL + T+ + R 
Sbjct: 121 AAMKLPIKTRTVVRE 135


>gi|269101050|ref|YP_003289198.1| 50S ribosomal protein L16 [Ectocarpus siliculosus]
 gi|266631558|emb|CAV31229.1| Chloroplast 50S ribosomal protein L16 [Ectocarpus siliculosus]
 gi|270118688|emb|CAT18756.1| Chloroplast 50S ribosomal protein L16 [Ectocarpus siliculosus]
          Length = 134

 Score =  194 bits (493), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 67/134 (50%), Positives = 93/134 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ KQ +GR+KG A  G+ I FG++AL+A E   + S +IEA RR I+R  KR
Sbjct: 1   MLSPKKTKFRKQHRGRLKGKASRGNSINFGDYALQALEPTWLTSRQIEATRRTITRYTKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD P+TA+  E RMG GKG+VE WV  VKPG ILFE+ GV  ++A+ A  +
Sbjct: 61  GGKLWITVFPDKPITARAAESRMGSGKGSVEYWVAVVKPGHILFELGGVPAKLAKEALEI 120

Query: 122 GAAKLSVVTKFIQR 135
            + KL + TKF+++
Sbjct: 121 ASYKLPIKTKFLKK 134


>gi|189095427|ref|YP_001936440.1| ribosomal protein L16 [Heterosigma akashiwo]
 gi|157694770|gb|ABV66046.1| 50S ribosomal protein L16 [Heterosigma akashiwo]
 gi|157778001|gb|ABV70187.1| 50S ribosomal protein L16 [Heterosigma akashiwo]
          Length = 137

 Score =  194 bits (493), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 70/135 (51%), Positives = 92/135 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ KQ +GR+KG A  G++I +G++AL+A E   + S +IEA RR I+R  KR
Sbjct: 1   MLLPKRTKFRKQHRGRLKGKACRGNKISYGDYALQALEPTWLTSRQIEATRRTITRYTKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD PVT +  E RMG GKG VE WV  VKPG+ILFE+ GV  E+A+ A + 
Sbjct: 61  GGKLWITVFPDKPVTFRAAESRMGSGKGAVEYWVAVVKPGKILFEMSGVPLELAKAAMKT 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL V TKFI R 
Sbjct: 121 ASYKLPVKTKFITRE 135


>gi|90994497|ref|YP_536987.1| ribosomal protein L16 [Porphyra yezoensis]
 gi|115502628|sp|Q1XDI1|RK16_PORYE RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|90819061|dbj|BAE92430.1| 50S ribosomal protein L16 [Porphyra yezoensis]
          Length = 139

 Score =  194 bits (493), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 70/134 (52%), Positives = 94/134 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ KQ +GR+KG A  G+ I FG++AL+A E   + S +IEA RR I+R ++R
Sbjct: 1   MLSPKKTKFRKQHRGRMKGSASKGNTIAFGDYALQATEPVWLTSRQIEATRRTITRYVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD PVTA+P E RMG GKG  E WV  +KPG ILFEI GV ++ A++A +L
Sbjct: 61  GGKLWIRVFPDKPVTARPAETRMGSGKGAPEYWVAVIKPGHILFEITGVPQKTAQQAMKL 120

Query: 122 GAAKLSVVTKFIQR 135
            + KL + TKFI R
Sbjct: 121 ASYKLPIKTKFIVR 134


>gi|11467338|ref|NP_043195.1| ribosomal protein L16 [Cyanophora paradoxa]
 gi|132704|sp|P23406|RK16_CYAPA RecName: Full=50S ribosomal protein L16, cyanelle
 gi|336648|gb|AAA63622.1| ribosomal protein l16 [Cyanophora paradoxa]
 gi|1016139|gb|AAA81226.1| ribosomal protein L16 [Cyanophora paradoxa]
          Length = 136

 Score =  194 bits (493), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 69/133 (51%), Positives = 97/133 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+ TK+ KQ +GR+KG++  G+ + FG+F L+A E   I S +IEA+RRAI+R ++R
Sbjct: 1   MLSPRRTKFRKQQRGRMKGISTRGNNLVFGDFGLQALEPAWITSRQIEASRRAINRYVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVT +P E RMG GKG  E WV  VKPGR++FEI+GVS+E+A+ AFR+
Sbjct: 61  GGKIWIRIFPDKPVTMRPAETRMGSGKGAPEYWVAIVKPGRVIFEINGVSQEMAKAAFRI 120

Query: 122 GAAKLSVVTKFIQ 134
              KL + TKFI 
Sbjct: 121 ATFKLPIKTKFIS 133


>gi|149203519|ref|ZP_01880489.1| 50S ribosomal protein L16 [Roseovarius sp. TM1035]
 gi|149143352|gb|EDM31391.1| 50S ribosomal protein L16 [Roseovarius sp. TM1035]
          Length = 137

 Score =  194 bits (493), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 87/135 (64%), Positives = 107/135 (79%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQFKGRIKG AKGGS + FG F LKA +  RI + +IEAARRA++R MKR
Sbjct: 1   MLQPKRTKFRKQFKGRIKGEAKGGSDLNFGTFGLKATQPERITARQIEAARRAMTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPDVPV++KPTEVRMGKGKG+V+ W C+VKPGR++FEIDGVSEE+A  A RL
Sbjct: 61  QGRVWIRIFPDVPVSSKPTEVRMGKGKGSVDYWACKVKPGRVMFEIDGVSEEIAFEALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL + T+ + R 
Sbjct: 121 AAMKLPIKTRVVVRE 135


>gi|228474581|ref|ZP_04059312.1| ribosomal protein L16 [Staphylococcus hominis SK119]
 gi|314935839|ref|ZP_07843191.1| ribosomal protein L16 [Staphylococcus hominis subsp. hominis C80]
 gi|228271244|gb|EEK12612.1| ribosomal protein L16 [Staphylococcus hominis SK119]
 gi|313656404|gb|EFS20144.1| ribosomal protein L16 [Staphylococcus hominis subsp. hominis C80]
          Length = 144

 Score =  194 bits (493), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 72/135 (53%), Positives = 93/135 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +Q + +  G +KGG+ + FG + L+A   + I S +IE+AR A++R MKR
Sbjct: 1   MLLPKRVKYRRQHRPKTTGRSKGGNFVTFGEYGLQATTTSWITSRQIESARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP  P T KP EVRMG GKG VE W+  VKPGRILFEI GVSE+VAR A RL
Sbjct: 61  GGKVWIKIFPHTPYTKKPLEVRMGAGKGAVEGWIAVVKPGRILFEIAGVSEDVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL V TKF++R 
Sbjct: 121 ASHKLPVKTKFVKRE 135


>gi|329889136|ref|ZP_08267479.1| ribosomal protein L16 [Brevundimonas diminuta ATCC 11568]
 gi|328844437|gb|EGF94001.1| ribosomal protein L16 [Brevundimonas diminuta ATCC 11568]
          Length = 145

 Score =  194 bits (493), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 86/134 (64%), Positives = 102/134 (76%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TKY K FKGRI G +KGG  + FG++ LKA E  RI + +IEAARRAI+R MKR
Sbjct: 1   MLQPKKTKYRKAFKGRIHGSSKGGFSLNFGSYGLKAVEPERITARQIEAARRAITRQMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPDVPV+ KP EVRMGKGKG V+ W  RV PGRI+FEIDGV ++VAR A RL
Sbjct: 61  QGRVWIRIFPDVPVSGKPAEVRMGKGKGAVDHWAARVAPGRIMFEIDGVPDDVAREALRL 120

Query: 122 GAAKLSVVTKFIQR 135
           GAAKL + TK + R
Sbjct: 121 GAAKLPIRTKVVTR 134


>gi|224477213|ref|YP_002634819.1| 50S ribosomal protein L16 [Staphylococcus carnosus subsp. carnosus
           TM300]
 gi|254799221|sp|B9DM40|RL16_STACT RecName: Full=50S ribosomal protein L16
 gi|222421820|emb|CAL28634.1| 50S ribosomal protein L16 [Staphylococcus carnosus subsp. carnosus
           TM300]
          Length = 144

 Score =  194 bits (493), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 72/135 (53%), Positives = 93/135 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +Q + +  G +KGG+ + FG + L+A   + I S +IE+AR A++R MKR
Sbjct: 1   MLLPKRVKYRRQHRPKTTGRSKGGNFVTFGEYGLQAITTSWITSRQIESARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP  P T KP EVRMG GKG VE W+  VKPGRILFE+ GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPHTPYTKKPLEVRMGAGKGAVEGWIAVVKPGRILFEVAGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL V TKF++R 
Sbjct: 121 ASHKLPVKTKFVKRE 135


>gi|42779198|ref|NP_976445.1| 50S ribosomal protein L16 [Bacillus cereus ATCC 10987]
 gi|217957692|ref|YP_002336236.1| 50S ribosomal protein L16 [Bacillus cereus AH187]
 gi|222093887|ref|YP_002527937.1| 50S ribosomal protein l16 [Bacillus cereus Q1]
 gi|228937420|ref|ZP_04100066.1| 50S ribosomal protein L16 [Bacillus thuringiensis serovar berliner
           ATCC 10792]
 gi|228970306|ref|ZP_04130965.1| 50S ribosomal protein L16 [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228976876|ref|ZP_04137288.1| 50S ribosomal protein L16 [Bacillus thuringiensis Bt407]
 gi|229136963|ref|ZP_04265590.1| 50S ribosomal protein L16 [Bacillus cereus BDRD-ST26]
 gi|81570004|sp|Q73F89|RL16_BACC1 RecName: Full=50S ribosomal protein L16
 gi|226710678|sp|B7HQV1|RL16_BACC7 RecName: Full=50S ribosomal protein L16
 gi|254799179|sp|B9IZK1|RL16_BACCQ RecName: Full=50S ribosomal protein L16
 gi|42735113|gb|AAS39053.1| ribosomal protein L16 [Bacillus cereus ATCC 10987]
 gi|217067981|gb|ACJ82231.1| ribosomal protein L16 [Bacillus cereus AH187]
 gi|221237935|gb|ACM10645.1| ribosomal protein L16 [Bacillus cereus Q1]
 gi|228646501|gb|EEL02708.1| 50S ribosomal protein L16 [Bacillus cereus BDRD-ST26]
 gi|228782846|gb|EEM31012.1| 50S ribosomal protein L16 [Bacillus thuringiensis Bt407]
 gi|228789415|gb|EEM37335.1| 50S ribosomal protein L16 [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228822253|gb|EEM68235.1| 50S ribosomal protein L16 [Bacillus thuringiensis serovar berliner
           ATCC 10792]
 gi|324324108|gb|ADY19368.1| 50S ribosomal protein L16 [Bacillus thuringiensis serovar finitimus
           YBT-020]
 gi|326937912|gb|AEA13808.1| 50S ribosomal protein L16 [Bacillus thuringiensis serovar chinensis
           CT-43]
          Length = 144

 Score =  194 bits (493), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 77/135 (57%), Positives = 98/135 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY ++ +G+++G AKGG+ + FG F L+AQ A+ I + +IEAARRA++R MKR
Sbjct: 1   MLMPKRVKYRREHRGKMRGRAKGGTEVAFGEFGLQAQAASWITNRQIEAARRAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP  P TAKP EVRMG GKG  E WV  VKPG+I+FEI GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPSKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKIMFEIAGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL V  KF++R 
Sbjct: 121 AAHKLPVKCKFVKRE 135


>gi|189347696|ref|YP_001944225.1| 50S ribosomal protein L16 [Chlorobium limicola DSM 245]
 gi|226710695|sp|B3EGY3|RL16_CHLL2 RecName: Full=50S ribosomal protein L16
 gi|189341843|gb|ACD91246.1| ribosomal protein L16 [Chlorobium limicola DSM 245]
          Length = 139

 Score =  194 bits (493), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 74/134 (55%), Positives = 92/134 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY K  +GR+KG +  G+ + FG+F LKA E   I S +IEAAR A++R MKR
Sbjct: 1   MLMPKRVKYRKSQRGRMKGNSGRGTSVSFGSFGLKAMEPAWITSRQIEAARVAMNRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PV+ K  E RMG GKG+ E WV  VKPGRI+FE +GVS EVA  AFRL
Sbjct: 61  DGKIWIRIFPDKPVSKKAAETRMGSGKGSPEFWVAVVKPGRIMFEAEGVSREVATEAFRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + TKFI R
Sbjct: 121 AAQKLPIKTKFIVR 134


>gi|295394341|ref|ZP_06804566.1| 50S ribosomal protein L16 [Brevibacterium mcbrellneri ATCC 49030]
 gi|294972799|gb|EFG48649.1| 50S ribosomal protein L16 [Brevibacterium mcbrellneri ATCC 49030]
          Length = 138

 Score =  194 bits (493), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 67/135 (49%), Positives = 91/135 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  KY KQ   +  G+AKGG+ I FG++ ++A E   + + +IEAAR A++R +KR
Sbjct: 1   MLIPRRVKYRKQHHPKRSGLAKGGTEIAFGDWGIQALEPAYVTNRQIEAARIAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI ++PD P+T KP E RMG GKG+ E WV  VKPGR+LFE+ GVSEEVAR A RL
Sbjct: 61  GGKVWINIYPDRPLTKKPAETRMGSGKGSPEWWVANVKPGRVLFELAGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  + I R 
Sbjct: 121 ATHKLPLKARIISRE 135


>gi|30018387|ref|NP_830018.1| 50S ribosomal protein L16 [Bacillus cereus ATCC 14579]
 gi|30260308|ref|NP_842685.1| 50S ribosomal protein L16 [Bacillus anthracis str. Ames]
 gi|49183151|ref|YP_026403.1| 50S ribosomal protein L16 [Bacillus anthracis str. Sterne]
 gi|49476719|ref|YP_034469.1| 50S ribosomal protein L16 [Bacillus thuringiensis serovar konkukian
           str. 97-27]
 gi|50196909|ref|YP_016722.2| 50S ribosomal protein L16 [Bacillus anthracis str. 'Ames Ancestor']
 gi|52145101|ref|YP_081728.1| 50S ribosomal protein L16 [Bacillus cereus E33L]
 gi|206972203|ref|ZP_03233150.1| 50S ribosomal protein L16 [Bacillus cereus AH1134]
 gi|218232395|ref|YP_002364966.1| 50S ribosomal protein L16 [Bacillus cereus B4264]
 gi|218895252|ref|YP_002443663.1| ribosomal protein L16 [Bacillus cereus G9842]
 gi|218901321|ref|YP_002449155.1| ribosomal protein L16 [Bacillus cereus AH820]
 gi|225862169|ref|YP_002747547.1| 50S ribosomal protein L16 [Bacillus cereus 03BB102]
 gi|227812790|ref|YP_002812799.1| 50S ribosomal protein L16 [Bacillus anthracis str. CDC 684]
 gi|228898870|ref|ZP_04063152.1| 50S ribosomal protein L16 [Bacillus thuringiensis IBL 4222]
 gi|228905914|ref|ZP_04069811.1| 50S ribosomal protein L16 [Bacillus thuringiensis IBL 200]
 gi|228912856|ref|ZP_04076503.1| 50S ribosomal protein L16 [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|228919067|ref|ZP_04082446.1| 50S ribosomal protein L16 [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228925370|ref|ZP_04088466.1| 50S ribosomal protein L16 [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228931619|ref|ZP_04094525.1| 50S ribosomal protein L16 [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228943923|ref|ZP_04106308.1| 50S ribosomal protein L16 [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|228950665|ref|ZP_04112799.1| 50S ribosomal protein L16 [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
 gi|228956558|ref|ZP_04118354.1| 50S ribosomal protein L16 [Bacillus thuringiensis serovar pakistani
           str. T13001]
 gi|228963217|ref|ZP_04124386.1| 50S ribosomal protein L16 [Bacillus thuringiensis serovar sotto
           str. T04001]
 gi|228983372|ref|ZP_04143585.1| 50S ribosomal protein L16 [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|229009626|ref|ZP_04166852.1| 50S ribosomal protein L16 [Bacillus mycoides DSM 2048]
 gi|229015519|ref|ZP_04172517.1| 50S ribosomal protein L16 [Bacillus cereus AH1273]
 gi|229021728|ref|ZP_04178310.1| 50S ribosomal protein L16 [Bacillus cereus AH1272]
 gi|229027965|ref|ZP_04184118.1| 50S ribosomal protein L16 [Bacillus cereus AH1271]
 gi|229041022|ref|ZP_04189785.1| 50S ribosomal protein L16 [Bacillus cereus AH676]
 gi|229067882|ref|ZP_04201199.1| 50S ribosomal protein L16 [Bacillus cereus F65185]
 gi|229074178|ref|ZP_04207224.1| 50S ribosomal protein L16 [Bacillus cereus Rock4-18]
 gi|229077417|ref|ZP_04210069.1| 50S ribosomal protein L16 [Bacillus cereus Rock4-2]
 gi|229094839|ref|ZP_04225844.1| 50S ribosomal protein L16 [Bacillus cereus Rock3-29]
 gi|229100916|ref|ZP_04231720.1| 50S ribosomal protein L16 [Bacillus cereus Rock3-28]
 gi|229107803|ref|ZP_04237439.1| 50S ribosomal protein L16 [Bacillus cereus Rock1-15]
 gi|229113793|ref|ZP_04243228.1| 50S ribosomal protein L16 [Bacillus cereus Rock1-3]
 gi|229119779|ref|ZP_04249040.1| 50S ribosomal protein L16 [Bacillus cereus 95/8201]
 gi|229125634|ref|ZP_04254666.1| 50S ribosomal protein L16 [Bacillus cereus BDRD-Cer4]
 gi|229131125|ref|ZP_04260037.1| 50S ribosomal protein L16 [Bacillus cereus BDRD-ST196]
 gi|229142923|ref|ZP_04271364.1| 50S ribosomal protein L16 [Bacillus cereus BDRD-ST24]
 gi|229148526|ref|ZP_04276782.1| 50S ribosomal protein L16 [Bacillus cereus m1550]
 gi|229153895|ref|ZP_04282025.1| 50S ribosomal protein L16 [Bacillus cereus ATCC 4342]
 gi|229159290|ref|ZP_04287314.1| 50S ribosomal protein L16 [Bacillus cereus R309803]
 gi|229165105|ref|ZP_04292900.1| 50S ribosomal protein L16 [Bacillus cereus AH621]
 gi|229170968|ref|ZP_04298569.1| 50S ribosomal protein L16 [Bacillus cereus MM3]
 gi|229176717|ref|ZP_04304121.1| 50S ribosomal protein L16 [Bacillus cereus 172560W]
 gi|229182511|ref|ZP_04309762.1| 50S ribosomal protein L16 [Bacillus cereus BGSC 6E1]
 gi|229188402|ref|ZP_04315450.1| 50S ribosomal protein L16 [Bacillus cereus ATCC 10876]
 gi|229194507|ref|ZP_04321310.1| 50S ribosomal protein L16 [Bacillus cereus m1293]
 gi|229601054|ref|YP_002864768.1| 50S ribosomal protein L16 [Bacillus anthracis str. A0248]
 gi|254726304|ref|ZP_05188086.1| 50S ribosomal protein L16 [Bacillus anthracis str. A1055]
 gi|296500950|ref|YP_003662650.1| 50S ribosomal protein L16 [Bacillus thuringiensis BMB171]
 gi|300119570|ref|ZP_07057114.1| 50S ribosomal protein L16 [Bacillus cereus SJ1]
 gi|301051854|ref|YP_003790065.1| 50S ribosomal protein L16 [Bacillus anthracis CI]
 gi|81580838|sp|Q81J35|RL16_BACCR RecName: Full=50S ribosomal protein L16
 gi|81614033|sp|Q6HPQ1|RL16_BACHK RecName: Full=50S ribosomal protein L16
 gi|81689836|sp|Q63H83|RL16_BACCZ RecName: Full=50S ribosomal protein L16
 gi|81715491|sp|Q81VS3|RL16_BACAN RecName: Full=50S ribosomal protein L16
 gi|215274944|sp|A0R8I7|RL16_BACAH RecName: Full=50S ribosomal protein L16
 gi|226710675|sp|B7JKC6|RL16_BACC0 RecName: Full=50S ribosomal protein L16
 gi|226710676|sp|B7IT26|RL16_BACC2 RecName: Full=50S ribosomal protein L16
 gi|226710677|sp|B7HJ55|RL16_BACC4 RecName: Full=50S ribosomal protein L16
 gi|254799176|sp|C3P9R2|RL16_BACAA RecName: Full=50S ribosomal protein L16
 gi|254799177|sp|C3LJ89|RL16_BACAC RecName: Full=50S ribosomal protein L16
 gi|254799178|sp|C1ET46|RL16_BACC3 RecName: Full=50S ribosomal protein L16
 gi|29893927|gb|AAP07219.1| LSU ribosomal protein L16P [Bacillus cereus ATCC 14579]
 gi|30253629|gb|AAP24171.1| 50S ribosomal protein L16 [Bacillus anthracis str. Ames]
 gi|49177078|gb|AAT52454.1| ribosomal protein L16 [Bacillus anthracis str. Sterne]
 gi|49328275|gb|AAT58921.1| ribosomal protein L16 (50S ribosomal protein L16) [Bacillus
           thuringiensis serovar konkukian str. 97-27]
 gi|50082971|gb|AAT29197.2| ribosomal protein L16 [Bacillus anthracis str. 'Ames Ancestor']
 gi|51978570|gb|AAU20120.1| ribosomal protein L16 (50S ribosomal protein L16) [Bacillus cereus
           E33L]
 gi|206732777|gb|EDZ49952.1| 50S ribosomal protein L16 [Bacillus cereus AH1134]
 gi|218160352|gb|ACK60344.1| ribosomal protein L16 [Bacillus cereus B4264]
 gi|218538272|gb|ACK90670.1| ribosomal protein L16 [Bacillus cereus AH820]
 gi|218541419|gb|ACK93813.1| ribosomal protein L16 [Bacillus cereus G9842]
 gi|225788391|gb|ACO28608.1| 50S ribosomal protein L16 [Bacillus cereus 03BB102]
 gi|227005243|gb|ACP14986.1| 50S ribosomal protein L16 [Bacillus anthracis str. CDC 684]
 gi|228588973|gb|EEK46988.1| 50S ribosomal protein L16 [Bacillus cereus m1293]
 gi|228595076|gb|EEK52847.1| 50S ribosomal protein L16 [Bacillus cereus ATCC 10876]
 gi|228600966|gb|EEK58535.1| 50S ribosomal protein L16 [Bacillus cereus BGSC 6E1]
 gi|228606760|gb|EEK64177.1| 50S ribosomal protein L16 [Bacillus cereus 172560W]
 gi|228612508|gb|EEK69729.1| 50S ribosomal protein L16 [Bacillus cereus MM3]
 gi|228618368|gb|EEK75398.1| 50S ribosomal protein L16 [Bacillus cereus AH621]
 gi|228624182|gb|EEK80984.1| 50S ribosomal protein L16 [Bacillus cereus R309803]
 gi|228629576|gb|EEK86273.1| 50S ribosomal protein L16 [Bacillus cereus ATCC 4342]
 gi|228634942|gb|EEK91515.1| 50S ribosomal protein L16 [Bacillus cereus m1550]
 gi|228640544|gb|EEK96933.1| 50S ribosomal protein L16 [Bacillus cereus BDRD-ST24]
 gi|228652338|gb|EEL08263.1| 50S ribosomal protein L16 [Bacillus cereus BDRD-ST196]
 gi|228657826|gb|EEL13632.1| 50S ribosomal protein L16 [Bacillus cereus BDRD-Cer4]
 gi|228663680|gb|EEL19259.1| 50S ribosomal protein L16 [Bacillus cereus 95/8201]
 gi|228669664|gb|EEL25071.1| 50S ribosomal protein L16 [Bacillus cereus Rock1-3]
 gi|228675652|gb|EEL30860.1| 50S ribosomal protein L16 [Bacillus cereus Rock1-15]
 gi|228682495|gb|EEL36568.1| 50S ribosomal protein L16 [Bacillus cereus Rock3-28]
 gi|228688582|gb|EEL42455.1| 50S ribosomal protein L16 [Bacillus cereus Rock3-29]
 gi|228705893|gb|EEL58227.1| 50S ribosomal protein L16 [Bacillus cereus Rock4-2]
 gi|228708948|gb|EEL61075.1| 50S ribosomal protein L16 [Bacillus cereus Rock4-18]
 gi|228715241|gb|EEL67100.1| 50S ribosomal protein L16 [Bacillus cereus F65185]
 gi|228727319|gb|EEL78513.1| 50S ribosomal protein L16 [Bacillus cereus AH676]
 gi|228733353|gb|EEL84182.1| 50S ribosomal protein L16 [Bacillus cereus AH1271]
 gi|228739596|gb|EEL90010.1| 50S ribosomal protein L16 [Bacillus cereus AH1272]
 gi|228745806|gb|EEL95810.1| 50S ribosomal protein L16 [Bacillus cereus AH1273]
 gi|228751648|gb|EEM01448.1| 50S ribosomal protein L16 [Bacillus mycoides DSM 2048]
 gi|228776362|gb|EEM24715.1| 50S ribosomal protein L16 [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|228796475|gb|EEM43914.1| 50S ribosomal protein L16 [Bacillus thuringiensis serovar sotto
           str. T04001]
 gi|228803123|gb|EEM49945.1| 50S ribosomal protein L16 [Bacillus thuringiensis serovar pakistani
           str. T13001]
 gi|228809016|gb|EEM55501.1| 50S ribosomal protein L16 [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
 gi|228815756|gb|EEM61992.1| 50S ribosomal protein L16 [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|228828047|gb|EEM73775.1| 50S ribosomal protein L16 [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228834292|gb|EEM79833.1| 50S ribosomal protein L16 [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228840592|gb|EEM85854.1| 50S ribosomal protein L16 [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228846792|gb|EEM91797.1| 50S ribosomal protein L16 [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|228853729|gb|EEM98489.1| 50S ribosomal protein L16 [Bacillus thuringiensis IBL 200]
 gi|228860770|gb|EEN05148.1| 50S ribosomal protein L16 [Bacillus thuringiensis IBL 4222]
 gi|229265462|gb|ACQ47099.1| 50S ribosomal protein L16 [Bacillus anthracis str. A0248]
 gi|296322002|gb|ADH04930.1| 50S ribosomal protein L16 [Bacillus thuringiensis BMB171]
 gi|298723042|gb|EFI63940.1| 50S ribosomal protein L16 [Bacillus cereus SJ1]
 gi|300374023|gb|ADK02927.1| 50S ribosomal protein L16 [Bacillus cereus biovar anthracis str.
           CI]
          Length = 144

 Score =  194 bits (493), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 78/135 (57%), Positives = 98/135 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY ++ +G+++G AKGG+ I FG F L+AQ A+ I + +IEAARRA++R MKR
Sbjct: 1   MLMPKRVKYRREHRGKMRGRAKGGTEIAFGEFGLQAQAASWITNRQIEAARRAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP  P TAKP EVRMG GKG  E WV  VKPG+I+FEI GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPSKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKIMFEIAGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL V  KF++R 
Sbjct: 121 AAHKLPVKCKFVKRE 135


>gi|296533994|ref|ZP_06896510.1| 50S ribosomal protein L16 [Roseomonas cervicalis ATCC 49957]
 gi|296265660|gb|EFH11769.1| 50S ribosomal protein L16 [Roseomonas cervicalis ATCC 49957]
          Length = 140

 Score =  194 bits (493), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 86/134 (64%), Positives = 99/134 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ K  KGRIKGVAKGG  + FG F LKA E  R+ + +IEAARRAI+R MKR
Sbjct: 1   MLSPKRTKFRKAHKGRIKGVAKGGFTLSFGGFGLKALEPERVTARQIEAARRAITRAMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPD+PV+ KP EVRMG GKG  E WV RVKPGRI+FEIDGVS E AR A  L
Sbjct: 61  QGRVWIRIFPDLPVSTKPAEVRMGSGKGAPEYWVARVKPGRIMFEIDGVSLETAREALTL 120

Query: 122 GAAKLSVVTKFIQR 135
           GAAKL + TK + R
Sbjct: 121 GAAKLPIKTKLVTR 134


>gi|23014081|ref|ZP_00053918.1| COG0197: Ribosomal protein L16/L10E [Magnetospirillum
           magnetotacticum MS-1]
          Length = 138

 Score =  194 bits (493), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 85/137 (62%), Positives = 102/137 (74%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY K  KGRIKGV KGGS + FG + LKA E  RI + +IEAARRA++R MKR
Sbjct: 1   MLSPKRTKYRKAHKGRIKGVTKGGSALNFGAYGLKALEPERITARQIEAARRALTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPD+PV++KP EVRMG GKG  E W  RV PGRILFE+DGV+EE+AR  F L
Sbjct: 61  QGRVWIRIFPDLPVSSKPAEVRMGSGKGAPEFWTARVAPGRILFEVDGVAEEIARHGFAL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            AAKL + TKFI R+ +
Sbjct: 121 AAAKLPIKTKFISRIGD 137


>gi|11465773|ref|NP_053917.1| ribosomal protein L16 [Porphyra purpurea]
 gi|1710413|sp|P51307|RK16_PORPU RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|1276773|gb|AAC08193.1| 50S ribosomal protein L16 [Porphyra purpurea]
          Length = 139

 Score =  193 bits (492), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 70/134 (52%), Positives = 94/134 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ KQ +GR+KG A  G+ I FG++AL+A E   + S +IEA RR I+R ++R
Sbjct: 1   MLSPKKTKFRKQHRGRMKGSASKGNTIAFGDYALQATEPVWLTSRQIEATRRTITRYVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD PVTA+P E RMG GKG  E WV  +KPG ILFEI GV ++ A++A +L
Sbjct: 61  GGKLWIRVFPDKPVTARPAETRMGSGKGAPEYWVAVIKPGHILFEITGVPQKTAQQAMKL 120

Query: 122 GAAKLSVVTKFIQR 135
            + KL + TKFI R
Sbjct: 121 ASYKLPIKTKFIVR 134


>gi|319783327|ref|YP_004142803.1| ribosomal protein L16 [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317169215|gb|ADV12753.1| ribosomal protein L16 [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 137

 Score =  193 bits (492), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 98/137 (71%), Positives = 113/137 (82%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQFKGRI G AKGG+ + FG F LKA E NR+ + EIEAARRAI+R MKR
Sbjct: 1   MLQPKRTKFRKQFKGRIHGTAKGGTNLDFGGFGLKALEPNRVTAREIEAARRAITREMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AGRVWI +FPDVPVT+KPTEVRMGKGKG V+ W  RVKPGRI+FEIDGV+EE AR A RL
Sbjct: 61  AGRVWIRIFPDVPVTSKPTEVRMGKGKGAVDYWAARVKPGRIMFEIDGVNEETAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
           GAAKLSV T+F+QR+ E
Sbjct: 121 GAAKLSVKTRFVQRIAE 137


>gi|148243222|ref|YP_001228379.1| 50S ribosomal protein L16 [Synechococcus sp. RCC307]
 gi|166216120|sp|A5GVW7|RL16_SYNR3 RecName: Full=50S ribosomal protein L16
 gi|147851532|emb|CAK29026.1| 50S ribosomal protein L16 [Synechococcus sp. RCC307]
          Length = 154

 Score =  193 bits (492), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 71/137 (51%), Positives = 95/137 (69%), Gaps = 2/137 (1%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  K+ KQ +GR++G+A  G+ I FG FAL+AQE   I S +IEA+RRA++R  KR
Sbjct: 1   MLSPRRVKFRKQQRGRMRGIATRGNTIAFGTFALQAQECGWITSRQIEASRRAMTRYTKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDG--VSEEVARRAF 119
            G++WI +FPD PVT +  E RMG GKGN E WV  +KPGRILFEI G  ++EE+A+ A 
Sbjct: 61  GGKIWIRIFPDKPVTMRAAETRMGSGKGNPEFWVAVIKPGRILFEIGGPEITEELAKEAM 120

Query: 120 RLGAAKLSVVTKFIQRV 136
           RL   KL V TKF+ + 
Sbjct: 121 RLAQYKLPVKTKFLVKE 137


>gi|327438285|dbj|BAK14650.1| ribosomal protein L16/L10E [Solibacillus silvestris StLB046]
          Length = 144

 Score =  193 bits (492), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 70/135 (51%), Positives = 93/135 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY ++ +G ++G AKGG  + FG F L+A  A+ I + +IE+AR A++R MKR
Sbjct: 1   MLLPKRVKYRREHRGNMRGEAKGGKEVSFGEFGLQATTASWITNRQIESARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP  P T KP EVRMG GKG+ E WV  VKPG+++FEI GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPHKPYTKKPLEVRMGSGKGSPEGWVAVVKPGKVMFEIAGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL V  K ++R 
Sbjct: 121 ASHKLPVKCKIVKRQ 135


>gi|167645585|ref|YP_001683248.1| 50S ribosomal protein L16 [Caulobacter sp. K31]
 gi|189041450|sp|B0T2C9|RL16_CAUSK RecName: Full=50S ribosomal protein L16
 gi|167348015|gb|ABZ70750.1| ribosomal protein L16 [Caulobacter sp. K31]
          Length = 146

 Score =  193 bits (492), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 85/135 (62%), Positives = 104/135 (77%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY KQFKGRI G +KGG+ + FG++ LKA E  RI + +IEAARRAI+R MKR
Sbjct: 1   MLSPKKTKYRKQFKGRIHGTSKGGTLLNFGSYGLKAVEPERITARQIEAARRAITRQMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPDVPVT KP EVRMGKGKG V+ W  RV PGRI+FEIDGV +++AR A RL
Sbjct: 61  QGRVWIRIFPDVPVTGKPAEVRMGKGKGAVDHWAARVAPGRIMFEIDGVPDDIAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
           GAAKL + T+ + R+
Sbjct: 121 GAAKLPIRTRVVTRI 135


>gi|15925233|ref|NP_372767.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|15927823|ref|NP_375356.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus
           N315]
 gi|21283891|ref|NP_646979.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus MW2]
 gi|49484459|ref|YP_041683.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|49487025|ref|YP_044246.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|57650827|ref|YP_187042.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus COL]
 gi|82751832|ref|YP_417573.1| 50S ribosomal protein L16 [Staphylococcus aureus RF122]
 gi|87162332|ref|YP_494832.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|88196155|ref|YP_500972.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus NCTC
           8325]
 gi|148268683|ref|YP_001247626.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus JH9]
 gi|150394748|ref|YP_001317423.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus JH1]
 gi|151222357|ref|YP_001333179.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus str.
           Newman]
 gi|156980558|ref|YP_001442817.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus Mu3]
 gi|221140155|ref|ZP_03564648.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus str.
           JKD6009]
 gi|253317003|ref|ZP_04840216.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus str.
           CF-Marseille]
 gi|253729909|ref|ZP_04864074.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253734348|ref|ZP_04868513.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|255007023|ref|ZP_05145624.2| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus
           Mu50-omega]
 gi|257423728|ref|ZP_05600157.1| LSU ribosomal protein L16P [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257426406|ref|ZP_05602808.1| ribosomal protein L16 [Staphylococcus aureus subsp. aureus 65-1322]
 gi|257429045|ref|ZP_05605432.1| ribosomal protein L16 [Staphylococcus aureus subsp. aureus 68-397]
 gi|257431691|ref|ZP_05608054.1| ribosomal protein L16 [Staphylococcus aureus subsp. aureus E1410]
 gi|257434652|ref|ZP_05610703.1| LSU ribosomal protein L16 [Staphylococcus aureus subsp. aureus
           M876]
 gi|257794589|ref|ZP_05643568.1| 50S ribosomal protein L16 [Staphylococcus aureus A9781]
 gi|258408809|ref|ZP_05681093.1| 50S ribosomal protein L16 [Staphylococcus aureus A9763]
 gi|258422408|ref|ZP_05685320.1| LSU ribosomal protein L16 [Staphylococcus aureus A9719]
 gi|258422690|ref|ZP_05685595.1| LSU ribosomal protein L16 [Staphylococcus aureus A9635]
 gi|258439797|ref|ZP_05690543.1| LSU ribosomal protein L16P [Staphylococcus aureus A9299]
 gi|258442647|ref|ZP_05691207.1| ribosomal protein L16 [Staphylococcus aureus A8115]
 gi|258446654|ref|ZP_05694809.1| 50S ribosomal protein L16 [Staphylococcus aureus A6300]
 gi|258450228|ref|ZP_05698320.1| ribosomal protein L16 [Staphylococcus aureus A6224]
 gi|258450762|ref|ZP_05698821.1| ribosomal protein L16 [Staphylococcus aureus A5948]
 gi|258455400|ref|ZP_05703360.1| 50S ribosomal protein L16 [Staphylococcus aureus A5937]
 gi|262048507|ref|ZP_06021391.1| 50S ribosomal protein L16 [Staphylococcus aureus D30]
 gi|262052032|ref|ZP_06024243.1| 50S ribosomal protein L16 [Staphylococcus aureus 930918-3]
 gi|269203876|ref|YP_003283145.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus
           ED98]
 gi|282893681|ref|ZP_06301913.1| 50S ribosomal protein L16 [Staphylococcus aureus A8117]
 gi|282902146|ref|ZP_06310039.1| ribosomal protein L16 [Staphylococcus aureus subsp. aureus C160]
 gi|282906586|ref|ZP_06314434.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282909556|ref|ZP_06317367.1| ribosomal protein L16 [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282911803|ref|ZP_06319599.1| ribosomal protein L16 [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282915092|ref|ZP_06322869.1| ribosomal protein L16 [Staphylococcus aureus subsp. aureus M899]
 gi|282917588|ref|ZP_06325340.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus
           D139]
 gi|282920818|ref|ZP_06328536.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus
           C427]
 gi|282922112|ref|ZP_06329808.1| 50S ribosomal protein L16 [Staphylococcus aureus A9765]
 gi|282925723|ref|ZP_06333371.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus
           C101]
 gi|282926789|ref|ZP_06334416.1| 50S ribosomal protein L16 [Staphylococcus aureus A10102]
 gi|283767335|ref|ZP_06340250.1| large subunit ribosomal protein L16 [Staphylococcus aureus subsp.
           aureus H19]
 gi|283959021|ref|ZP_06376462.1| ribosomal protein L16 [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|284025269|ref|ZP_06379667.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus 132]
 gi|293497496|ref|ZP_06665350.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus
           58-424]
 gi|293511071|ref|ZP_06669768.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus
           M809]
 gi|293549677|ref|ZP_06672349.1| ribosomal protein L16 [Staphylococcus aureus subsp. aureus M1015]
 gi|294848776|ref|ZP_06789521.1| 50S ribosomal protein L16 [Staphylococcus aureus A9754]
 gi|295404919|ref|ZP_06814732.1| 50S ribosomal protein L16 [Staphylococcus aureus A8819]
 gi|295428826|ref|ZP_06821450.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|296275966|ref|ZP_06858473.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus MR1]
 gi|297209944|ref|ZP_06926340.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|297243977|ref|ZP_06927867.1| 50S ribosomal protein L16 [Staphylococcus aureus A8796]
 gi|297589688|ref|ZP_06948329.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus MN8]
 gi|300910956|ref|ZP_07128406.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|304379427|ref|ZP_07362162.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|81648831|sp|Q6G778|RL16_STAAS RecName: Full=50S ribosomal protein L16
 gi|81650583|sp|Q6GEJ0|RL16_STAAR RecName: Full=50S ribosomal protein L16
 gi|81693964|sp|Q5HDW5|RL16_STAAC RecName: Full=50S ribosomal protein L16
 gi|81704219|sp|Q7A080|RL16_STAAW RecName: Full=50S ribosomal protein L16
 gi|81705247|sp|Q7A461|RL16_STAAN RecName: Full=50S ribosomal protein L16
 gi|81781099|sp|Q99S28|RL16_STAAM RecName: Full=50S ribosomal protein L16
 gi|115502795|sp|Q2FEP6|RL16_STAA3 RecName: Full=50S ribosomal protein L16
 gi|115502796|sp|Q2FW13|RL16_STAA8 RecName: Full=50S ribosomal protein L16
 gi|115502797|sp|Q2YYQ3|RL16_STAAB RecName: Full=50S ribosomal protein L16
 gi|166216112|sp|A7X5F4|RL16_STAA1 RecName: Full=50S ribosomal protein L16
 gi|172049019|sp|A6QJ85|RL16_STAAE RecName: Full=50S ribosomal protein L16
 gi|189041486|sp|A6U3W8|RL16_STAA2 RecName: Full=50S ribosomal protein L16
 gi|189041487|sp|A5IV27|RL16_STAA9 RecName: Full=50S ribosomal protein L16
 gi|13702043|dbj|BAB43335.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus
           N315]
 gi|14248016|dbj|BAB58405.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|21205333|dbj|BAB96027.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus MW2]
 gi|49242588|emb|CAG41309.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|49245468|emb|CAG43945.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|57285013|gb|AAW37107.1| ribosomal protein L16 [Staphylococcus aureus subsp. aureus COL]
 gi|82657363|emb|CAI81804.1| 50S ribosomal protein L16 [Staphylococcus aureus RF122]
 gi|87128306|gb|ABD22820.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|87203713|gb|ABD31523.1| ribosomal protein L16 [Staphylococcus aureus subsp. aureus NCTC
           8325]
 gi|147741752|gb|ABQ50050.1| LSU ribosomal protein L16P [Staphylococcus aureus subsp. aureus
           JH9]
 gi|149947200|gb|ABR53136.1| ribosomal protein L16 [Staphylococcus aureus subsp. aureus JH1]
 gi|150375157|dbj|BAF68417.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus str.
           Newman]
 gi|156722693|dbj|BAF79110.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus Mu3]
 gi|253726356|gb|EES95085.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253727665|gb|EES96394.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|257272746|gb|EEV04848.1| LSU ribosomal protein L16P [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257276037|gb|EEV07488.1| ribosomal protein L16 [Staphylococcus aureus subsp. aureus 65-1322]
 gi|257279526|gb|EEV10113.1| ribosomal protein L16 [Staphylococcus aureus subsp. aureus 68-397]
 gi|257282570|gb|EEV12702.1| ribosomal protein L16 [Staphylococcus aureus subsp. aureus E1410]
 gi|257285248|gb|EEV15364.1| LSU ribosomal protein L16 [Staphylococcus aureus subsp. aureus
           M876]
 gi|257788561|gb|EEV26901.1| 50S ribosomal protein L16 [Staphylococcus aureus A9781]
 gi|257840492|gb|EEV64952.1| 50S ribosomal protein L16 [Staphylococcus aureus A9763]
 gi|257841839|gb|EEV66276.1| LSU ribosomal protein L16 [Staphylococcus aureus A9719]
 gi|257847101|gb|EEV71110.1| LSU ribosomal protein L16 [Staphylococcus aureus A9635]
 gi|257847573|gb|EEV71575.1| LSU ribosomal protein L16P [Staphylococcus aureus A9299]
 gi|257851768|gb|EEV75702.1| ribosomal protein L16 [Staphylococcus aureus A8115]
 gi|257854722|gb|EEV77670.1| 50S ribosomal protein L16 [Staphylococcus aureus A6300]
 gi|257856320|gb|EEV79229.1| ribosomal protein L16 [Staphylococcus aureus A6224]
 gi|257861545|gb|EEV84347.1| ribosomal protein L16 [Staphylococcus aureus A5948]
 gi|257862611|gb|EEV85379.1| 50S ribosomal protein L16 [Staphylococcus aureus A5937]
 gi|259160087|gb|EEW45120.1| 50S ribosomal protein L16 [Staphylococcus aureus 930918-3]
 gi|259163365|gb|EEW47923.1| 50S ribosomal protein L16 [Staphylococcus aureus D30]
 gi|262076166|gb|ACY12139.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus
           ED98]
 gi|269941832|emb|CBI50242.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus
           TW20]
 gi|282312552|gb|EFB42956.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus
           C101]
 gi|282315233|gb|EFB45617.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus
           C427]
 gi|282318550|gb|EFB48908.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus
           D139]
 gi|282320813|gb|EFB51147.1| ribosomal protein L16 [Staphylococcus aureus subsp. aureus M899]
 gi|282323499|gb|EFB53815.1| ribosomal protein L16 [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282326535|gb|EFB56837.1| ribosomal protein L16 [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282329485|gb|EFB59006.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282591240|gb|EFB96313.1| 50S ribosomal protein L16 [Staphylococcus aureus A10102]
 gi|282593580|gb|EFB98573.1| 50S ribosomal protein L16 [Staphylococcus aureus A9765]
 gi|282596605|gb|EFC01564.1| ribosomal protein L16 [Staphylococcus aureus subsp. aureus C160]
 gi|282763739|gb|EFC03867.1| 50S ribosomal protein L16 [Staphylococcus aureus A8117]
 gi|283461214|gb|EFC08298.1| large subunit ribosomal protein L16 [Staphylococcus aureus subsp.
           aureus H19]
 gi|283471465|emb|CAQ50676.1| ribosomal protein L16 [Staphylococcus aureus subsp. aureus ST398]
 gi|283788613|gb|EFC27440.1| ribosomal protein L16 [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|285817905|gb|ADC38392.1| 50S ribosomal protein L16 [Staphylococcus aureus 04-02981]
 gi|290918724|gb|EFD95800.1| ribosomal protein L16 [Staphylococcus aureus subsp. aureus M1015]
 gi|291096427|gb|EFE26685.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus
           58-424]
 gi|291466058|gb|EFF08587.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus
           M809]
 gi|294824155|gb|EFG40579.1| 50S ribosomal protein L16 [Staphylococcus aureus A9754]
 gi|294969864|gb|EFG45882.1| 50S ribosomal protein L16 [Staphylococcus aureus A8819]
 gi|295127175|gb|EFG56817.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|296885617|gb|EFH24554.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|297178755|gb|EFH38000.1| 50S ribosomal protein L16 [Staphylococcus aureus A8796]
 gi|297578199|gb|EFH96912.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus MN8]
 gi|298695499|gb|ADI98721.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus
           ED133]
 gi|300887936|gb|EFK83131.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|302333879|gb|ADL24072.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus
           JKD6159]
 gi|302752116|gb|ADL66293.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus str.
           JKD6008]
 gi|304341959|gb|EFM07863.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|312437346|gb|ADQ76417.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus
           TCH60]
 gi|312830592|emb|CBX35434.1| ribosomal protein L16 [Staphylococcus aureus subsp. aureus ECT-R 2]
 gi|315129677|gb|EFT85668.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus
           CGS03]
 gi|315193495|gb|EFU23891.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus
           CGS00]
 gi|315198227|gb|EFU28558.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus
           CGS01]
 gi|320140219|gb|EFW32078.1| ribosomal protein L16 [Staphylococcus aureus subsp. aureus MRSA131]
 gi|320143489|gb|EFW35270.1| ribosomal protein L16 [Staphylococcus aureus subsp. aureus MRSA177]
 gi|323440077|gb|EGA97792.1| 50S ribosomal protein L16 [Staphylococcus aureus O11]
 gi|323442751|gb|EGB00377.1| 50S ribosomal protein L16 [Staphylococcus aureus O46]
 gi|329314926|gb|AEB89339.1| 50S ribosomal protein L16 [Staphylococcus aureus subsp. aureus
           T0131]
 gi|329723521|gb|EGG60050.1| ribosomal protein L16 [Staphylococcus aureus subsp. aureus 21172]
 gi|329730400|gb|EGG66790.1| ribosomal protein L16 [Staphylococcus aureus subsp. aureus 21193]
 gi|329732007|gb|EGG68362.1| ribosomal protein L16 [Staphylococcus aureus subsp. aureus 21189]
          Length = 144

 Score =  193 bits (492), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 73/135 (54%), Positives = 93/135 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +Q + +  G +KGG+ + FG F L+A   + I S +IE+AR A++R MKR
Sbjct: 1   MLLPKRVKYRRQHRPKTTGRSKGGNYVTFGEFGLQATTTSWITSRQIESARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP  P T KP EVRMG GKG VE W+  VKPGRILFE+ GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPHTPYTKKPLEVRMGAGKGAVEGWIAVVKPGRILFEVAGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL V TKF++R 
Sbjct: 121 ASHKLPVKTKFVKRE 135


>gi|315497980|ref|YP_004086784.1| ribosomal protein l16 [Asticcacaulis excentricus CB 48]
 gi|315415992|gb|ADU12633.1| ribosomal protein L16 [Asticcacaulis excentricus CB 48]
          Length = 142

 Score =  193 bits (492), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 83/134 (61%), Positives = 101/134 (75%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY K FKGRI G AKGG  + FG++ LK  E  R+ + +IEAARRAI+R MKR
Sbjct: 1   MLLPKRTKYRKAFKGRIHGNAKGGYTLNFGSYGLKTVEPERLTARQIEAARRAITRQMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPD+PVT KP EVRMG GKG+V+ W  RV PGRILFEIDGV++++AR A RL
Sbjct: 61  QGRVWIRIFPDLPVTGKPAEVRMGSGKGSVDYWAARVAPGRILFEIDGVADDIAREALRL 120

Query: 122 GAAKLSVVTKFIQR 135
           GAAKL V T+ + R
Sbjct: 121 GAAKLPVRTRVVTR 134


>gi|256420666|ref|YP_003121319.1| ribosomal protein L16 [Chitinophaga pinensis DSM 2588]
 gi|256035574|gb|ACU59118.1| ribosomal protein L16 [Chitinophaga pinensis DSM 2588]
          Length = 139

 Score =  193 bits (492), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 77/134 (57%), Positives = 91/134 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGRIKG AK G+ I FG+F LKA E   I   +IEAAR A++R MKR
Sbjct: 1   MLQPKRTKHRKMHKGRIKGNAKRGAAISFGSFGLKALEPKWITDRQIEAARVALTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G VWI +FPD  +TAKP EVRMGKGKG  + W   VKPGRILFE DGV  +VA+ A  L
Sbjct: 61  EGNVWIRIFPDKSITAKPLEVRMGKGKGAPDHWAAVVKPGRILFEADGVPLQVAKEAMEL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL +  KF+ R
Sbjct: 121 AAQKLPIKVKFVVR 134


>gi|225376416|ref|ZP_03753637.1| hypothetical protein ROSEINA2194_02058 [Roseburia inulinivorans DSM
           16841]
 gi|225211792|gb|EEG94146.1| hypothetical protein ROSEINA2194_02058 [Roseburia inulinivorans DSM
           16841]
          Length = 145

 Score =  193 bits (492), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 67/134 (50%), Positives = 90/134 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQF+G + G A  G+++ +G + + A E   I +++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKHRKQFRGSMAGKATRGNKLTYGEYGIVAMEPCWIKANQIEAARVAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP+ PVT KP  VRMGKGKG +E WV  VKPGR+LFEI GV E+VAR A RL
Sbjct: 61  GGKVWIKIFPEKPVTHKPMGVRMGKGKGALEYWVAVVKPGRVLFEISGVPEDVAREALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL    K + R
Sbjct: 121 ATHKLPCKCKVVSR 134


>gi|229829422|ref|ZP_04455491.1| hypothetical protein GCWU000342_01512 [Shuttleworthia satelles DSM
           14600]
 gi|229791853|gb|EEP27967.1| hypothetical protein GCWU000342_01512 [Shuttleworthia satelles DSM
           14600]
          Length = 143

 Score =  193 bits (492), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 67/134 (50%), Positives = 88/134 (65%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQF+G + G A  G++I  G + L A E   I S++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKHRKQFRGTMTGKAMRGNKISNGEYGLVATEPCWIKSNQIEAARVAMTRYVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVTAKP E RMG GKG +E WV  VKPGR++FEI GV EE A+ A RL
Sbjct: 61  GGKIWIKIFPDKPVTAKPAETRMGSGKGALEYWVAVVKPGRVMFEISGVPEESAKEALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL    K + +
Sbjct: 121 AMHKLPCKCKIVSK 134


>gi|222148373|ref|YP_002549330.1| 50S ribosomal protein L16 [Agrobacterium vitis S4]
 gi|254799172|sp|B9JVP4|RL16_AGRVS RecName: Full=50S ribosomal protein L16
 gi|221735361|gb|ACM36324.1| 50S ribosomal protein L16 [Agrobacterium vitis S4]
          Length = 137

 Score =  193 bits (491), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 103/137 (75%), Positives = 117/137 (85%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TKY KQFKGRIKGVAKGG  + FG F LKA E NR+ + EIEAARRAI+R MKR
Sbjct: 1   MLQPKRTKYRKQFKGRIKGVAKGGFDLAFGEFGLKALEPNRVNAREIEAARRAITRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AGRVWI VFPDVPVTAKPTEVRMGKGKG+VE W C+VKPGR++FEIDGVSEE+AR A RL
Sbjct: 61  AGRVWIRVFPDVPVTAKPTEVRMGKGKGSVEYWACKVKPGRMMFEIDGVSEEIAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
           G+AKLSV T+F+QR+ E
Sbjct: 121 GSAKLSVKTRFVQRIAE 137


>gi|309812439|ref|ZP_07706194.1| ribosomal protein L16 [Dermacoccus sp. Ellin185]
 gi|308433744|gb|EFP57621.1| ribosomal protein L16 [Dermacoccus sp. Ellin185]
          Length = 139

 Score =  193 bits (491), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 64/135 (47%), Positives = 93/135 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  K+ KQ   +  G AKGG+++ FG++ ++A E   + + +IE+AR A++R MKR
Sbjct: 1   MLIPRRVKHRKQHHPKRSGTAKGGTQVTFGDYGIQALEPAYVTNRQIESARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI ++PD P+T KP E RMG GKG+ E WV  VKPGR++FE++GVSEEVAR A RL
Sbjct: 61  GGKVWINIYPDRPLTKKPAETRMGSGKGSPEWWVANVKPGRVMFEVNGVSEEVAREAMRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  +F+ R 
Sbjct: 121 AMHKLPMKCRFVARE 135


>gi|290487902|gb|ADD30335.1| ribosomal protein L16 [Gunnera manicata]
          Length = 135

 Score =  193 bits (491), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 68/132 (51%), Positives = 95/132 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+RICFG +AL+A E   I S +IEA RRAI+R  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGISYRGNRICFGRYALQALEPTWITSRQIEAGRRAITRHARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD P+T +P E RMG GKG+ E WV  VKPGRIL+E+ GV+E  AR A  L
Sbjct: 61  GGKIWVRIFPDKPITVRPAETRMGSGKGSPEYWVAVVKPGRILYEMGGVTENAAREAISL 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+FI
Sbjct: 121 AASKMPIRTQFI 132


>gi|78185529|ref|YP_377963.1| 50S ribosomal protein L16 [Synechococcus sp. CC9902]
 gi|115504860|sp|Q3AUW9|RL16_SYNS9 RecName: Full=50S ribosomal protein L16
 gi|78169823|gb|ABB26920.1| LSU ribosomal protein L16P [Synechococcus sp. CC9902]
          Length = 158

 Score =  193 bits (491), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 72/134 (53%), Positives = 94/134 (70%), Gaps = 2/134 (1%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQ +GR++GVA  G+ I FG FAL+AQE   I S +IEA+RRA++R +KR
Sbjct: 1   MLSPKRVKFRKQQRGRMRGVATRGNTIAFGEFALQAQECGWITSRQIEASRRAMTRYVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDG--VSEEVARRAF 119
            G++WI +FPD PVT +  E RMG GKGN E WV  +KPGRILFE+ G  ++ E+A+ A 
Sbjct: 61  GGKIWIRIFPDKPVTMRAAETRMGSGKGNPEFWVAVIKPGRILFEMGGEEITPEIAKEAM 120

Query: 120 RLGAAKLSVVTKFI 133
           RL   KL V TKFI
Sbjct: 121 RLAQYKLPVKTKFI 134


>gi|256827407|ref|YP_003151366.1| 50S ribosomal protein L16P [Cryptobacterium curtum DSM 15641]
 gi|256583550|gb|ACU94684.1| LSU ribosomal protein L16P [Cryptobacterium curtum DSM 15641]
          Length = 140

 Score =  193 bits (491), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 71/137 (51%), Positives = 91/137 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ K  +G +KG AKGG+R+  G + ++A EA+ I + +IEAAR AI+R MKR
Sbjct: 1   MLVPKRVKHRKVQRGSMKGRAKGGTRLNHGEWGIQALEAHWITNRQIEAARVAITRQMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G VWI +FPD P+T+KP E RMG GKGN E WV  VKPGRI+FEI GV E  A+ A RL
Sbjct: 61  GGHVWITIFPDKPITSKPAETRMGSGKGNPEGWVAVVKPGRIMFEIGGVDEATAKEACRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
              KL +  K + R  E
Sbjct: 121 AINKLPIKCKIVTRETE 137


>gi|316933534|ref|YP_004108516.1| 50S ribosomal protein L16 [Rhodopseudomonas palustris DX-1]
 gi|315601248|gb|ADU43783.1| ribosomal protein L16 [Rhodopseudomonas palustris DX-1]
          Length = 137

 Score =  193 bits (491), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 82/137 (59%), Positives = 104/137 (75%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGRI GVA  G+ + FG F LKA E  RI + +IEAARRA++R MKR
Sbjct: 1   MMQPKRTKFRKAHKGRIHGVASSGATLAFGQFGLKAMEPERITARQIEAARRALTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AGRVWI +FPD+PV+ KP EVRMG GKG+ E WV RVKPGR++FEIDGV++++AR A  L
Sbjct: 61  AGRVWIRIFPDLPVSKKPAEVRMGSGKGSPELWVARVKPGRVMFEIDGVNQQIAREALTL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            AAKL + T+F+ R+ E
Sbjct: 121 AAAKLPIKTRFVARIAE 137


>gi|224179522|ref|YP_002601056.1| ribosomal protein L16 [Monomastix sp. OKE-1]
 gi|217314565|gb|ACK36908.1| ribosomal protein L16 [Monomastix sp. OKE-1]
          Length = 138

 Score =  193 bits (491), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 66/137 (48%), Positives = 91/137 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY K  +GR+KG A  G++I +G FAL+A E   + S +IEA RR I+R  KR
Sbjct: 1   MLSPKRTKYRKHHRGRMKGQASRGNKIAYGTFALQALEPGWLTSRQIEAGRRTITRYAKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD P+T +P E RMG GKG+ E WV  +KPGRIL+E++GV   +A+ A R 
Sbjct: 61  GGKLWIRVFPDKPITMRPAETRMGSGKGSPEYWVAVIKPGRILYEMNGVPLTLAKEAMRN 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            + K+ V T F+  + E
Sbjct: 121 ASYKMPVKTTFLTTITE 137


>gi|83949787|ref|ZP_00958520.1| ribosomal protein L16 [Roseovarius nubinhibens ISM]
 gi|83837686|gb|EAP76982.1| ribosomal protein L16 [Roseovarius nubinhibens ISM]
          Length = 137

 Score =  193 bits (491), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 84/135 (62%), Positives = 106/135 (78%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGRIKG AKGGS + FG+F LKA +  R+ + +IEAARRA++R MKR
Sbjct: 1   MLQPKRTKFRKMHKGRIKGQAKGGSDLNFGSFGLKATQPERVTARQIEAARRAMTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPD PVT+KPTEVRMGKGKG+V+ W C+VKPGR++FEIDGV+E+VA  A RL
Sbjct: 61  QGRVWIRIFPDTPVTSKPTEVRMGKGKGSVDFWACKVKPGRVMFEIDGVAEDVALEALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL + T+ +QR 
Sbjct: 121 AAMKLPIKTRVVQRE 135


>gi|319789245|ref|YP_004150878.1| ribosomal protein L16 [Thermovibrio ammonificans HB-1]
 gi|317113747|gb|ADU96237.1| ribosomal protein L16 [Thermovibrio ammonificans HB-1]
          Length = 142

 Score =  193 bits (491), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 69/135 (51%), Positives = 96/135 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+ TKY KQ +GR+KG +  G+R+ FG++ ++A E + + +++IEAAR AI+R MKR
Sbjct: 1   MLMPRRTKYRKQQRGRLKGKSYRGNRLAFGDYGIQALEPHYVTTNQIEAARVAITRTMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P T KP E RMGKGKGNVE WV +V PGRI+FE+ GV E+VA  A RL
Sbjct: 61  GGKVWIRIFPDKPYTKKPLETRMGKGKGNVETWVAKVLPGRIMFEVAGVPEDVAMEALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  + ++R 
Sbjct: 121 AIHKLPMKCRIVKRE 135


>gi|312889360|ref|ZP_07748914.1| LSU ribosomal protein L16P [Mucilaginibacter paludis DSM 18603]
 gi|311298237|gb|EFQ75352.1| LSU ribosomal protein L16P [Mucilaginibacter paludis DSM 18603]
          Length = 140

 Score =  193 bits (491), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 78/134 (58%), Positives = 97/134 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGR+ G+A  G+ + FG+F +K+ EA  I S +IEAAR A++R MKR
Sbjct: 1   MLQPKRTKFRKMQKGRMNGLASRGAELSFGSFGIKSLEAAWITSRQIEAARIAVTRFMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT KP EVRMGKGKG  E WV  V+PGRI+FE +GVS E A+ A RL
Sbjct: 61  EGQVWIRIFPDKPVTKKPAEVRMGKGKGAPEYWVAVVRPGRIIFEAEGVSLETAKEALRL 120

Query: 122 GAAKLSVVTKFIQR 135
            AAKL V TKF+ R
Sbjct: 121 AAAKLPVQTKFVLR 134


>gi|294675863|ref|YP_003576478.1| 50S ribosomal protein L16 [Rhodobacter capsulatus SB 1003]
 gi|294474683|gb|ADE84071.1| 50S ribosomal protein L16 [Rhodobacter capsulatus SB 1003]
          Length = 137

 Score =  193 bits (491), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 89/135 (65%), Positives = 107/135 (79%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQ KGRI G AKGG  + FG+FALKA E  R+ + +IEAARRAI+R MKR
Sbjct: 1   MLQPKRTKFRKQHKGRIHGEAKGGFNLNFGSFALKATEPERVTARQIEAARRAITRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI VFPDVPVT+KPTEVRMGKGKG+V+ W C+VKPGRI+FEIDGV + +AR A RL
Sbjct: 61  QGRVWIRVFPDVPVTSKPTEVRMGKGKGSVDFWACKVKPGRIMFEIDGVPDAIAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
           GA KL V+T+ + R 
Sbjct: 121 GANKLPVMTRIVARE 135


>gi|218135274|ref|ZP_03464078.1| hypothetical protein BACPEC_03179 [Bacteroides pectinophilus ATCC
           43243]
 gi|217990659|gb|EEC56670.1| hypothetical protein BACPEC_03179 [Bacteroides pectinophilus ATCC
           43243]
          Length = 145

 Score =  193 bits (491), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 68/134 (50%), Positives = 90/134 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +QF+G + G A  G++I  G + + A E   I S++IEAAR A++R +KR
Sbjct: 1   MLLPKRVKYRRQFRGSMAGKATRGNKISNGEYGIVAMEPCWIKSNQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+V+I +FPD PVT KP  VRMGKGKGN+E WV  VKPGR++FEI GV E+VA+ A RL
Sbjct: 61  GGKVFIKIFPDKPVTQKPIGVRMGKGKGNLEYWVAVVKPGRVMFEISGVPEDVAKEALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL    K + R
Sbjct: 121 ATHKLPCKCKIVSR 134


>gi|146340064|ref|YP_001205112.1| 50S ribosomal protein L16 [Bradyrhizobium sp. ORS278]
 gi|166234551|sp|A4YSJ9|RL16_BRASO RecName: Full=50S ribosomal protein L16
 gi|146192870|emb|CAL76875.1| 50S ribosomal subunit protein L16 [Bradyrhizobium sp. ORS278]
          Length = 137

 Score =  193 bits (491), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 83/137 (60%), Positives = 105/137 (76%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGRI GVA  G+ + FG F LKA E +R+ + +IEAARRA++R MKR
Sbjct: 1   MMQPKKTKFRKAHKGRIHGVASSGATLAFGQFGLKAMEPDRVTARQIEAARRALTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AGRVWI VFPD+PV+ KP EVRMG GKG+ E WV RVKPGR++FEIDGVS ++AR A  L
Sbjct: 61  AGRVWIRVFPDLPVSKKPAEVRMGSGKGSPELWVARVKPGRVMFEIDGVSNQIAREALTL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            AAKL + T+F++R+ E
Sbjct: 121 AAAKLPIKTRFVERIAE 137


>gi|238922837|ref|YP_002936350.1| 50S ribosomal protein L16 [Eubacterium rectale ATCC 33656]
 gi|259645650|sp|C4ZBS6|RL16_EUBR3 RecName: Full=50S ribosomal protein L16
 gi|238874509|gb|ACR74216.1| 50S ribosomal protein L16 [Eubacterium rectale ATCC 33656]
 gi|291523739|emb|CBK89326.1| LSU ribosomal protein L16P [Eubacterium rectale DSM 17629]
 gi|291528795|emb|CBK94381.1| LSU ribosomal protein L16P [Eubacterium rectale M104/1]
          Length = 145

 Score =  193 bits (491), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 67/134 (50%), Positives = 89/134 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQF+G + G A  G++I  G + + A E   I +++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKHRKQFRGSMAGKATRGNKITNGEYGIVALEPCWIKANQIEAARVAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP+ PVT KP  VRMGKGKG +E WV  VKPGR+LFEI GV E+VA+ A RL
Sbjct: 61  GGKVWIKIFPEKPVTHKPMGVRMGKGKGALEYWVAVVKPGRVLFEISGVPEDVAKEALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL    K + R
Sbjct: 121 ATHKLPCKCKVVSR 134


>gi|13470558|ref|NP_102127.1| 50S ribosomal protein L16 [Mesorhizobium loti MAFF303099]
 gi|75544193|sp|Q98N50|RL16_RHILO RecName: Full=50S ribosomal protein L16
 gi|14021300|dbj|BAB47913.1| 50S ribosomal protein L16 [Mesorhizobium loti MAFF303099]
          Length = 137

 Score =  193 bits (491), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 98/137 (71%), Positives = 113/137 (82%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQFKGRI G AKGG+ + FG F LKA E NR+ + EIEAARRAI+R MKR
Sbjct: 1   MLQPKRTKFRKQFKGRIHGTAKGGTNLDFGGFGLKALEPNRVTAREIEAARRAITREMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AGRVWI +FPD+PVT+KPTEVRMGKGKG V+ W  RVKPGRI+FEIDGVSEE AR A RL
Sbjct: 61  AGRVWIRIFPDLPVTSKPTEVRMGKGKGAVDYWAARVKPGRIMFEIDGVSEETAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
           GAAKLSV T+F+QR+ E
Sbjct: 121 GAAKLSVRTRFVQRIAE 137


>gi|325104861|ref|YP_004274515.1| LSU ribosomal protein L16P [Pedobacter saltans DSM 12145]
 gi|324973709|gb|ADY52693.1| LSU ribosomal protein L16P [Pedobacter saltans DSM 12145]
          Length = 140

 Score =  193 bits (491), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 77/134 (57%), Positives = 96/134 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGR+KG+A  G+ + FG+F +K+ E   I S +IEAAR A++R MKR
Sbjct: 1   MLQPKRTKFRKMQKGRMKGLATRGAELAFGSFGIKSMEECWITSRQIEAARIAVTRFMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT KP EVRMGKGKG  E WV  V+PGRILFE +GV  E+A+ A RL
Sbjct: 61  EGQVWIRIFPDKPVTKKPAEVRMGKGKGAPEYWVAVVRPGRILFEAEGVPYEIAKEAMRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL V TKF+ R
Sbjct: 121 AAQKLPVQTKFVVR 134


>gi|308233859|ref|ZP_07664596.1| LSU ribosomal protein L16P [Atopobium vaginae DSM 15829]
 gi|328943567|ref|ZP_08241032.1| 50S ribosomal protein L16 [Atopobium vaginae DSM 15829]
 gi|327491536|gb|EGF23310.1| 50S ribosomal protein L16 [Atopobium vaginae DSM 15829]
          Length = 141

 Score =  193 bits (491), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 73/134 (54%), Positives = 95/134 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK   + K  +G +KG AKG + + FG++ L+A EA+ I + +IEAAR AI+R MKR
Sbjct: 1   MLAPKRVLHRKVQRGSMKGHAKGNTELHFGSYGLQALEAHWITNRQIEAARIAITRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPD P++ KP E RMG GKGN E+WV  VKPGRI+FEIDGVSEEVA+ A RL
Sbjct: 61  GGRVWITIFPDKPISKKPAETRMGSGKGNPEEWVAVVKPGRIMFEIDGVSEEVAKEALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              K+ + TK + R
Sbjct: 121 AQHKMPIKTKVVAR 134


>gi|83312222|ref|YP_422486.1| 50S ribosomal protein L16 [Magnetospirillum magneticum AMB-1]
 gi|115502759|sp|Q2W2J8|RL16_MAGMM RecName: Full=50S ribosomal protein L16
 gi|82947063|dbj|BAE51927.1| Ribosomal protein L16/L10E [Magnetospirillum magneticum AMB-1]
          Length = 138

 Score =  193 bits (491), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 84/137 (61%), Positives = 102/137 (74%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ K  KGRIKGV KGGS + FG + LKA E  RI + +IEAARRA++R MKR
Sbjct: 1   MLSPKRTKFRKAHKGRIKGVTKGGSALNFGAYGLKALEPERITARQIEAARRALTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPD+PV++KP EVRMG GKG  E W  RV PGRILFE+DGV+EE+AR  F L
Sbjct: 61  QGRVWIRIFPDLPVSSKPAEVRMGSGKGAPEFWTARVAPGRILFEVDGVAEEIARHGFAL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            AAKL + TKFI R+ +
Sbjct: 121 AAAKLPIKTKFISRIGD 137


>gi|114570338|ref|YP_757018.1| 50S ribosomal protein L16 [Maricaulis maris MCS10]
 gi|122315790|sp|Q0ANQ7|RL16_MARMM RecName: Full=50S ribosomal protein L16
 gi|114340800|gb|ABI66080.1| LSU ribosomal protein L16P [Maricaulis maris MCS10]
          Length = 137

 Score =  193 bits (491), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 88/137 (64%), Positives = 105/137 (76%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGRIKG AKGG  + FG++ LKA +  R+ + +IEA RRAI+R MKR
Sbjct: 1   MLQPKRTKFRKAHKGRIKGAAKGGFTLNFGSYGLKALQPERVTARQIEATRRAITRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AGRVWI +FPDVPV+ KPTEVRMGKGKG+ E W C+VKPGRI+FEIDGV E VAR A  L
Sbjct: 61  AGRVWIRIFPDVPVSKKPTEVRMGKGKGSPEFWACKVKPGRIMFEIDGVPENVAREALEL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
           GAAKL V TK + R+ E
Sbjct: 121 GAAKLPVKTKIVARLGE 137


>gi|206889523|ref|YP_002249238.1| ribosomal protein L16 [Thermodesulfovibrio yellowstonii DSM 11347]
 gi|226712370|sp|B5YG40|RL16_THEYD RecName: Full=50S ribosomal protein L16
 gi|206741461|gb|ACI20518.1| ribosomal protein L16 [Thermodesulfovibrio yellowstonii DSM 11347]
          Length = 139

 Score =  193 bits (491), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 72/135 (53%), Positives = 91/135 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ K  KGR+ G+A  GS + FG + LK  E   I + +IEAAR AI R  K+
Sbjct: 1   MLAPKKVKFRKMQKGRMNGIAYRGSTVSFGEYGLKVLEPAWITARQIEAARVAIMRHAKK 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
             ++WI +FPD P+T KP E RMGKGKGN E WV  VKPGRILFE+ GVSEE+A+ AF L
Sbjct: 61  GCKLWIRIFPDKPITRKPAETRMGKGKGNPEFWVAVVKPGRILFELSGVSEEIAKEAFEL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL V TKF++R 
Sbjct: 121 ASHKLPVKTKFVKRQ 135


>gi|313891591|ref|ZP_07825201.1| ribosomal protein L16 [Dialister microaerophilus UPII 345-E]
 gi|329121835|ref|ZP_08250450.1| 50S ribosomal protein L16 [Dialister micraerophilus DSM 19965]
 gi|313120050|gb|EFR43232.1| ribosomal protein L16 [Dialister microaerophilus UPII 345-E]
 gi|327467773|gb|EGF13265.1| 50S ribosomal protein L16 [Dialister micraerophilus DSM 19965]
          Length = 141

 Score =  193 bits (490), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 69/137 (50%), Positives = 93/137 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY KQF+GR+KG  + G+ + +G + L A E + I S +IEAAR A++R  KR
Sbjct: 1   MLIPKRTKYRKQFRGRMKGRDRRGNTVTYGEYGLVAMEPSWITSRQIEAARIAMTRYTKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVTAKP   R G GKG+VE WV  V+PGR++FEI G+ E +A+ A RL
Sbjct: 61  GGKVWIKIFPDKPVTAKPIGTRQGSGKGSVEYWVAVVRPGRVMFEIGGIPEAMAKEALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
              KL + TKF+ +  E
Sbjct: 121 AGHKLPIKTKFVVKGQE 137


>gi|146329501|ref|YP_001210144.1| 50S ribosomal protein L16 [Dichelobacter nodosus VCS1703A]
 gi|166234577|sp|A5EX92|RL16_DICNV RecName: Full=50S ribosomal protein L16
 gi|146232971|gb|ABQ13949.1| 50S ribosomal protein L16 [Dichelobacter nodosus VCS1703A]
          Length = 137

 Score =  193 bits (490), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 81/136 (59%), Positives = 104/136 (76%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQ KGR +G+A+ G+ + FG++ LKA    R+ + +IEAARRAI+R +KR
Sbjct: 1   MLQPKRTKFRKQQKGRNRGLAQSGNTVSFGDYGLKATTRGRLTARQIEAARRAINRHVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI VFPDVPVT KP EVR GKGKGNVE WV +V+PG +L+E++GV+EE+AR AFRL
Sbjct: 61  GGKVWIRVFPDVPVTNKPLEVRQGKGKGNVEYWVAKVQPGTVLYEMEGVTEELAREAFRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL V T F  R V
Sbjct: 121 AAAKLPVQTTFEYRKV 136


>gi|145219068|ref|YP_001129777.1| 50S ribosomal protein L16 [Prosthecochloris vibrioformis DSM 265]
 gi|189041474|sp|A4SCR6|RL16_PROVI RecName: Full=50S ribosomal protein L16
 gi|145205232|gb|ABP36275.1| LSU ribosomal protein L16P [Chlorobium phaeovibrioides DSM 265]
          Length = 139

 Score =  193 bits (490), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 74/134 (55%), Positives = 92/134 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY K  +GR+KG A  G+ + FG+F LKA E   I S +IEAAR A++R MKR
Sbjct: 1   MLMPKRVKYRKTQRGRMKGNAGRGTDVSFGSFGLKAIEPAWITSRQIEAARVAMNRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PV+ K  E RMG GKG  E WV  VKPGRI+FE DGVS+E+A  AFRL
Sbjct: 61  DGKIWIRIFPDKPVSKKAAETRMGSGKGAPEFWVAVVKPGRIMFEADGVSKEIATEAFRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + T+FI R
Sbjct: 121 AAKKLPIKTRFIVR 134


>gi|260468547|ref|ZP_05813714.1| ribosomal protein L16 [Mesorhizobium opportunistum WSM2075]
 gi|259028703|gb|EEW30012.1| ribosomal protein L16 [Mesorhizobium opportunistum WSM2075]
          Length = 137

 Score =  193 bits (490), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 98/137 (71%), Positives = 113/137 (82%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQFKGRI G AKGG+ + FG F LKA E NR+ + EIEAARRAI+R MKR
Sbjct: 1   MLQPKRTKFRKQFKGRIHGTAKGGTNLDFGGFGLKALEPNRVTAREIEAARRAITREMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AGRVWI +FPDVPVT+KPTEVRMGKGKG V+ W  RVKPGRI+FEIDGV+EE AR A RL
Sbjct: 61  AGRVWIRIFPDVPVTSKPTEVRMGKGKGAVDYWAARVKPGRIMFEIDGVNEETAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
           GAAKLSV T+F+QR+ E
Sbjct: 121 GAAKLSVRTRFVQRIAE 137


>gi|282855201|ref|ZP_06264533.1| ribosomal protein L16 [Propionibacterium acnes J139]
 gi|282581789|gb|EFB87174.1| ribosomal protein L16 [Propionibacterium acnes J139]
 gi|314924178|gb|EFS88009.1| ribosomal protein L16 [Propionibacterium acnes HL001PA1]
 gi|314965088|gb|EFT09187.1| ribosomal protein L16 [Propionibacterium acnes HL082PA2]
 gi|314982258|gb|EFT26351.1| ribosomal protein L16 [Propionibacterium acnes HL110PA3]
 gi|315090445|gb|EFT62421.1| ribosomal protein L16 [Propionibacterium acnes HL110PA4]
 gi|315093680|gb|EFT65656.1| ribosomal protein L16 [Propionibacterium acnes HL060PA1]
 gi|315103974|gb|EFT75950.1| ribosomal protein L16 [Propionibacterium acnes HL050PA2]
 gi|327326705|gb|EGE68491.1| ribosomal protein L16 [Propionibacterium acnes HL103PA1]
          Length = 139

 Score =  193 bits (490), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 64/135 (47%), Positives = 89/135 (65%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  KY KQ   +  G AKGG+++ FG++ ++A E   + + +IEAAR A++R +KR
Sbjct: 1   MLIPRRVKYRKQHHPKRTGAAKGGTQLAFGDYGIQATEGGYLTNRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI V+PD P+T  P E RMG GKG  E W+  +KPGR+LFE+ GV EEVAR A RL
Sbjct: 61  GGKVWINVYPDRPMTKHPAESRMGSGKGTPEWWIANIKPGRVLFELSGVPEEVAREAMRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  +FI R 
Sbjct: 121 AIHKLPMKARFISRE 135


>gi|50843311|ref|YP_056538.1| 50S ribosomal protein L16 [Propionibacterium acnes KPA171202]
 gi|289424785|ref|ZP_06426567.1| ribosomal protein L16 [Propionibacterium acnes SK187]
 gi|289427705|ref|ZP_06429417.1| ribosomal protein L16 [Propionibacterium acnes J165]
 gi|295131380|ref|YP_003582043.1| ribosomal protein L16 [Propionibacterium acnes SK137]
 gi|81611204|sp|Q6A6N3|RL16_PROAC RecName: Full=50S ribosomal protein L16
 gi|50840913|gb|AAT83580.1| 50S ribosomal protein L16 [Propionibacterium acnes KPA171202]
 gi|289154748|gb|EFD03431.1| ribosomal protein L16 [Propionibacterium acnes SK187]
 gi|289159196|gb|EFD07388.1| ribosomal protein L16 [Propionibacterium acnes J165]
 gi|291375395|gb|ADD99249.1| ribosomal protein L16 [Propionibacterium acnes SK137]
 gi|313763231|gb|EFS34595.1| ribosomal protein L16 [Propionibacterium acnes HL013PA1]
 gi|313773090|gb|EFS39056.1| ribosomal protein L16 [Propionibacterium acnes HL074PA1]
 gi|313793265|gb|EFS41323.1| ribosomal protein L16 [Propionibacterium acnes HL110PA1]
 gi|313801091|gb|EFS42359.1| ribosomal protein L16 [Propionibacterium acnes HL110PA2]
 gi|313808832|gb|EFS47286.1| ribosomal protein L16 [Propionibacterium acnes HL087PA2]
 gi|313810374|gb|EFS48088.1| ribosomal protein L16 [Propionibacterium acnes HL083PA1]
 gi|313812290|gb|EFS50004.1| ribosomal protein L16 [Propionibacterium acnes HL025PA1]
 gi|313816567|gb|EFS54281.1| ribosomal protein L16 [Propionibacterium acnes HL059PA1]
 gi|313818012|gb|EFS55726.1| ribosomal protein L16 [Propionibacterium acnes HL046PA2]
 gi|313819925|gb|EFS57639.1| ribosomal protein L16 [Propionibacterium acnes HL036PA1]
 gi|313823415|gb|EFS61129.1| ribosomal protein L16 [Propionibacterium acnes HL036PA2]
 gi|313824887|gb|EFS62601.1| ribosomal protein L16 [Propionibacterium acnes HL063PA1]
 gi|313828371|gb|EFS66085.1| ribosomal protein L16 [Propionibacterium acnes HL063PA2]
 gi|313830129|gb|EFS67843.1| ribosomal protein L16 [Propionibacterium acnes HL007PA1]
 gi|313832600|gb|EFS70314.1| ribosomal protein L16 [Propionibacterium acnes HL056PA1]
 gi|313837956|gb|EFS75670.1| ribosomal protein L16 [Propionibacterium acnes HL086PA1]
 gi|314914339|gb|EFS78170.1| ribosomal protein L16 [Propionibacterium acnes HL005PA4]
 gi|314917659|gb|EFS81490.1| ribosomal protein L16 [Propionibacterium acnes HL050PA1]
 gi|314919609|gb|EFS83440.1| ribosomal protein L16 [Propionibacterium acnes HL050PA3]
 gi|314925781|gb|EFS89612.1| ribosomal protein L16 [Propionibacterium acnes HL036PA3]
 gi|314930200|gb|EFS94031.1| ribosomal protein L16 [Propionibacterium acnes HL067PA1]
 gi|314957193|gb|EFT01297.1| ribosomal protein L16 [Propionibacterium acnes HL027PA1]
 gi|314957769|gb|EFT01872.1| ribosomal protein L16 [Propionibacterium acnes HL002PA1]
 gi|314960861|gb|EFT04962.1| ribosomal protein L16 [Propionibacterium acnes HL002PA2]
 gi|314963535|gb|EFT07635.1| ribosomal protein L16 [Propionibacterium acnes HL082PA1]
 gi|314969882|gb|EFT13980.1| ribosomal protein L16 [Propionibacterium acnes HL037PA1]
 gi|314973022|gb|EFT17118.1| ribosomal protein L16 [Propionibacterium acnes HL053PA1]
 gi|314975518|gb|EFT19613.1| ribosomal protein L16 [Propionibacterium acnes HL045PA1]
 gi|314979740|gb|EFT23834.1| ribosomal protein L16 [Propionibacterium acnes HL072PA2]
 gi|314984894|gb|EFT28986.1| ribosomal protein L16 [Propionibacterium acnes HL005PA1]
 gi|314986060|gb|EFT30152.1| ribosomal protein L16 [Propionibacterium acnes HL005PA2]
 gi|314988676|gb|EFT32767.1| ribosomal protein L16 [Propionibacterium acnes HL005PA3]
 gi|315077158|gb|EFT49225.1| ribosomal protein L16 [Propionibacterium acnes HL053PA2]
 gi|315079843|gb|EFT51819.1| ribosomal protein L16 [Propionibacterium acnes HL078PA1]
 gi|315083211|gb|EFT55187.1| ribosomal protein L16 [Propionibacterium acnes HL027PA2]
 gi|315086835|gb|EFT58811.1| ribosomal protein L16 [Propionibacterium acnes HL002PA3]
 gi|315089928|gb|EFT61904.1| ribosomal protein L16 [Propionibacterium acnes HL072PA1]
 gi|315096750|gb|EFT68726.1| ribosomal protein L16 [Propionibacterium acnes HL038PA1]
 gi|315097978|gb|EFT69954.1| ribosomal protein L16 [Propionibacterium acnes HL059PA2]
 gi|315100621|gb|EFT72597.1| ribosomal protein L16 [Propionibacterium acnes HL046PA1]
 gi|315106066|gb|EFT78042.1| ribosomal protein L16 [Propionibacterium acnes HL030PA1]
 gi|315109225|gb|EFT81201.1| ribosomal protein L16 [Propionibacterium acnes HL030PA2]
 gi|327325164|gb|EGE66970.1| ribosomal protein L16 [Propionibacterium acnes HL096PA3]
 gi|327325206|gb|EGE67011.1| ribosomal protein L16 [Propionibacterium acnes HL096PA2]
 gi|327332716|gb|EGE74450.1| ribosomal protein L16 [Propionibacterium acnes HL097PA1]
 gi|327444007|gb|EGE90661.1| ribosomal protein L16 [Propionibacterium acnes HL043PA1]
 gi|327449365|gb|EGE96019.1| ribosomal protein L16 [Propionibacterium acnes HL013PA2]
 gi|327449407|gb|EGE96061.1| ribosomal protein L16 [Propionibacterium acnes HL043PA2]
 gi|327451428|gb|EGE98082.1| ribosomal protein L16 [Propionibacterium acnes HL087PA3]
 gi|327451597|gb|EGE98251.1| ribosomal protein L16 [Propionibacterium acnes HL092PA1]
 gi|327451884|gb|EGE98538.1| ribosomal protein L16 [Propionibacterium acnes HL083PA2]
 gi|328752098|gb|EGF65714.1| ribosomal protein L16 [Propionibacterium acnes HL087PA1]
 gi|328755506|gb|EGF69122.1| ribosomal protein L16 [Propionibacterium acnes HL025PA2]
 gi|328756290|gb|EGF69906.1| ribosomal protein L16 [Propionibacterium acnes HL020PA1]
 gi|328761376|gb|EGF74903.1| ribosomal protein L16 [Propionibacterium acnes HL099PA1]
          Length = 139

 Score =  193 bits (490), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 63/135 (46%), Positives = 89/135 (65%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  KY KQ   +  G AKGG+++ FG++ ++A E   + + +IEAAR A++R +KR
Sbjct: 1   MLIPRRVKYRKQHHPKRTGAAKGGTQLAFGDYGIQATEGGYLTNRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI V+PD P+T  P E RMG GKG  E W+  +KPGR+LFE+ GV E+VAR A RL
Sbjct: 61  GGKVWINVYPDRPMTKHPAESRMGSGKGTPEWWIANIKPGRVLFELSGVPEDVAREAMRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  +FI R 
Sbjct: 121 AIHKLPMKARFISRE 135


>gi|116266160|gb|ABJ91318.1| 50S ribosomal protein L16 [Porphyra yezoensis]
          Length = 139

 Score =  193 bits (490), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 70/134 (52%), Positives = 93/134 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ KQ +GR+KG A  G+ I FG++AL+A E   + S +IEA RR I+R  +R
Sbjct: 1   MLSPKKTKFRKQHRGRMKGSASKGNTIAFGDYALQATEPVWLTSRQIEATRRTITRYARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD PVTA+P E RMG GKG  E WV  +KPG ILFEI GV ++ A++A +L
Sbjct: 61  GGKLWIRVFPDKPVTARPAETRMGSGKGAPEYWVAVIKPGHILFEITGVPQKTAQQAMKL 120

Query: 122 GAAKLSVVTKFIQR 135
            + KL + TKFI R
Sbjct: 121 ASYKLPIKTKFIVR 134


>gi|150020852|ref|YP_001306206.1| 50S ribosomal protein L16 [Thermosipho melanesiensis BI429]
 gi|166216121|sp|A6LLM0|RL16_THEM4 RecName: Full=50S ribosomal protein L16
 gi|149793373|gb|ABR30821.1| ribosomal protein L16 [Thermosipho melanesiensis BI429]
          Length = 142

 Score =  193 bits (490), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 72/134 (53%), Positives = 96/134 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY KQ +GR+KG AKGGS + FG++ LKA EA+ I + +IEA R AI+R +K+
Sbjct: 1   MLMPKRVKYRKQHRGRMKGKAKGGSLVAFGDYGLKALEAHWITAQQIEACRIAITRTLKK 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           +G++WI +FPD   T  P E ++GKGKGNVE WV  VKPGR++FEI GVSEE+AR A   
Sbjct: 61  SGKLWIRIFPDKSYTKHPAESKLGKGKGNVEGWVAVVKPGRVMFEIGGVSEELAREALEY 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + TK ++R
Sbjct: 121 AATKLPIRTKIVKR 134


>gi|39936306|ref|NP_948582.1| 50S ribosomal protein L16 [Rhodopseudomonas palustris CGA009]
 gi|192292030|ref|YP_001992635.1| 50S ribosomal protein L16 [Rhodopseudomonas palustris TIE-1]
 gi|81562137|sp|Q6N4U1|RL16_RHOPA RecName: Full=50S ribosomal protein L16; AltName: Full=RRP-L16
 gi|226712345|sp|B3QBX3|RL16_RHOPT RecName: Full=50S ribosomal protein L16
 gi|39650161|emb|CAE28684.1| 50S ribosomal protein L16 [Rhodopseudomonas palustris CGA009]
 gi|192285779|gb|ACF02160.1| ribosomal protein L16 [Rhodopseudomonas palustris TIE-1]
          Length = 137

 Score =  193 bits (490), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 83/137 (60%), Positives = 104/137 (75%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGRI GVA  G+ + FG F LKA E  RI + +IEAARRA++R MKR
Sbjct: 1   MMQPKRTKFRKAHKGRIHGVASSGATLAFGQFGLKAMEPERITARQIEAARRALTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AGRVWI VFPD+PV+ KP EVRMG GKG+ E WV RVKPGR++FEIDGV++++AR A  L
Sbjct: 61  AGRVWIRVFPDLPVSKKPAEVRMGSGKGSPELWVARVKPGRVMFEIDGVNQQIAREALTL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            AAKL + T+F+ R+ E
Sbjct: 121 AAAKLPIKTRFVARIAE 137


>gi|126728171|ref|ZP_01743987.1| 50S ribosomal protein L16 [Sagittula stellata E-37]
 gi|126711136|gb|EBA10186.1| 50S ribosomal protein L16 [Sagittula stellata E-37]
          Length = 137

 Score =  193 bits (490), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 85/135 (62%), Positives = 108/135 (80%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K FKGRIKG AKGGS + FG++ LKA E  R+ + +IEAARRA++R MKR
Sbjct: 1   MLQPKRTKFRKAFKGRIKGEAKGGSDLNFGHYGLKATEPERVTARQIEAARRAMTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPD PVTAKP EVRMGKGKG+V++WVC+VKPGR++FEIDGV+E++AR A RL
Sbjct: 61  QGRVWIRIFPDTPVTAKPIEVRMGKGKGSVDRWVCKVKPGRVMFEIDGVAEDIAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL + T+ + R 
Sbjct: 121 AAMKLPIKTRVVVRE 135


>gi|193211858|ref|YP_001997811.1| 50S ribosomal protein L16 [Chlorobaculum parvum NCIB 8327]
 gi|226710696|sp|B3QR87|RL16_CHLP8 RecName: Full=50S ribosomal protein L16
 gi|193085335|gb|ACF10611.1| ribosomal protein L16 [Chlorobaculum parvum NCIB 8327]
          Length = 139

 Score =  193 bits (490), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 74/134 (55%), Positives = 93/134 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  +Y K  +GR+KG A+ G+ + FG+F LKA E   I S +IEAAR A++R MKR
Sbjct: 1   MLMPKRVQYRKTQRGRMKGNAQRGTAVTFGSFGLKALEPAWITSRQIEAARVAMNRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVT KP E RMG GKGN E WV  VKPGRI+FE  GV  E+A+ AFRL
Sbjct: 61  DGKIWIRIFPDKPVTKKPAETRMGSGKGNPEFWVAVVKPGRIMFEAAGVPREIAQEAFRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + T+FI R
Sbjct: 121 AAKKLPIKTRFIVR 134


>gi|166031652|ref|ZP_02234481.1| hypothetical protein DORFOR_01352 [Dorea formicigenerans ATCC
           27755]
 gi|166028629|gb|EDR47386.1| hypothetical protein DORFOR_01352 [Dorea formicigenerans ATCC
           27755]
          Length = 145

 Score =  193 bits (490), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 69/134 (51%), Positives = 89/134 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K  KQF+G +KG A  G++I  G + + A E   I S++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKRRKQFRGSMKGKALRGNKITNGEYGIVAMEPCWIRSNQIEAARVAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT KP E RMG GKG +E WV  VKPGR++FEI GV+EEVA+ A RL
Sbjct: 61  GGKVWIKIFPDKPVTTKPAETRMGSGKGTLEYWVAVVKPGRVMFEISGVAEEVAKEALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL    K + R
Sbjct: 121 ATHKLPCKCKVVSR 134


>gi|84494779|ref|ZP_00993898.1| 50S ribosomal protein L16 [Janibacter sp. HTCC2649]
 gi|84384272|gb|EAQ00152.1| 50S ribosomal protein L16 [Janibacter sp. HTCC2649]
          Length = 139

 Score =  193 bits (490), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 68/135 (50%), Positives = 91/135 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  K+ KQ      G AKGG+ I FG++ L+A E   + + +IE+AR A++R MKR
Sbjct: 1   MLIPRRVKHRKQHHPGRSGAAKGGTTIAFGDYGLQALEPAYVTNRQIESARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI ++PD P+T KP E RMG GKG+ E W+  VKPGRI+FEI GVSEEVAR A RL
Sbjct: 61  GGKVWINIYPDRPLTKKPAETRMGSGKGSPEWWIANVKPGRIMFEISGVSEEVAREAMRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  +F+QR 
Sbjct: 121 AMHKLPMKCRFVQRE 135


>gi|328951229|ref|YP_004368564.1| 50S ribosomal protein L16 [Marinithermus hydrothermalis DSM 14884]
 gi|328451553|gb|AEB12454.1| 50S ribosomal protein L16 [Marinithermus hydrothermalis DSM 14884]
          Length = 141

 Score =  193 bits (490), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 73/134 (54%), Positives = 94/134 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY KQ +GR++G AKGG  + FG++ L A E   I S +IEAAR A+ R  +R
Sbjct: 1   MLMPKRLKYRKQHRGRLRGTAKGGDYVAFGDYGLVALEPAWITSQQIEAARVAMVRHFRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+++I +FPD P T KP EVRMGKGKGNVE WV  VKPGR++FE+ GV+EE AR AFRL
Sbjct: 61  GGKIFIRIFPDKPYTKKPLEVRMGKGKGNVEGWVAVVKPGRVMFEVAGVTEEQAREAFRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL + TK ++R
Sbjct: 121 AGHKLPIKTKVVKR 134


>gi|257065026|ref|YP_003144698.1| LSU ribosomal protein L16P [Slackia heliotrinireducens DSM 20476]
 gi|256792679|gb|ACV23349.1| LSU ribosomal protein L16P [Slackia heliotrinireducens DSM 20476]
          Length = 143

 Score =  193 bits (490), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 67/135 (49%), Positives = 91/135 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  ++ K  +G +KG AKG +++  G++ ++A EA+ I + +IEAAR A++R MKR
Sbjct: 1   MLAPKRVRHRKVQRGSMKGKAKGYTKLNHGDYGIQALEAHWITNRQIEAARVAMTREMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T KP E RMG GKGN E WV  VKPGRI+FEI GV + VAR A RL
Sbjct: 61  GGKVWITIFPDKPITQKPAETRMGSGKGNPEGWVAVVKPGRIMFEIAGVEDAVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  K + R 
Sbjct: 121 AINKLPIKCKIVTRE 135


>gi|77462266|ref|YP_351770.1| 50S ribosomal protein L16 [Rhodobacter sphaeroides 2.4.1]
 gi|126461142|ref|YP_001042256.1| 50S ribosomal protein L16 [Rhodobacter sphaeroides ATCC 17029]
 gi|221638120|ref|YP_002524382.1| 50S ribosomal protein L16 [Rhodobacter sphaeroides KD131]
 gi|85701221|sp|Q3J5R5|RL16_RHOS4 RecName: Full=50S ribosomal protein L16
 gi|166215168|sp|A3PGL8|RL16_RHOS1 RecName: Full=50S ribosomal protein L16
 gi|254799218|sp|B9KL98|RL16_RHOSK RecName: Full=50S ribosomal protein L16
 gi|77386684|gb|ABA77869.1| LSU ribosomal protein L16P [Rhodobacter sphaeroides 2.4.1]
 gi|126102806|gb|ABN75484.1| LSU ribosomal protein L16P [Rhodobacter sphaeroides ATCC 17029]
 gi|221158901|gb|ACL99880.1| 50S ribosomal protein L16 [Rhodobacter sphaeroides KD131]
          Length = 137

 Score =  193 bits (490), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 89/135 (65%), Positives = 105/135 (77%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQ KGRI G AKGG  + FG F LKA E  R+ + +IEAARRAI+R MKR
Sbjct: 1   MLQPKRTKFRKQHKGRIHGEAKGGFLLNFGGFGLKATEPERVTARQIEAARRAITRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI VFPDVPVT+KPTEVRMGKGKG+V+ W  +VKPGRI+FEIDGVSE +AR A RL
Sbjct: 61  QGRVWIRVFPDVPVTSKPTEVRMGKGKGSVDYWAAKVKPGRIMFEIDGVSETIAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
           GA KL V+T+ + R 
Sbjct: 121 GAMKLPVMTRIVVRE 135


>gi|149072016|ref|YP_001293587.1| 50S ribosomal protein L16 [Rhodomonas salina]
 gi|215274773|sp|A6MW08|RK16_RHDSA RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|134302967|gb|ABO70771.1| 50S ribosomal protein L16 [Rhodomonas salina]
          Length = 137

 Score =  193 bits (490), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 65/135 (48%), Positives = 90/135 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ K  +GR +G A  G++I FG +AL+A E   + S +IEA RR+++R +KR
Sbjct: 1   MLSPKRTKFRKPHRGRFRGTATRGNKIVFGEYALQALEPVWLTSRQIEATRRSVTRFVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD  ++ KP E RMG GKG  + WV  +KPG ILFEI GVSE +A  AF+ 
Sbjct: 61  TGKLWIRVFPDKSISCKPPETRMGAGKGAPDYWVAVIKPGHILFEIGGVSETLAYNAFKN 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL + TKFI + 
Sbjct: 121 ASYKLPIKTKFISKE 135


>gi|302382625|ref|YP_003818448.1| ribosomal protein L16 [Brevundimonas subvibrioides ATCC 15264]
 gi|302193253|gb|ADL00825.1| ribosomal protein L16 [Brevundimonas subvibrioides ATCC 15264]
          Length = 146

 Score =  193 bits (490), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 88/134 (65%), Positives = 101/134 (75%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TKY K FKGRI G AKGG  + FG++ LK  E  RI + +IEAARRAI+R MKR
Sbjct: 1   MLQPKKTKYRKAFKGRIHGAAKGGFSLNFGSYGLKTLEPERITARQIEAARRAITRQMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI VFPDVPV+ KP EVRMGKGKG V+ W  R  PGRILFEIDGV+++VAR A RL
Sbjct: 61  QGRVWIRVFPDVPVSGKPAEVRMGKGKGAVDHWAARCHPGRILFEIDGVADDVAREALRL 120

Query: 122 GAAKLSVVTKFIQR 135
           GAAKL V TK + R
Sbjct: 121 GAAKLPVRTKVVTR 134


>gi|299135250|ref|ZP_07028441.1| ribosomal protein L16 [Afipia sp. 1NLS2]
 gi|298590227|gb|EFI50431.1| ribosomal protein L16 [Afipia sp. 1NLS2]
          Length = 137

 Score =  192 bits (489), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 83/137 (60%), Positives = 102/137 (74%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGRI GVA  G+ + FG F LKA    RI + +IEAARRA++R MKR
Sbjct: 1   MMQPKKTKFRKAHKGRIHGVASSGATLSFGQFGLKAMAPERITARQIEAARRALTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI VFPD+PV+ KP EVRMG GKG+ E WV RVKPGRILFEIDGV++++AR A  L
Sbjct: 61  VGRVWIRVFPDLPVSKKPAEVRMGSGKGSPELWVARVKPGRILFEIDGVNDQIAREALSL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            AAKL + T+F+ R+ E
Sbjct: 121 AAAKLPIKTRFVARIAE 137


>gi|153004780|ref|YP_001379105.1| 50S ribosomal protein L16 [Anaeromyxobacter sp. Fw109-5]
 gi|166234543|sp|A7HBM5|RL16_ANADF RecName: Full=50S ribosomal protein L16
 gi|152028353|gb|ABS26121.1| ribosomal protein L16 [Anaeromyxobacter sp. Fw109-5]
          Length = 138

 Score =  192 bits (489), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 70/134 (52%), Positives = 93/134 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QP  TKY K  KGR++G A  GS +  G + L+A E   + + +IEAAR AI+R +KR
Sbjct: 1   MLQPARTKYRKMMKGRMRGKAYRGSDLNQGEYGLQATECGWLTARQIEAARVAITRYVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD P+T KP E RMG GKGNVE +V  VKPGR+L+E+ GV +E A++AF L
Sbjct: 61  GGKLWIRVFPDKPITKKPAETRMGTGKGNVEYYVAVVKPGRVLYELAGVDDESAKKAFHL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL V TK ++R
Sbjct: 121 AAHKLPVATKLVKR 134


>gi|163796912|ref|ZP_02190869.1| 50S ribosomal protein L29 [alpha proteobacterium BAL199]
 gi|159177901|gb|EDP62450.1| 50S ribosomal protein L29 [alpha proteobacterium BAL199]
          Length = 137

 Score =  192 bits (489), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 81/137 (59%), Positives = 103/137 (75%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ K  KGRI G+AKGG+ + FG + LKA    R+ + +IEAARRAI+R ++R
Sbjct: 1   MLSPKRTKFRKAHKGRIHGLAKGGTALNFGAYGLKATTPARVTARQIEAARRAITRHIRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPDVPV++KP EVRMGKGKG  E WVCRVKPGRI+FE+DGV  ++A  AFRL
Sbjct: 61  VGRVWIRIFPDVPVSSKPAEVRMGKGKGAPEFWVCRVKPGRIMFELDGVPRDLAEEAFRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            A KL V T+F+ R+ E
Sbjct: 121 AAMKLPVDTRFVVRLGE 137


>gi|85858153|ref|YP_460356.1| 50S ribosomal protein L16 [Syntrophus aciditrophicus SB]
 gi|115502802|sp|Q2LQB3|RL16_SYNAS RecName: Full=50S ribosomal protein L16
 gi|85721244|gb|ABC76187.1| LSU ribosomal protein L16P [Syntrophus aciditrophicus SB]
          Length = 140

 Score =  192 bits (489), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 68/135 (50%), Positives = 92/135 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY K  +GR  G A  GS+I FG + L+A+E   I + +IEAAR AI+R ++R
Sbjct: 1   MLMPKRVKYRKLQRGRRTGTATRGSKISFGEYGLQAEECGWITARQIEAARIAITRHVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FP   +T KP E RMGKGKG  E+WV  VKPG +L+E+ GVS+EVAR AFRL
Sbjct: 61  GGKIWIRIFPHKSITKKPAETRMGKGKGAPEEWVAVVKPGTVLYEMQGVSKEVAREAFRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL + T+F+ R 
Sbjct: 121 ASHKLPIGTRFLSRE 135


>gi|73661979|ref|YP_300760.1| 50S ribosomal protein L16 [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
 gi|85541823|sp|Q49ZG1|RL16_STAS1 RecName: Full=50S ribosomal protein L16
 gi|72494494|dbj|BAE17815.1| 50S ribosomal protein L16 [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
          Length = 144

 Score =  192 bits (489), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 71/135 (52%), Positives = 92/135 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +Q + +  G +KGG+ + FG + L+A   + I S +IE+AR A++R MKR
Sbjct: 1   MLLPKRVKYRRQHRPKTTGRSKGGNYVTFGEYGLQATTTSWITSRQIESARIAMTRFMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP  P T KP EVRMG GKG VE W+   KPGRILFEI GV+EEVAR A RL
Sbjct: 61  GGKVWIKIFPHTPYTQKPLEVRMGAGKGAVEGWIAVAKPGRILFEIAGVNEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL V TKF++R 
Sbjct: 121 ASHKLPVKTKFVKRE 135


>gi|169830023|ref|YP_001700181.1| 50S ribosomal protein L16 [Lysinibacillus sphaericus C3-41]
 gi|226712319|sp|B1HMX3|RL16_LYSSC RecName: Full=50S ribosomal protein L16
 gi|168994511|gb|ACA42051.1| 50S ribosomal protein L16 [Lysinibacillus sphaericus C3-41]
          Length = 144

 Score =  192 bits (489), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 71/135 (52%), Positives = 94/135 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY ++ +G ++G AKGG  + FG + L+AQ A+ I + +IE+AR A++R MKR
Sbjct: 1   MLLPKRVKYRREHRGNMRGEAKGGKEVSFGEWGLQAQTASWITNRQIESARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP  P T KP EVRMG GKG+ E WV  VKPG+I+FEI GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPHKPYTKKPLEVRMGSGKGSPEGWVAVVKPGKIMFEIAGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL V  K ++R 
Sbjct: 121 ASHKLPVKCKIVKRQ 135


>gi|289550150|ref|YP_003471054.1| LSU ribosomal protein L16p (L10e) [Staphylococcus lugdunensis
           HKU09-01]
 gi|315659220|ref|ZP_07912084.1| 50S ribosomal protein L16 [Staphylococcus lugdunensis M23590]
 gi|289179682|gb|ADC86927.1| LSU ribosomal protein L16p (L10e) [Staphylococcus lugdunensis
           HKU09-01]
 gi|315495645|gb|EFU83976.1| 50S ribosomal protein L16 [Staphylococcus lugdunensis M23590]
          Length = 144

 Score =  192 bits (489), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 72/135 (53%), Positives = 92/135 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +Q + +  G +KGG+ + FG + L+A   + I S +IE+AR A++R MKR
Sbjct: 1   MLLPKRVKYRRQHRPKTTGRSKGGNYVTFGEYGLQATTTSWITSRQIESARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP  P T KP EVRMG GKG VE W+  VKPGRILFEI GV EEVAR A RL
Sbjct: 61  GGKVWIKIFPHTPYTKKPLEVRMGAGKGAVEGWIAVVKPGRILFEIAGVQEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL V TKF++R 
Sbjct: 121 ASHKLPVKTKFVKRE 135


>gi|260438209|ref|ZP_05792025.1| ribosomal protein L16 [Butyrivibrio crossotus DSM 2876]
 gi|292809401|gb|EFF68606.1| ribosomal protein L16 [Butyrivibrio crossotus DSM 2876]
          Length = 145

 Score =  192 bits (489), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 69/134 (51%), Positives = 90/134 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQF+G + G A  G++I +G + + A E   + S +IEAAR A++R +KR
Sbjct: 1   MLLPKRVKHRKQFRGSMAGKATRGNKIVYGEYGIVALEPKWVSSRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P T KP  VRMGKGKG+VE WV  VKPGR++FEI GV EEVAR A RL
Sbjct: 61  GGKVWIKLFPDKPYTHKPLGVRMGKGKGSVEYWVAVVKPGRVMFEIAGVPEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL +  K + R
Sbjct: 121 AMHKLPLRCKIVSR 134


>gi|239636226|ref|ZP_04677230.1| ribosomal protein L16 [Staphylococcus warneri L37603]
 gi|239598242|gb|EEQ80735.1| ribosomal protein L16 [Staphylococcus warneri L37603]
 gi|330685185|gb|EGG96849.1| ribosomal protein L16 [Staphylococcus epidermidis VCU121]
          Length = 144

 Score =  192 bits (489), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 71/135 (52%), Positives = 92/135 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +Q + +  G +KGG+ + FG + L+A   + I S +IE+AR A++R MKR
Sbjct: 1   MLLPKRVKYRRQHRPKTTGRSKGGNYVTFGEYGLQATTTSWITSRQIESARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP  P T KP EVRMG GKG VE W+  VKPGRILFE+ GV EEVAR A RL
Sbjct: 61  GGKVWIKIFPHTPYTKKPLEVRMGAGKGAVEGWIAVVKPGRILFEVAGVQEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL V TKF++R 
Sbjct: 121 ASHKLPVKTKFVKRE 135


>gi|86357312|ref|YP_469204.1| 50S ribosomal protein L16 [Rhizobium etli CFN 42]
 gi|190891362|ref|YP_001977904.1| 50S ribosomal protein L16 [Rhizobium etli CIAT 652]
 gi|218458653|ref|ZP_03498744.1| 50S ribosomal protein L16 [Rhizobium etli Kim 5]
 gi|218672113|ref|ZP_03521782.1| 50S ribosomal protein L16 [Rhizobium etli GR56]
 gi|115502779|sp|Q2K9K9|RL16_RHIEC RecName: Full=50S ribosomal protein L16
 gi|226712342|sp|B3PWS8|RL16_RHIE6 RecName: Full=50S ribosomal protein L16
 gi|86281414|gb|ABC90477.1| 50S ribosomal protein L16 [Rhizobium etli CFN 42]
 gi|190696641|gb|ACE90726.1| 50S ribosomal protein L16 [Rhizobium etli CIAT 652]
 gi|327191392|gb|EGE58418.1| 50S ribosomal protein L16 [Rhizobium etli CNPAF512]
          Length = 137

 Score =  192 bits (489), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 105/137 (76%), Positives = 119/137 (86%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TKY KQFKGRIKGVAKGGS + FG F LKAQE NR+ + EIEAARRAI+R MKR
Sbjct: 1   MLQPKRTKYRKQFKGRIKGVAKGGSDLAFGEFGLKAQEPNRVNAREIEAARRAITRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AGRVWI VFPDVPVTAKPTEVRMGKGKG+VE W C+VKPGR++FEIDGVSEE+AR A RL
Sbjct: 61  AGRVWIRVFPDVPVTAKPTEVRMGKGKGSVEYWACKVKPGRMMFEIDGVSEEIAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
           G+AKLSV T+F+QR+ E
Sbjct: 121 GSAKLSVKTRFVQRIAE 137


>gi|297564044|ref|YP_003683017.1| ribosomal protein L16 [Nocardiopsis dassonvillei subsp.
           dassonvillei DSM 43111]
 gi|296848493|gb|ADH70511.1| ribosomal protein L16 [Nocardiopsis dassonvillei subsp.
           dassonvillei DSM 43111]
          Length = 137

 Score =  192 bits (489), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 64/137 (46%), Positives = 91/137 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  KY KQ    ++G AKGG+ + FG F ++A E+  + + +IE+AR A++R +KR
Sbjct: 1   MLIPRKVKYRKQHHPDLRGKAKGGTTVTFGEFGIQALESAYVTNRQIESARIAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T KP EVRMG GKG+ E WV  VKPGR++FE+ GV E +A+ A R 
Sbjct: 61  GGKVWINIFPDRPLTKKPAEVRMGSGKGSPEWWVAPVKPGRVMFELSGVPEAIAKEAMRR 120

Query: 122 GAAKLSVVTKFIQRVVE 138
              KL +  KF+ R  E
Sbjct: 121 AMHKLPMKCKFVTREGE 137


>gi|254798664|ref|YP_003058312.1| ribosomal protein L16 [Parachlorella kessleri]
 gi|229915612|gb|ACQ90955.1| ribosomal protein L16 [Parachlorella kessleri]
          Length = 134

 Score =  192 bits (489), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 66/134 (49%), Positives = 92/134 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY K  +GR++G A  G+ + FG++ L+  E + I S +IEAARRA++R ++R
Sbjct: 1   MLSPKRTKYRKHHRGRMRGKASRGNTLVFGDYGLQTLECSWITSRQIEAARRAMTRQVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVT +P E RMG GKG  E WV  VKPG+IL+E+ GV E VAR A  L
Sbjct: 61  GGQIWIRLFPDKPVTMRPAETRMGSGKGAPEYWVAVVKPGKILYELKGVPETVARVALLL 120

Query: 122 GAAKLSVVTKFIQR 135
            A+KL V T+ + +
Sbjct: 121 AASKLPVKTQILVK 134


>gi|296282589|ref|ZP_06860587.1| 50S ribosomal protein L16 [Citromicrobium bathyomarinum JL354]
          Length = 144

 Score =  192 bits (489), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 84/137 (61%), Positives = 101/137 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TKY K FKGRI G AKGG+ + FG++ LKA E  RI + +IEAARRAI+R MKR
Sbjct: 1   MLQPKRTKYRKAFKGRIHGNAKGGTELNFGSYGLKAMEPERITARQIEAARRAITRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI VFPDVPV+ KP EVR GKGKG+VE W  RVKPGRILFE+DGVS  +A  AF  
Sbjct: 61  QGRLWIRVFPDVPVSKKPAEVRQGKGKGSVEYWAARVKPGRILFELDGVSGPLAAEAFER 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            A KL + TK + R+ +
Sbjct: 121 AAMKLPIKTKVVARLGD 137


>gi|241895180|ref|ZP_04782476.1| 50S ribosomal protein L16 [Weissella paramesenteroides ATCC 33313]
 gi|241871486|gb|EER75237.1| 50S ribosomal protein L16 [Weissella paramesenteroides ATCC 33313]
          Length = 139

 Score =  192 bits (488), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 69/137 (50%), Positives = 93/137 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +  +G+++G AKGG  + FG+F L+A E++ I + +IEAAR A++R MKR
Sbjct: 1   MLVPKRVKYRRPHRGKMRGEAKGGKTVAFGDFGLQATESHWITNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP +  T+K   VRMG GKG  E WV  VK G++LFE+ GV EEVAR A RL
Sbjct: 61  GGKVWIKIFPHLSYTSKGVGVRMGNGKGTPEGWVAPVKRGKVLFEVAGVPEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            + KL V TK + R VE
Sbjct: 121 ASNKLPVKTKILARQVE 137


>gi|161784229|ref|YP_001595545.1| ribosomal protein L16 [Lemna minor]
 gi|215275570|sp|A9L9D3|RK16_LEMMI RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|88696807|gb|ABD48532.1| ribosomal protein L16 [Lemna minor]
          Length = 135

 Score =  192 bits (488), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 70/132 (53%), Positives = 94/132 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG +  G+ I FG +AL+A E + I + +IEA RRAISR  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGTSYRGNHISFGRYALQALEPSWITARQIEAGRRAISRYARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +P E RMG GKG+ E WV  VKPGRIL+EI GVSE VAR A  L
Sbjct: 61  GGKIWVRLFPDKPVTLRPAETRMGSGKGSPEYWVSVVKPGRILYEIGGVSENVARTAMLL 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+FI
Sbjct: 121 AASKMPIRTQFI 132


>gi|218961426|ref|YP_001741201.1| 50S ribosomal subunit protein L16 [Candidatus Cloacamonas
           acidaminovorans]
 gi|167730083|emb|CAO80995.1| 50S ribosomal subunit protein L16 [Candidatus Cloacamonas
           acidaminovorans]
          Length = 139

 Score =  192 bits (488), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 72/135 (53%), Positives = 90/135 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ K  KGR KG++  G  I FG++ L A E + I S +IEA R AI+R MKR
Sbjct: 1   MLAPKKVKHRKMMKGRRKGLSWTGCNISFGDYGLIALEDSFITSRQIEACRIAITRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T KP E RMGKGKG  E WV  V+PGR+LFEI+GV   VA+ A RL
Sbjct: 61  EGKVWIRIFPDKPITKKPAETRMGKGKGAPEYWVAVVRPGRVLFEIEGVDVNVAKEALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL + T+FI R 
Sbjct: 121 AAHKLPIKTRFIARE 135


>gi|254459704|ref|ZP_05073120.1| ribosomal protein L16 [Rhodobacterales bacterium HTCC2083]
 gi|206676293|gb|EDZ40780.1| ribosomal protein L16 [Rhodobacteraceae bacterium HTCC2083]
          Length = 137

 Score =  192 bits (488), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 82/135 (60%), Positives = 104/135 (77%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGRI G+AKGGS + FG + LKA    R+ + +IEAARRA++R MKR
Sbjct: 1   MLQPKRTKFRKMHKGRINGLAKGGSDLNFGTYGLKATTPERVTARQIEAARRAMTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPD PVT+KPTEVRMGKGKG+V+ W  +VKPGRI+FEIDGV++E+AR A RL
Sbjct: 61  QGRVWIRIFPDTPVTSKPTEVRMGKGKGSVDFWAAKVKPGRIMFEIDGVNDEIAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL+V T+ + R 
Sbjct: 121 AAMKLAVKTRIVVRE 135


>gi|313836028|gb|EFS73742.1| ribosomal protein L16 [Propionibacterium acnes HL037PA2]
 gi|314929567|gb|EFS93398.1| ribosomal protein L16 [Propionibacterium acnes HL044PA1]
 gi|314970548|gb|EFT14646.1| ribosomal protein L16 [Propionibacterium acnes HL037PA3]
 gi|328906223|gb|EGG25998.1| ribosomal protein L16 [Propionibacterium sp. P08]
          Length = 139

 Score =  192 bits (488), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 63/135 (46%), Positives = 89/135 (65%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  KY KQ   +  G AKGG+++ FG++ ++A E   + + +IEAAR A++R +KR
Sbjct: 1   MLIPRRVKYRKQHHPKRSGAAKGGTQLAFGDYGIQATEGGYLTNRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI V+PD P+T  P E RMG GKG  E W+  +KPGR+LFE+ GV +EVAR A RL
Sbjct: 61  GGKVWINVYPDRPMTKHPAESRMGSGKGTPEWWIANIKPGRVLFELSGVPDEVAREAMRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  +FI R 
Sbjct: 121 AIHKLPMKARFISRE 135


>gi|226226286|ref|YP_002760392.1| 50S ribosomal protein L16 [Gemmatimonas aurantiaca T-27]
 gi|259645652|sp|C1A6R2|RL16_GEMAT RecName: Full=50S ribosomal protein L16
 gi|226089477|dbj|BAH37922.1| 50S ribosomal protein L16 [Gemmatimonas aurantiaca T-27]
          Length = 142

 Score =  192 bits (488), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 72/135 (53%), Positives = 94/135 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ K FKGR+ G+A  GS + FG + L+A E   + S +IEA R A++R +KR
Sbjct: 1   MLSPKRVKFRKMFKGRMTGLAHRGSDVSFGTYGLQALEPGWVTSRQIEACRVAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T KP E RMGKGKG+ E WV  VKPGR++FEI+GVS+E+A  A  L
Sbjct: 61  GGKVWIRIFPDKPITKKPAETRMGKGKGSPELWVAVVKPGRVMFEIEGVSKELAETAMSL 120

Query: 122 GAAKLSVVTKFIQRV 136
            AAKL V TKF+ R 
Sbjct: 121 AAAKLGVKTKFVARE 135


>gi|319778736|ref|YP_004129649.1| LSU ribosomal protein L16p (L10e) [Taylorella equigenitalis MCE9]
 gi|317108760|gb|ADU91506.1| LSU ribosomal protein L16p (L10e) [Taylorella equigenitalis MCE9]
          Length = 137

 Score =  192 bits (488), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 72/134 (53%), Positives = 97/134 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P   KY K+ KGR  G+A  G+ + FG+F LKA    R+ + +IEAARRA++R +KR
Sbjct: 1   MLSPARRKYRKEQKGRNTGLATRGTNVNFGDFGLKATGRGRLTARQIEAARRAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI +FPD P++ KP EVRMG GKGN E WV  ++PG++L+E+DGVSEE+AR AFRL
Sbjct: 61  GGRIWIRIFPDKPISQKPAEVRMGNGKGNPEYWVAEIQPGKVLYEMDGVSEELAREAFRL 120

Query: 122 GAAKLSVVTKFIQR 135
            AAKL + T F+ R
Sbjct: 121 AAAKLPISTTFVTR 134


>gi|78186076|ref|YP_374119.1| 50S ribosomal protein L16 [Chlorobium luteolum DSM 273]
 gi|115502774|sp|Q3B6F5|RL16_PELLD RecName: Full=50S ribosomal protein L16
 gi|78165978|gb|ABB23076.1| LSU ribosomal protein L16P [Chlorobium luteolum DSM 273]
          Length = 139

 Score =  192 bits (488), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 74/134 (55%), Positives = 91/134 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY K  +GR+KG A  G+ + FG+F LKA E   I S +IEAAR A++R MKR
Sbjct: 1   MLMPKRVKYRKTQRGRMKGNAGRGTSVAFGSFGLKAIEPAWITSRQIEAARVAMNRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PV+ K  E RMG GKG+ E WV  VKPGRI+FE DGV  EVA  AFRL
Sbjct: 61  DGKIWIRIFPDKPVSKKAAETRMGSGKGSPEFWVAVVKPGRIMFEADGVPMEVATEAFRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + T+FI R
Sbjct: 121 AAKKLPIKTRFIVR 134


>gi|118475886|ref|YP_893037.1| 50S ribosomal protein L16 [Bacillus thuringiensis str. Al Hakam]
 gi|118415111|gb|ABK83530.1| LSU ribosomal protein L16P [Bacillus thuringiensis str. Al Hakam]
          Length = 162

 Score =  192 bits (488), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 78/135 (57%), Positives = 98/135 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY ++ +G+++G AKGG+ I FG F L+AQ A+ I + +IEAARRA++R MKR
Sbjct: 19  MLMPKRVKYRREHRGKMRGRAKGGTEIAFGEFGLQAQAASWITNRQIEAARRAMTRYMKR 78

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP  P TAKP EVRMG GKG  E WV  VKPG+I+FEI GVSEEVAR A RL
Sbjct: 79  GGKVWIKIFPSKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKIMFEIAGVSEEVAREALRL 138

Query: 122 GAAKLSVVTKFIQRV 136
            A KL V  KF++R 
Sbjct: 139 AAHKLPVKCKFVKRE 153


>gi|27468735|ref|NP_765372.1| 50S ribosomal protein L16 [Staphylococcus epidermidis ATCC 12228]
 gi|57867710|ref|YP_189387.1| 50S ribosomal protein L16 [Staphylococcus epidermidis RP62A]
 gi|242243954|ref|ZP_04798397.1| 50S ribosomal protein L16 [Staphylococcus epidermidis W23144]
 gi|251812054|ref|ZP_04826527.1| 50S ribosomal protein L16 [Staphylococcus epidermidis BCM-HMP0060]
 gi|282875349|ref|ZP_06284222.1| ribosomal protein L16 [Staphylococcus epidermidis SK135]
 gi|293368440|ref|ZP_06615064.1| 50S ribosomal protein L16 [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|81673591|sp|Q5HM06|RL16_STAEQ RecName: Full=50S ribosomal protein L16
 gi|81843472|sp|Q8CRG7|RL16_STAES RecName: Full=50S ribosomal protein L16
 gi|27316283|gb|AAO05458.1|AE016750_63 50S ribosomal protein L16 [Staphylococcus epidermidis ATCC 12228]
 gi|57638368|gb|AAW55156.1| ribosomal protein L16 [Staphylococcus epidermidis RP62A]
 gi|242232587|gb|EES34899.1| 50S ribosomal protein L16 [Staphylococcus epidermidis W23144]
 gi|251804388|gb|EES57045.1| 50S ribosomal protein L16 [Staphylococcus epidermidis BCM-HMP0060]
 gi|281296114|gb|EFA88635.1| ribosomal protein L16 [Staphylococcus epidermidis SK135]
 gi|291317398|gb|EFE57820.1| 50S ribosomal protein L16 [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|319400617|gb|EFV88842.1| ribosomal protein L16 [Staphylococcus epidermidis FRI909]
 gi|329731180|gb|EGG67550.1| ribosomal protein L16 [Staphylococcus epidermidis VCU144]
 gi|329736457|gb|EGG72725.1| ribosomal protein L16 [Staphylococcus epidermidis VCU028]
 gi|329737052|gb|EGG73307.1| ribosomal protein L16 [Staphylococcus epidermidis VCU045]
          Length = 144

 Score =  192 bits (488), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 70/135 (51%), Positives = 92/135 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +Q + +  G +KGG+ + FG + L+A   + I S +IE+AR A++R MKR
Sbjct: 1   MLLPKRVKYRRQHRPKTTGRSKGGNYVTFGEYGLQATTTSWITSRQIESARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP  P T KP EVRMG GKG VE W+  VKPGRILFE+ GV EEVAR A RL
Sbjct: 61  GGKVWIKIFPHTPYTKKPLEVRMGAGKGAVEGWIAVVKPGRILFEVAGVPEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL V +KF++R 
Sbjct: 121 ASHKLPVKSKFVKRE 135


>gi|290487868|gb|ADD30318.1| ribosomal protein L16 [Antirrhinum majus]
          Length = 135

 Score =  192 bits (488), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 66/133 (49%), Positives = 95/133 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+ ICFG + L+A E   I S +IEA RRA++R  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGMSYRGNHICFGKYGLQALEPAWITSRQIEAGRRAMTRNARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +P E RMG GKG+ E WV  VKPGRIL+E+ GV+E +ARRA  +
Sbjct: 61  GGKIWVRIFPDKPVTIRPAETRMGSGKGSPEYWVAVVKPGRILYEMSGVTENIARRAILI 120

Query: 122 GAAKLSVVTKFIQ 134
            A+K+ + T+FI 
Sbjct: 121 AASKMPIRTQFIS 133


>gi|15805347|ref|NP_294041.1| 50S ribosomal protein L16 [Deinococcus radiodurans R1]
 gi|28948930|pdb|1NKW|K Chain K, Crystal Structure Of The Large Ribosomal Subunit From
           Deinococcus Radiodurans
 gi|51247383|pdb|1SM1|K Chain K, Complex Of The Large Ribosomal Subunit From Deinococcus
           Radiodurans With Quinupristin And Dalfopristin
 gi|190613499|pdb|2ZJP|J Chain J, Thiopeptide Antibiotic Nosiheptide Bound To The Large
           Ribosomal Subunit Of Deinococcus Radiodurans
 gi|190613529|pdb|2ZJQ|J Chain J, Interaction Of L7 With L11 Induced By Microccocin Binding
           To The Deinococcus Radiodurans 50s Subunit
 gi|190613560|pdb|2ZJR|J Chain J, Refined Native Structure Of The Large Ribosomal Subunit
           (50s) From Deinococcus Radiodurans
 gi|190613667|pdb|3CF5|J Chain J, Thiopeptide Antibiotic Thiostrepton Bound To The Large
           Ribosomal Subunit Of Deinococcus Radiodurans
 gi|203282466|pdb|3DLL|J Chain J, The Oxazolidinone Antibiotics Perturb The Ribosomal
           Peptidyl-Transferase Center And Effect Trna Positioning
 gi|6457992|gb|AAF09899.1|AE001892_10 ribosomal protein L16 [Deinococcus radiodurans R1]
          Length = 142

 Score =  192 bits (488), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 73/137 (53%), Positives = 96/137 (70%)

Query: 1   MLRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMK 60
           M+  PK TK+ KQF+GR+ G AKGG  + FG++ L A E   I S++IEA R  +SR  +
Sbjct: 1   MMLLPKRTKFRKQFRGRMTGDAKGGDYVAFGDYGLIAMEPAWIKSNQIEACRIVMSRHFR 60

Query: 61  RAGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFR 120
           R G+++I +FPD PVT KP E RMGKGKG VE WV  VKPGR++FE+ GV+EE A+ AFR
Sbjct: 61  RGGKIYIRIFPDKPVTKKPAETRMGKGKGAVEYWVSVVKPGRVMFEVAGVTEEQAKEAFR 120

Query: 121 LGAAKLSVVTKFIQRVV 137
           L   KL + TK ++R V
Sbjct: 121 LAGHKLPIQTKMVKREV 137


>gi|330430094|gb|AEC21428.1| 50S ribosomal protein L16 [Pusillimonas sp. T7-7]
          Length = 138

 Score =  192 bits (488), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 73/136 (53%), Positives = 99/136 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QP   KY K+ KGR  G+A  G+++ FG F LKA    R+ + +IEAARRAI+R +KR
Sbjct: 1   MLQPSRRKYRKEHKGRNTGLATRGAQVSFGEFGLKATGRGRLTARQIEAARRAINRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI +FPD P++ KP EVRMG GKGN E WV  ++PG++L+E++GVSEE+AR AFRL
Sbjct: 61  GGRIWIRIFPDKPISQKPAEVRMGNGKGNPEYWVAEIQPGKVLYEMEGVSEELAREAFRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + T F+ R +
Sbjct: 121 AAAKLPISTTFVSRHI 136


>gi|148554267|ref|YP_001261849.1| 50S ribosomal protein L16 [Sphingomonas wittichii RW1]
 gi|166216111|sp|A5V5Z5|RL16_SPHWW RecName: Full=50S ribosomal protein L16
 gi|148499457|gb|ABQ67711.1| LSU ribosomal protein L16P [Sphingomonas wittichii RW1]
          Length = 143

 Score =  192 bits (488), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 79/137 (57%), Positives = 97/137 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGRI G A GG+ + FG F LKA E +RI + +IEAARRAI+R +KR
Sbjct: 1   MLQPKRTKFRKAHKGRIHGNAPGGASLNFGAFGLKALEPDRITARQIEAARRAITRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI +FPDVPV++KP EVRMG GKG+ E W  RVKPGRILFE+DGV   +AR AF  
Sbjct: 61  QGRLWIRIFPDVPVSSKPAEVRMGSGKGSPEFWAARVKPGRILFELDGVPGPLARVAFER 120

Query: 122 GAAKLSVVTKFIQRVVE 138
              KL + TK + R  E
Sbjct: 121 AMEKLPIKTKVVARFGE 137


>gi|150396214|ref|YP_001326681.1| 50S ribosomal protein L16 [Sinorhizobium medicae WSM419]
 gi|166216110|sp|A6U866|RL16_SINMW RecName: Full=50S ribosomal protein L16
 gi|150027729|gb|ABR59846.1| ribosomal protein L16 [Sinorhizobium medicae WSM419]
          Length = 137

 Score =  192 bits (488), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 106/137 (77%), Positives = 119/137 (86%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TKY KQFKGRIKGVAKGGS + FG F LKAQE NR+ + EIEAARRAI+R MKR
Sbjct: 1   MLQPKRTKYRKQFKGRIKGVAKGGSDLAFGEFGLKAQEPNRVNAREIEAARRAITRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AGRVWI VFPDVPVTAKPTEVRMGKGKG+VE W C+VKPGR++FEIDGVSEE+AR A RL
Sbjct: 61  AGRVWIRVFPDVPVTAKPTEVRMGKGKGSVEYWACKVKPGRMMFEIDGVSEELAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
           GAAKLSV T+F+QR+ E
Sbjct: 121 GAAKLSVKTRFVQRIAE 137


>gi|110639528|ref|YP_679737.1| 50S ribosomal protein L16 [Cytophaga hutchinsonii ATCC 33406]
 gi|123163232|sp|Q11QB9|RL16_CYTH3 RecName: Full=50S ribosomal protein L16
 gi|110282209|gb|ABG60395.1| LSU ribosomal protein L16P [Cytophaga hutchinsonii ATCC 33406]
          Length = 140

 Score =  192 bits (488), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 80/134 (59%), Positives = 94/134 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TKY KQ KGR+ GVA  G RI FG+FA+K+ E   I + +IEAAR A++R MKR
Sbjct: 1   MLQPKRTKYRKQQKGRVTGVATRGHRIAFGSFAIKSLEGGWITARQIEAARIAMTRAMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI VFPD P+T KP EVRMGKGKG  E WV  +KPG ILFE  GVS E A+ + RL
Sbjct: 61  EGQVWIRVFPDKPITQKPAEVRMGKGKGAPEYWVACIKPGTILFESGGVSIETAQESLRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL   TKFI R
Sbjct: 121 AAQKLPFKTKFIVR 134


>gi|239623354|ref|ZP_04666385.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47_FAA]
 gi|239522320|gb|EEQ62186.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47FAA]
          Length = 145

 Score =  192 bits (488), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 71/134 (52%), Positives = 85/134 (63%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K  KQF+G + G A  G+ I  G F L A E   I S++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKRRKQFRGSMAGKALRGNTISNGEFGLVATEPCWIKSNQIEAARVAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVTAKP E RMG GKG +E WV  VKPGR+LFEI GV EE AR A RL
Sbjct: 61  GGKVWIKIFPDKPVTAKPAETRMGSGKGALEYWVAVVKPGRVLFEIAGVPEETAREALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL    K   +
Sbjct: 121 AMHKLPCKCKIASK 134


>gi|126736607|ref|ZP_01752347.1| 50S ribosomal protein L16 [Roseobacter sp. CCS2]
 gi|126713920|gb|EBA10791.1| 50S ribosomal protein L16 [Roseobacter sp. CCS2]
          Length = 137

 Score =  192 bits (488), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 83/135 (61%), Positives = 103/135 (76%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGRI+G AKGGS + FG + LKA E  RI + +IEAARRA++R MKR
Sbjct: 1   MLQPKRTKHRKLHKGRIRGEAKGGSDLNFGTYGLKAIEPERITARQIEAARRAMTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPD PVT+KP EVRMGKGKG+++ W C+VKPGR++FEIDGVSE +AR A RL
Sbjct: 61  QGRVWIRIFPDTPVTSKPVEVRMGKGKGSIDFWACKVKPGRVMFEIDGVSEPIAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL + T+ I R 
Sbjct: 121 AAMKLPIKTRTIVRE 135


>gi|84685422|ref|ZP_01013320.1| 50S ribosomal protein L16 [Maritimibacter alkaliphilus HTCC2654]
 gi|84666579|gb|EAQ13051.1| 50S ribosomal protein L16 [Rhodobacterales bacterium HTCC2654]
          Length = 137

 Score =  192 bits (488), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 82/135 (60%), Positives = 105/135 (77%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGRIKG AKGGS + FG + LKA E  R+ + +IEAARRA++R MKR
Sbjct: 1   MLQPKRTKFRKMHKGRIKGQAKGGSDLNFGTYGLKALEPERVTARQIEAARRAMTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPDVP++AKP EVRMGKGKG+V++W  +VKPGR++FEIDGVS+E+AR A RL
Sbjct: 61  QGRVWIRIFPDVPISAKPIEVRMGKGKGSVDRWAAKVKPGRVMFEIDGVSDEIAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL + T+ + R 
Sbjct: 121 AAMKLPIKTRTVVRE 135


>gi|222085682|ref|YP_002544212.1| ribosomal protein L16 [Agrobacterium radiobacter K84]
 gi|254799171|sp|B9JDT5|RL16_AGRRK RecName: Full=50S ribosomal protein L16
 gi|221723130|gb|ACM26286.1| ribosomal protein L16 [Agrobacterium radiobacter K84]
          Length = 137

 Score =  192 bits (488), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 105/137 (76%), Positives = 119/137 (86%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TKY KQFKGRIKGVAKGGS + FG F LK+QE NR+ + EIEAARRAI+R MKR
Sbjct: 1   MLQPKRTKYRKQFKGRIKGVAKGGSDLAFGEFGLKSQEPNRVNAREIEAARRAITRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AGRVWI VFPDVPVTAKPTEVRMGKGKG+VE W C+VKPGR++FEIDGVSEE+AR A RL
Sbjct: 61  AGRVWIRVFPDVPVTAKPTEVRMGKGKGSVEYWACKVKPGRMMFEIDGVSEEIAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
           GAAKLSV T+F+QR+ E
Sbjct: 121 GAAKLSVKTRFVQRIAE 137


>gi|229577792|ref|YP_002836128.1| ribosomal protein L16 [Megaleranthis saniculifolia]
 gi|226933920|gb|ACO92053.1| ribosomal protein L16 [Megaleranthis saniculifolia]
          Length = 135

 Score =  192 bits (488), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 69/132 (52%), Positives = 97/132 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+RICFG +AL+A E   I S +IEA RRA++R  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGISYRGNRICFGGYALQALEPAWITSRQIEAGRRAMTRYARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +PTE RMG GKG+ E WV  VKPGRIL+E+ GVSE VAR A  +
Sbjct: 61  GGKIWVRIFPDKPVTVRPTETRMGSGKGSPEYWVSVVKPGRILYEMGGVSEIVAREAISI 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+F+
Sbjct: 121 AASKMPIRTQFV 132


>gi|15965116|ref|NP_385469.1| 50S ribosomal protein L16 [Sinorhizobium meliloti 1021]
 gi|227821763|ref|YP_002825733.1| 50S ribosomal protein L16 [Sinorhizobium fredii NGR234]
 gi|307314366|ref|ZP_07593972.1| ribosomal protein L16 [Sinorhizobium meliloti BL225C]
 gi|307322078|ref|ZP_07601454.1| ribosomal protein L16 [Sinorhizobium meliloti AK83]
 gi|81634726|sp|Q92QG3|RL16_RHIME RecName: Full=50S ribosomal protein L16
 gi|254799216|sp|C3MAY7|RL16_RHISN RecName: Full=50S ribosomal protein L16
 gi|15074296|emb|CAC45942.1| Probable 50S ribosomal protein L16 [Sinorhizobium meliloti 1021]
 gi|227340762|gb|ACP24980.1| 50S ribosomal protein L16 [Sinorhizobium fredii NGR234]
 gi|306892260|gb|EFN23070.1| ribosomal protein L16 [Sinorhizobium meliloti AK83]
 gi|306899064|gb|EFN29706.1| ribosomal protein L16 [Sinorhizobium meliloti BL225C]
          Length = 137

 Score =  192 bits (488), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 105/137 (76%), Positives = 119/137 (86%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TKY KQFKGRIKGVAKGGS + FG F LKAQE NR+ + EIEAARRAI+R MKR
Sbjct: 1   MLQPKRTKYRKQFKGRIKGVAKGGSDLAFGEFGLKAQEPNRVNAREIEAARRAITRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AGRVWI VFPDVPVTAKPTEVRMGKGKG+VE W C+VKPGR++FEIDGV+EE+AR A RL
Sbjct: 61  AGRVWIRVFPDVPVTAKPTEVRMGKGKGSVEYWACKVKPGRMMFEIDGVNEELAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
           GAAKLSV T+F+QR+ E
Sbjct: 121 GAAKLSVKTRFVQRIAE 137


>gi|154494387|ref|ZP_02033707.1| hypothetical protein PARMER_03742 [Parabacteroides merdae ATCC
           43184]
 gi|218262280|ref|ZP_03476803.1| hypothetical protein PRABACTJOHN_02477 [Parabacteroides johnsonii
           DSM 18315]
 gi|154085831|gb|EDN84876.1| hypothetical protein PARMER_03742 [Parabacteroides merdae ATCC
           43184]
 gi|218223503|gb|EEC96153.1| hypothetical protein PRABACTJOHN_02477 [Parabacteroides johnsonii
           DSM 18315]
          Length = 144

 Score =  191 bits (487), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 72/134 (53%), Positives = 98/134 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ +Q KGR+KG A+ G+++ FG+F +KA E   I   +IEAAR A++R M+R
Sbjct: 1   MLQPKKTKFRRQQKGRMKGEAQRGNQLAFGSFGIKALENKWITGRQIEAARIAVTRYMQR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VW+ +FPD P+T KP EVRMGKGKGN E +V  V PGR++FEI+GV  ++A+ A RL
Sbjct: 61  QGQVWVRIFPDKPITKKPAEVRMGKGKGNPEGFVAPVTPGRLIFEIEGVPFDIAKEALRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL V TKF+ R
Sbjct: 121 AAQKLPVTTKFVVR 134


>gi|311109605|ref|YP_003982458.1| 50S ribosomal protein L16 [Achromobacter xylosoxidans A8]
 gi|310764294|gb|ADP19743.1| ribosomal protein L16 [Achromobacter xylosoxidans A8]
          Length = 138

 Score =  191 bits (487), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 72/136 (52%), Positives = 98/136 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QP   KY K+ KGR  G+A  G+ + FG + LKA    R+ + +IEAARRAI+R +KR
Sbjct: 1   MLQPSRRKYRKEQKGRNTGLATRGTHVSFGEYGLKATGRGRLTARQIEAARRAINRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI +FPD P++ KP EVRMG GKGN E WV  ++PG++L+E++GVSEE+AR AFRL
Sbjct: 61  GGRIWIRIFPDKPISQKPAEVRMGNGKGNPEYWVAEIQPGKVLYEMEGVSEELAREAFRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + T F+ R +
Sbjct: 121 AAAKLPISTTFVARHI 136


>gi|290487876|gb|ADD30322.1| ribosomal protein L16 [Ilex cornuta]
          Length = 135

 Score =  191 bits (487), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 67/132 (50%), Positives = 97/132 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+ ICFG +AL+A E   I S +IEA RRA++R  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGISYRGNHICFGKYALQALEPAWITSRQIEAGRRAMTRNARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +PTE RMG GKG+ E WV  VKPGRIL+E+ GV+E +AR+A  +
Sbjct: 61  GGKIWVRIFPDKPVTVRPTETRMGSGKGSPEYWVAVVKPGRILYEMGGVTENIARKAISI 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+FI
Sbjct: 121 AASKMPIRTQFI 132


>gi|326385092|ref|ZP_08206762.1| 50S ribosomal protein L16 [Gordonia neofelifaecis NRRL B-59395]
 gi|326196177|gb|EGD53381.1| 50S ribosomal protein L16 [Gordonia neofelifaecis NRRL B-59395]
          Length = 138

 Score =  191 bits (487), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 63/135 (46%), Positives = 89/135 (65%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  K+ KQ    +KG AKGG+++ FG++ ++A E   I + +IE+AR AI+R +KR
Sbjct: 1   MLIPRRVKHRKQHHPSLKGRAKGGTKVTFGDYGIQALEGAYITNRQIESARIAINRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T KP E RMG GKG+ E WV  VKPGR+LFE+   +EE AR A R 
Sbjct: 61  GGKVWINIFPDRPITKKPAETRMGSGKGSPEWWVAPVKPGRVLFEMSYPNEETAREALRR 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL + T+ + R 
Sbjct: 121 AQHKLPIKTRIVTRE 135


>gi|116251547|ref|YP_767385.1| 50S ribosomal protein L16 [Rhizobium leguminosarum bv. viciae 3841]
 gi|209548942|ref|YP_002280859.1| 50S ribosomal protein L16 [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|241204172|ref|YP_002975268.1| 50S ribosomal protein L16 [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|115502780|sp|Q1MID4|RL16_RHIL3 RecName: Full=50S ribosomal protein L16
 gi|226712343|sp|B5ZYU2|RL16_RHILW RecName: Full=50S ribosomal protein L16
 gi|115256195|emb|CAK07276.1| putative 50S ribosomal protein L16 [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|209534698|gb|ACI54633.1| ribosomal protein L16 [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|240858062|gb|ACS55729.1| ribosomal protein L16 [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 137

 Score =  191 bits (487), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 104/137 (75%), Positives = 118/137 (86%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TKY KQFKGRIKGVAKGGS + FG F LKAQE NR+ + EIEAARRAI+R MKR
Sbjct: 1   MLQPKRTKYRKQFKGRIKGVAKGGSDLAFGEFGLKAQEPNRVNAREIEAARRAITRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AGRVWI VFPDVPVT KPTEVRMGKGKG+VE W C+VKPGR++FEIDGVSEE+AR A RL
Sbjct: 61  AGRVWIRVFPDVPVTKKPTEVRMGKGKGSVEYWACKVKPGRMMFEIDGVSEEIAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
           G+AKLSV T+F+QR+ E
Sbjct: 121 GSAKLSVKTRFVQRIAE 137


>gi|225387230|ref|ZP_03756994.1| hypothetical protein CLOSTASPAR_00982 [Clostridium asparagiforme
           DSM 15981]
 gi|225046709|gb|EEG56955.1| hypothetical protein CLOSTASPAR_00982 [Clostridium asparagiforme
           DSM 15981]
          Length = 145

 Score =  191 bits (487), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 70/134 (52%), Positives = 86/134 (64%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K  KQF+G + G A  G++I  G + L A E   I S++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKRRKQFRGSMAGKALRGNKISNGEYGLVATEPCWIKSNQIEAARVAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVTAKP E RMG GKG +E WV  VKPGR+LFEI GV EE AR A RL
Sbjct: 61  GGQVWIKIFPDKPVTAKPAETRMGSGKGALEYWVAVVKPGRVLFEIAGVPEETAREALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL    K   +
Sbjct: 121 AMHKLPCKCKIASK 134


>gi|110598094|ref|ZP_01386372.1| ribosomal protein L16 [Chlorobium ferrooxidans DSM 13031]
 gi|110340226|gb|EAT58723.1| ribosomal protein L16 [Chlorobium ferrooxidans DSM 13031]
          Length = 139

 Score =  191 bits (487), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 75/134 (55%), Positives = 92/134 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY K  +GR+KG +  G+ + FG+F LKA E+  I S +IEAAR A++R MKR
Sbjct: 1   MLMPKRVKYRKTMRGRMKGNSGRGTLVTFGSFGLKAIESAWITSRQIEAARVAMTRFMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVT K  E RMG GKG+ E WV  VKPGRI+FE DGV  EVA  AFRL
Sbjct: 61  DGKIWIRIFPDKPVTKKAAETRMGSGKGSPEFWVAVVKPGRIMFEADGVPREVATEAFRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + TKFI R
Sbjct: 121 AAQKLPIKTKFIVR 134


>gi|255020772|ref|ZP_05292830.1| LSU ribosomal protein L16p (L10e) [Acidithiobacillus caldus ATCC
           51756]
 gi|254969768|gb|EET27272.1| LSU ribosomal protein L16p (L10e) [Acidithiobacillus caldus ATCC
           51756]
          Length = 138

 Score =  191 bits (487), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 78/136 (57%), Positives = 102/136 (75%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QP  TK+ KQ KGR +G+A  G+++ FG + LKA    RI + ++EAARRAISR +KR
Sbjct: 1   MLQPNRTKFRKQHKGRNRGIATRGNKVSFGEYGLKAVTRGRITARQLEAARRAISRHVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI +FPD P++ KP EVRMGKGKGN E WV  ++PG++L+E++GVSEEVAR AF L
Sbjct: 61  GGRIWIRIFPDKPISKKPAEVRMGKGKGNPEYWVALIQPGKVLYEMEGVSEEVAREAFSL 120

Query: 122 GAAKLSVVTKFIQRVV 137
           GAAKL V T F+ R V
Sbjct: 121 GAAKLPVQTVFVSRRV 136


>gi|299541939|ref|ZP_07052262.1| 50S ribosomal protein L16 [Lysinibacillus fusiformis ZC1]
 gi|298725677|gb|EFI66318.1| 50S ribosomal protein L16 [Lysinibacillus fusiformis ZC1]
          Length = 144

 Score =  191 bits (487), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 70/135 (51%), Positives = 94/135 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY ++ +G ++G AKGG  + FG + L+AQ A+ I + +IE+AR A++R MKR
Sbjct: 1   MLLPKRVKYRREHRGNMRGEAKGGKEVTFGEWGLQAQTASWITNRQIESARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP  P T KP EVRMG GKG+ E WV  VKPG+++FEI GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPHKPYTKKPLEVRMGSGKGSPEGWVAVVKPGKVMFEIAGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL V  K ++R 
Sbjct: 121 ASHKLPVKCKIVKRQ 135


>gi|170748643|ref|YP_001754903.1| 50S ribosomal protein L16 [Methylobacterium radiotolerans JCM 2831]
 gi|226712322|sp|B1LWT3|RL16_METRJ RecName: Full=50S ribosomal protein L16
 gi|170655165|gb|ACB24220.1| ribosomal protein L16 [Methylobacterium radiotolerans JCM 2831]
          Length = 137

 Score =  191 bits (487), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 84/137 (61%), Positives = 105/137 (76%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK T++ KQFKGRI G AKGG  + FG F LKA E  R+ + +IEAARRAI+R MKR
Sbjct: 1   MLQPKKTRFRKQFKGRIHGAAKGGFELNFGQFGLKAVEPERVTARQIEAARRAITREMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI VFPDVPV++KPTEVRMG GKG  + W  RV PGRI+FE+DGV+E +A+ A RL
Sbjct: 61  QGRVWIRVFPDVPVSSKPTEVRMGSGKGAPDYWAARVHPGRIMFEVDGVAENIAKEALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
           GAAKL + T+ +QR+ +
Sbjct: 121 GAAKLPIRTRVVQRIAD 137


>gi|330850779|ref|YP_004376457.1| ribosomal protein L16 [Olea europaea subsp. europaea]
 gi|291059290|gb|ADD72126.1| ribosomal protein L16 [Olea europaea]
 gi|328795469|emb|CBR30351.1| ribosomal protein L16 [Olea europaea subsp. europaea]
          Length = 135

 Score =  191 bits (487), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 67/132 (50%), Positives = 96/132 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+ ICFG +AL+A E   I S +IEA RRA++R  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGISYRGNHICFGKYALQALEPAWITSRQIEAGRRAMTRNARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +P E RMG GKG+ E WV  VKPGRIL+E+ GV+E +ARRA  +
Sbjct: 61  GGKIWVRIFPDKPVTVRPAETRMGSGKGSPEYWVAVVKPGRILYEMGGVTENIARRAISI 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+FI
Sbjct: 121 AASKMPIRTQFI 132


>gi|114771262|ref|ZP_01448682.1| 50S ribosomal protein L16 [alpha proteobacterium HTCC2255]
 gi|114548187|gb|EAU51074.1| 50S ribosomal protein L16 [alpha proteobacterium HTCC2255]
          Length = 137

 Score =  191 bits (487), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 87/135 (64%), Positives = 106/135 (78%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ K FKGRIKG+AKGGS + FG+F LKA +  R+ + +IEAARRA++R MKR
Sbjct: 1   MLSPKRTKFRKMFKGRIKGLAKGGSDLNFGSFGLKATQPERVTARQIEAARRAMTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPDVPVT KPTEVRMGKGKG+VE W C+VKPGR++FEIDGVSE +A  A RL
Sbjct: 61  QGRVWIRIFPDVPVTNKPTEVRMGKGKGSVEYWACKVKPGRVMFEIDGVSEAIAVEALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL V T+ +QR 
Sbjct: 121 AAMKLPVKTRVVQRE 135


>gi|262203617|ref|YP_003274825.1| 50S ribosomal protein L16 [Gordonia bronchialis DSM 43247]
 gi|262086964|gb|ACY22932.1| ribosomal protein L16 [Gordonia bronchialis DSM 43247]
          Length = 138

 Score =  191 bits (487), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 64/135 (47%), Positives = 91/135 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  K+ KQ    +KG AKGG+++ FG+F ++A E+  I + +IE+AR AI+R +KR
Sbjct: 1   MLIPRRVKHRKQHHPSLKGQAKGGTKVTFGDFGIQALESAYITNRQIESARIAINRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T KP E RMG GKG+ E WV  VKPGR+LFE+   +EE+AR A R 
Sbjct: 61  GGKVWINIFPDRPLTKKPAETRMGSGKGSPEWWVAPVKPGRVLFEMTYPNEEIAREALRR 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL + T+ + R 
Sbjct: 121 AQHKLPIKTRIVTRE 135


>gi|21674991|ref|NP_663056.1| 50S ribosomal protein L16 [Chlorobium tepidum TLS]
 gi|81790496|sp|Q8KAH9|RL16_CHLTE RecName: Full=50S ribosomal protein L16
 gi|21648224|gb|AAM73398.1| ribosomal protein L16 [Chlorobium tepidum TLS]
          Length = 139

 Score =  191 bits (487), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 74/134 (55%), Positives = 93/134 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  +Y K  +GR+KG A+ G+ + FG+F LKA E   I S +IEAAR A++R MKR
Sbjct: 1   MLMPKRVQYRKTQRGRMKGNAQRGTAVTFGSFGLKAMEPAWITSRQIEAARIAMNRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PV+ KP E RMG GKG+ E WV  VKPGR++FE DGV  EVA  AFRL
Sbjct: 61  DGKIWIRIFPDKPVSKKPAETRMGSGKGSPEFWVAVVKPGRVMFEADGVPREVAVEAFRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + TKFI R
Sbjct: 121 AAKKLPIKTKFIVR 134


>gi|148655330|ref|YP_001275535.1| 50S ribosomal protein L16 [Roseiflexus sp. RS-1]
 gi|166215174|sp|A5USI2|RL16_ROSS1 RecName: Full=50S ribosomal protein L16
 gi|148567440|gb|ABQ89585.1| LSU ribosomal protein L16P [Roseiflexus sp. RS-1]
          Length = 141

 Score =  191 bits (487), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 68/135 (50%), Positives = 87/135 (64%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY KQ +G  +G+A  G+ + FG + L A EA  + S +IEAARRAIS  +KR
Sbjct: 1   MLMPKRVKYRKQQRGHNRGMAHRGNTVAFGEYGLMALEATWMTSRQIEAARRAISHHVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVTAKP E RMG GKG V+ +V  +KPGRILFE+ GV  EVA  A   
Sbjct: 61  GGKIWIRIFPDKPVTAKPAETRMGSGKGAVDHYVAVIKPGRILFELAGVRPEVAHEALER 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL +  K + R 
Sbjct: 121 AAQKLPIKCKIVPRE 135


>gi|94985960|ref|YP_605324.1| 50S ribosomal protein L16 [Deinococcus geothermalis DSM 11300]
 gi|115502744|sp|Q1IX79|RL16_DEIGD RecName: Full=50S ribosomal protein L16
 gi|94556241|gb|ABF46155.1| ribosomal protein L16 [Deinococcus geothermalis DSM 11300]
          Length = 141

 Score =  191 bits (487), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 73/136 (53%), Positives = 94/136 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY KQF+GR+ G  KGG  + FG++ L A E   I S++IEA R  +SR  +R
Sbjct: 1   MLLPKRTKYRKQFRGRMTGDTKGGDYVAFGDYGLVALEPAWIKSNQIEACRIVMSRHFRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+++I +FPD PVT KP E RMGKGKG VE WV  VKPGR++FE+ GV+EE AR AFRL
Sbjct: 61  GGKIYIRIFPDKPVTKKPAETRMGKGKGAVEYWVSVVKPGRVMFEVSGVTEEQAREAFRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
              KL + TK ++R V
Sbjct: 121 AGHKLPIQTKMVKREV 136


>gi|258591323|emb|CBE67622.1| 50S ribosomal subunit protein L16 [NC10 bacterium 'Dutch sediment']
          Length = 139

 Score =  191 bits (487), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 71/136 (52%), Positives = 95/136 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQ +GR  G+A  GS + FG + LKA EA  I + +IEAARRA++R +KR
Sbjct: 1   MLAPKRVKFRKQHRGRRSGIAVAGSALAFGEYGLKALEAAWITNRQIEAARRAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T KP E RMGKGKG  E WV  VKPGR+L E++GV+E +A+ A RL
Sbjct: 61  GGKVWIRIFPDKPITKKPAETRMGKGKGAPEGWVAVVKPGRVLCEMEGVTEAIAKEAMRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            A KL + T+F+ R +
Sbjct: 121 AAHKLPISTRFVSRTM 136


>gi|229576655|sp|B1X501|RK16_PAUCH RecName: Full=50S ribosomal protein L16, organellar chromatophore
          Length = 149

 Score =  191 bits (487), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 72/134 (53%), Positives = 94/134 (70%), Gaps = 2/134 (1%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQ +GR++G+A  G+ I FG FAL+AQE   I S +IEA+RRA++R +KR
Sbjct: 1   MLSPKRVKFRKQQRGRMRGIATRGNTIAFGQFALQAQECGWITSRQIEASRRAMTRYVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDG--VSEEVARRAF 119
            GR+WI VFPD PVT +  E RMG GKGN E WV  +KPGRILFE+ G  ++E +AR A 
Sbjct: 61  GGRIWIRVFPDKPVTMRAAETRMGSGKGNPEFWVAVIKPGRILFEMGGPEITETIAREAM 120

Query: 120 RLGAAKLSVVTKFI 133
           RL   KL + TKF+
Sbjct: 121 RLAQYKLPLKTKFL 134


>gi|266620256|ref|ZP_06113191.1| ribosomal protein L16 [Clostridium hathewayi DSM 13479]
 gi|288868159|gb|EFD00458.1| ribosomal protein L16 [Clostridium hathewayi DSM 13479]
          Length = 145

 Score =  191 bits (487), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 70/134 (52%), Positives = 85/134 (63%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K  KQF+G + G A  G+ I  G + L A E   I S++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKRRKQFRGSMAGKALRGNTISNGEYGLVALEPCWIKSNQIEAARVAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVTAKP E RMG GKG +E WV  VKPGR+LFEI GV EE AR A RL
Sbjct: 61  GGKVWIKIFPDKPVTAKPAETRMGSGKGALEYWVAVVKPGRVLFEIAGVPEETAREALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL    K   +
Sbjct: 121 AMHKLPCRCKIAAK 134


>gi|326792600|ref|YP_004310421.1| ribosomal protein L16 [Clostridium lentocellum DSM 5427]
 gi|326543364|gb|ADZ85223.1| ribosomal protein L16 [Clostridium lentocellum DSM 5427]
          Length = 146

 Score =  191 bits (486), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 68/134 (50%), Positives = 93/134 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K  KQ +GR+KG A  G++I +G + + A E + + S++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKRRKQSRGRMKGQATRGNKITYGEYGIVAMEPSWVKSNQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVTA P E RMGKGKG+V+ WV  VKPGR++FE+ GV+EE AR A RL
Sbjct: 61  GGKVWIKIFPDKPVTATPAETRMGKGKGSVDYWVAVVKPGRVMFELSGVAEETAREALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL +  K + R
Sbjct: 121 AVHKLPMKCKIVSR 134


>gi|115525578|ref|YP_782489.1| 50S ribosomal protein L16 [Rhodopseudomonas palustris BisA53]
 gi|122940698|sp|Q07KM5|RL16_RHOP5 RecName: Full=50S ribosomal protein L16
 gi|115519525|gb|ABJ07509.1| LSU ribosomal protein L16P [Rhodopseudomonas palustris BisA53]
          Length = 137

 Score =  191 bits (486), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 82/137 (59%), Positives = 102/137 (74%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGRI GVA  G+ + FG F LKA    RI + +IEAARRA++R MKR
Sbjct: 1   MMQPKKTKFRKAHKGRIHGVASSGATLSFGQFGLKAMAPERITARQIEAARRALTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AGRVWI +FPDVPV+ KP EVRMG GKG+ E WV RVKPGR++FEIDGV+ ++AR A  L
Sbjct: 61  AGRVWIRIFPDVPVSKKPAEVRMGSGKGSPELWVARVKPGRVIFEIDGVNLQIAREALTL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            AAKL + T+F+ R+ E
Sbjct: 121 AAAKLPIKTRFVARIAE 137


>gi|290487874|gb|ADD30321.1| ribosomal protein L16 [Ehretia acuminata]
          Length = 135

 Score =  191 bits (486), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 67/132 (50%), Positives = 96/132 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+ ICFG +AL+A E   I S +IEA RRA++R  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGISYRGNHICFGKYALQALEPAWITSRQIEAGRRAMTRNARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +P E RMG GKG+ E WV  VKPGRIL+E+ GV+E +ARRA  +
Sbjct: 61  GGKIWVRIFPDKPVTLRPAETRMGSGKGSPEYWVAVVKPGRILYEMSGVTENIARRAISI 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+FI
Sbjct: 121 AASKMPIQTQFI 132


>gi|323340381|ref|ZP_08080638.1| 50S ribosomal protein L16 [Lactobacillus ruminis ATCC 25644]
 gi|323092157|gb|EFZ34772.1| 50S ribosomal protein L16 [Lactobacillus ruminis ATCC 25644]
          Length = 143

 Score =  191 bits (486), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 69/136 (50%), Positives = 95/136 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ ++F+G+++G AKGG  + FG F L+A +++ I + +IEAAR A++R MKR
Sbjct: 1   MLVPKRVKHRREFRGKMRGEAKGGKEVVFGEFGLQALDSHWITNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP    TAK   VRMG GKG  E WV  VK G+++FEI GVSEE+AR A RL
Sbjct: 61  GGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVAPVKRGKVMFEIGGVSEEIAREALRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            + KL V TKF++R V
Sbjct: 121 ASHKLPVKTKFVKREV 136


>gi|323148866|ref|YP_004221958.1| ribosomal protein L16 [Erodium carvifolium]
 gi|316926330|gb|ADU58183.1| ribosomal protein L16 [Erodium carvifolium]
          Length = 143

 Score =  191 bits (486), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 66/134 (49%), Positives = 95/134 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ KQ +G+++GVA  GS I FG +AL+A E   I S +IEA RRA++R ++R
Sbjct: 1   MLSPKRTKFRKQHRGKMRGVASRGSCISFGRYALQALEPAWITSRQIEAGRRAMTRNVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +  E RMG GKG+ E WV  VKPGRIL+E+ GV+E +AR+A  +
Sbjct: 61  GGKIWVRIFPDKPVTVRSAETRMGSGKGSPEYWVAVVKPGRILYEMGGVAENIARKAIEI 120

Query: 122 GAAKLSVVTKFIQR 135
             +K+ + T+FI R
Sbjct: 121 AGSKMPIRTQFISR 134


>gi|312130542|ref|YP_003997882.1| lsu ribosomal protein l16p [Leadbetterella byssophila DSM 17132]
 gi|311907088|gb|ADQ17529.1| LSU ribosomal protein L16P [Leadbetterella byssophila DSM 17132]
          Length = 139

 Score =  191 bits (486), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 76/134 (56%), Positives = 95/134 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK T++ K+ KGRIKG+A  G +I FG+FA+K+ E  RI + +IEAAR  ++R MKR
Sbjct: 1   MLQPKRTRFRKRQKGRIKGIASRGHQIAFGSFAIKSLEPGRITARQIEAARIGVTRAMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T KP EVRMGKGKG  E WV  V PG ILFE  GV  E+A+ A RL
Sbjct: 61  EGQVWIRIFPDNPITQKPLEVRMGKGKGAPEYWVANVYPGTILFECTGVPLELAKEALRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL V TKF+ R
Sbjct: 121 AAQKLPVKTKFVVR 134


>gi|293602628|ref|ZP_06685071.1| 50S ribosomal protein L16 [Achromobacter piechaudii ATCC 43553]
 gi|292819000|gb|EFF78038.1| 50S ribosomal protein L16 [Achromobacter piechaudii ATCC 43553]
          Length = 138

 Score =  191 bits (486), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 73/136 (53%), Positives = 98/136 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QP   KY K+ KGR  G+A  G+ + FG F LKA    R+ + +IEAARRAI+R +KR
Sbjct: 1   MLQPSRRKYRKEQKGRNTGLATRGTHVSFGEFGLKATGRGRLTARQIEAARRAINRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI +FPD P++ KP EVRMG GKGN E WV  ++PG++L+E++GVSEE+AR AFRL
Sbjct: 61  GGRIWIRIFPDKPISQKPAEVRMGNGKGNPEYWVAEIQPGKVLYEMEGVSEEIAREAFRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + T F+ R +
Sbjct: 121 AAAKLPISTTFVARHI 136


>gi|290487904|gb|ADD30336.1| ribosomal protein L16 [Heuchera sanguinea]
          Length = 134

 Score =  191 bits (486), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 66/132 (50%), Positives = 96/132 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+ ICFG +AL+A E   I S +IEA RRA++R  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGISYRGNHICFGRYALQALEPAWITSRQIEAGRRAMTRNARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +P E RMG GKG+ E WV  VKPGRIL+E+ GV+E +AR+A  +
Sbjct: 61  GGKIWVRIFPDKPVTVRPAETRMGSGKGSPEYWVAVVKPGRILYEMGGVTENIARKAISI 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+FI
Sbjct: 121 AASKMPIRTQFI 132


>gi|28261754|ref|NP_783268.1| ribosomal protein L16 [Atropa belladonna]
 gi|75248023|sp|Q8S8V6|RK16_ATRBE RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|20068368|emb|CAC88081.1| ribosomal protein L16 [Atropa belladonna]
          Length = 134

 Score =  191 bits (486), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 67/132 (50%), Positives = 95/132 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+ I FG +AL+A E   I S +IEA RRA++R  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGISYRGNHISFGKYALQALEPAWITSRQIEAGRRAMTRNARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +P E RMG GKG+ E WV  VKPGRIL+E+ GV+E +ARRA  L
Sbjct: 61  GGKIWVRIFPDKPVTLRPAETRMGSGKGSPEYWVAVVKPGRILYEMGGVTENIARRAISL 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+FI
Sbjct: 121 AASKMPIRTQFI 132


>gi|290487870|gb|ADD30319.1| ribosomal protein L16 [Aucuba japonica]
          Length = 135

 Score =  191 bits (486), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 68/132 (51%), Positives = 97/132 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+ ICFG +AL+A E   I S +IEA RRA++R  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGISYRGNHICFGKYALQALEPAWITSRQIEAGRRAMTRNARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +PTE RMG GKG+ E WV  VKPGRIL+E+ GV+E +ARRA  +
Sbjct: 61  GGKIWVRIFPDKPVTIRPTETRMGSGKGSPEYWVAVVKPGRILYEMGGVTENIARRAISI 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+FI
Sbjct: 121 AASKMPIRTQFI 132


>gi|94968261|ref|YP_590309.1| 50S ribosomal protein L16 [Candidatus Koribacter versatilis
           Ellin345]
 gi|115502727|sp|Q1ISB5|RL16_ACIBL RecName: Full=50S ribosomal protein L16
 gi|94550311|gb|ABF40235.1| LSU ribosomal protein L16P [Candidatus Koribacter versatilis
           Ellin345]
          Length = 139

 Score =  191 bits (486), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 69/135 (51%), Positives = 90/135 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY KQ +GR++G A  GS + FG+F LK  E   I   +IEA+R A++R +KR
Sbjct: 1   MLMPKKVKYRKQQRGRMRGKAWRGSELSFGDFGLKVLEPGWISDRQIEASRVAMTRFIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVT KP E RMGKGKG  + WV  V+PG+ILFE++GVS   A  A RL
Sbjct: 61  GGKIWIRLFPDKPVTKKPAETRMGKGKGAPDHWVAVVRPGKILFEMEGVSVTDAAEAMRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL + TKF+ R 
Sbjct: 121 AAHKLPLRTKFVARE 135


>gi|11466364|ref|NP_038367.1| ribosomal protein L16 [Mesostigma viride]
 gi|14548228|sp|Q9MUU3|RK16_MESVI RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|7259507|gb|AAF43808.1|AF166114_20 ribosomal protein L16 [Mesostigma viride]
          Length = 136

 Score =  191 bits (486), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 65/136 (47%), Positives = 93/136 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ +  +G+++GVA  G+++ FG+F LK  E   + S +IEA RRA++R  +R
Sbjct: 1   MLSPKRTKFRRHHRGKMRGVATRGNKVSFGDFGLKTLEPGWLTSRQIEAGRRAMTRYTRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD PVT +P E RMG GKG+ E WV  VKPG IL+E+ GV+ E+AR A R+
Sbjct: 61  GGQLWIRVFPDKPVTIRPAETRMGSGKGSPEYWVAVVKPGTILYEMKGVTPEIARSAMRV 120

Query: 122 GAAKLSVVTKFIQRVV 137
              K+ V T+F+ R V
Sbjct: 121 AGFKMPVKTQFVVRDV 136


>gi|325293329|ref|YP_004279193.1| 50S ribosomal protein L16 [Agrobacterium sp. H13-3]
 gi|325061182|gb|ADY64873.1| 50S ribosomal protein L16 [Agrobacterium sp. H13-3]
          Length = 137

 Score =  191 bits (486), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 104/137 (75%), Positives = 118/137 (86%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TKY KQFKGRIKGVAKGG  + FG F LK+QE NR+ + EIEAARRAI+R MKR
Sbjct: 1   MLQPKRTKYRKQFKGRIKGVAKGGFDLAFGEFGLKSQEPNRVNAREIEAARRAITRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AGRVWI VFPDVPVTAKPTEVRMGKGKG+VE W C+VKPGR++FEIDGVSEE+AR A RL
Sbjct: 61  AGRVWIRVFPDVPVTAKPTEVRMGKGKGSVEYWACKVKPGRMMFEIDGVSEEIAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
           GAAKLSV T+F+QR+ E
Sbjct: 121 GAAKLSVKTRFVQRIAE 137


>gi|313680508|ref|YP_004058247.1| LSU ribosomal protein l16p [Oceanithermus profundus DSM 14977]
 gi|313153223|gb|ADR37074.1| LSU ribosomal protein L16P [Oceanithermus profundus DSM 14977]
          Length = 141

 Score =  191 bits (485), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 71/134 (52%), Positives = 93/134 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY KQ +G ++G  KGG  + FG + L A E + I + +IEAAR A+ R  +R
Sbjct: 1   MLMPKRLKYRKQHRGNMRGATKGGDYVAFGEYGLVALEPSWISNRQIEAARVAMVRHFRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+++I +FPD P T KP EVRMGKGKGNVE WV  VKPGR++FE+ GV+EE AR AFRL
Sbjct: 61  GGKIYIRIFPDKPFTKKPLEVRMGKGKGNVEGWVAVVKPGRVMFEVAGVTEEQAREAFRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL + TKF++R
Sbjct: 121 AGHKLPIKTKFVKR 134


>gi|150008977|ref|YP_001303720.1| 50S ribosomal protein L16 [Parabacteroides distasonis ATCC 8503]
 gi|255014808|ref|ZP_05286934.1| 50S ribosomal protein L16 [Bacteroides sp. 2_1_7]
 gi|256841022|ref|ZP_05546529.1| ribosomal protein L10.e [Parabacteroides sp. D13]
 gi|262383867|ref|ZP_06077003.1| 50S ribosomal protein L16 [Bacteroides sp. 2_1_33B]
 gi|298375790|ref|ZP_06985746.1| ribosomal protein L16 [Bacteroides sp. 3_1_19]
 gi|301312026|ref|ZP_07217948.1| ribosomal protein L16 [Bacteroides sp. 20_3]
 gi|166199697|sp|A6LEI4|RL16_PARD8 RecName: Full=50S ribosomal protein L16
 gi|149937401|gb|ABR44098.1| 50S ribosomal protein L16 [Parabacteroides distasonis ATCC 8503]
 gi|256736865|gb|EEU50192.1| ribosomal protein L10.e [Parabacteroides sp. D13]
 gi|262294765|gb|EEY82697.1| 50S ribosomal protein L16 [Bacteroides sp. 2_1_33B]
 gi|298266827|gb|EFI08484.1| ribosomal protein L16 [Bacteroides sp. 3_1_19]
 gi|300830128|gb|EFK60776.1| ribosomal protein L16 [Bacteroides sp. 20_3]
          Length = 144

 Score =  191 bits (485), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 71/134 (52%), Positives = 98/134 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ +Q KGR+KG A+ G+++ FG+F +K+ E   I   +IEAAR A++R M+R
Sbjct: 1   MLQPKKTKFRRQQKGRMKGEAQRGNQLAFGSFGIKSLENKWITGRQIEAARIAVTRYMQR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VW+ +FPD P+T KP EVRMGKGKGN E +V  V PGR++FEI+GV  ++A+ A RL
Sbjct: 61  QGQVWVRIFPDKPITKKPAEVRMGKGKGNPEGFVAPVTPGRLIFEIEGVPFDIAKEALRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL V TKF+ R
Sbjct: 121 AAQKLPVTTKFVVR 134


>gi|108773166|ref|YP_635676.1| ribosomal protein L16 [Solanum tuberosum]
 gi|88656840|gb|ABD47093.1| ribosomal protein L16 [Solanum tuberosum]
          Length = 134

 Score =  191 bits (485), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 67/132 (50%), Positives = 95/132 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+ I FG +AL+A E   I S +IEA RRA++R  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGISSRGNHISFGKYALQALEPAWITSRQIEAGRRAMTRNARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +P E RMG GKG+ E WV  VKPGRIL+E+ GV+E +ARRA  L
Sbjct: 61  GGKIWVRIFPDKPVTLRPAETRMGSGKGSPEYWVAVVKPGRILYEMGGVTENIARRAISL 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+FI
Sbjct: 121 AASKMPIRTQFI 132


>gi|257784956|ref|YP_003180173.1| 50S ribosomal protein L16 [Atopobium parvulum DSM 20469]
 gi|257473463|gb|ACV51582.1| ribosomal protein L16 [Atopobium parvulum DSM 20469]
          Length = 141

 Score =  191 bits (485), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 71/134 (52%), Positives = 95/134 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK   + K  +G +KG AKG +++ FG + ++A+EA+ I + +IEAAR A++R MKR
Sbjct: 1   MLAPKRVLHRKVQRGSMKGQAKGNTQLHFGTWGIRAEEAHWITNRQIEAARIALTREMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T KP E RMG GKGN E+WV  VKPGRI+FEIDGV EEVAR A RL
Sbjct: 61  GGKVWITIFPDKPITKKPAETRMGSGKGNPEEWVAVVKPGRIMFEIDGVPEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL + TK + +
Sbjct: 121 AQHKLPIKTKIVSK 134


>gi|163859266|ref|YP_001633564.1| 50S ribosomal protein L16 [Bordetella petrii DSM 12804]
 gi|226710685|sp|A9IIY9|RL16_BORPD RecName: Full=50S ribosomal protein L16
 gi|163262994|emb|CAP45297.1| 50S ribosomal protein L16 [Bordetella petrii]
 gi|317401544|gb|EFV82173.1| 50S ribosomal protein L16 [Achromobacter xylosoxidans C54]
          Length = 138

 Score =  191 bits (485), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 73/136 (53%), Positives = 98/136 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QP   KY K+ KGR  G+A  G+ + FG F LKA    R+ + +IEAARRAI+R +KR
Sbjct: 1   MLQPSRRKYRKEQKGRNTGLATRGTHVSFGEFGLKATGRGRLTARQIEAARRAINRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI +FPD P++ KP EVRMG GKGN E WV  ++PG++L+E++GVSEE+AR AFRL
Sbjct: 61  GGRIWIRIFPDKPISQKPAEVRMGNGKGNPEYWVAEIQPGKVLYEMEGVSEELAREAFRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + T F+ R +
Sbjct: 121 AAAKLPISTTFVARHI 136


>gi|34499634|ref|NP_903849.1| 50S ribosomal protein L16 [Chromobacterium violaceum ATCC 12472]
 gi|81654189|sp|Q7NQF9|RL16_CHRVO RecName: Full=50S ribosomal protein L16
 gi|34105484|gb|AAQ61839.1| 50S ribosomal protein L16 [Chromobacterium violaceum ATCC 12472]
          Length = 138

 Score =  191 bits (485), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 73/136 (53%), Positives = 101/136 (74%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QP   KY KQ KGR  G+A  G+++ FG+F LKA    R+ + +IEAARRA++R +KR
Sbjct: 1   MLQPTRLKYRKQHKGRNTGIATRGNKVSFGDFGLKAIGRGRLTARQIEAARRAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI +FPD P+T+KP EVRMG GKG+ E +V  ++PG++L+E+DGVSEE+AR AFRL
Sbjct: 61  GGRIWIRIFPDKPITSKPAEVRMGGGKGSPEYYVAEIQPGKMLYEMDGVSEELAREAFRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + T F+ + V
Sbjct: 121 AAAKLPIATVFVTKQV 136


>gi|290487882|gb|ADD30325.1| ribosomal protein L16 [Nelumbo nucifera]
          Length = 135

 Score =  191 bits (485), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 70/132 (53%), Positives = 97/132 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+RICFG +AL+A E   I S +IEA RRA++R  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGISYRGNRICFGRYALQALEPAWITSRQIEAGRRAMTRYARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVT +PTE RMG GKG+ E WV  VKPGRIL+E+ GVSE VAR A  +
Sbjct: 61  GGKIWIRIFPDKPVTIRPTETRMGSGKGSPEYWVSVVKPGRILYEMGGVSEIVAREAISI 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+F+
Sbjct: 121 AASKMPIRTQFV 132


>gi|291562761|emb|CBL41577.1| LSU ribosomal protein L16P [butyrate-producing bacterium SS3/4]
          Length = 145

 Score =  191 bits (485), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 68/134 (50%), Positives = 85/134 (63%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K  KQF+G + G A  G+ I  G + L A E   I S++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKRRKQFRGTMAGKALRGNTISNGEYGLVALEPCWIKSNQIEAARVAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVTAKP E RMG GKG +E WV  VKPGR++FEI GV EE A+ A RL
Sbjct: 61  GGKVWIKIFPDKPVTAKPAETRMGSGKGALEYWVAVVKPGRVMFEIAGVPEETAKEALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL    K   +
Sbjct: 121 AMHKLPCKCKIASK 134


>gi|313204924|ref|YP_004043581.1| LSU ribosomal protein l16p [Paludibacter propionicigenes WB4]
 gi|312444240|gb|ADQ80596.1| LSU ribosomal protein L16P [Paludibacter propionicigenes WB4]
          Length = 144

 Score =  191 bits (485), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 71/134 (52%), Positives = 99/134 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ +Q KGR+KG A+ G+++ FG+F +K+ E+  +   +IEAAR A++R M+R
Sbjct: 1   MLQPKKTKFRRQQKGRMKGNAQRGNQLAFGSFGIKSLESKWLTGRQIEAARIAVTRYMQR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD P+T KP EVRMGKGKG  E +V  + PGR+LFE++GVS E+A+ A RL
Sbjct: 61  QGQIWIRVFPDKPITKKPAEVRMGKGKGAPEGFVAPITPGRMLFEVEGVSYEIAKEALRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL V TKF+ R
Sbjct: 121 AAQKLPVTTKFVVR 134


>gi|217077290|ref|YP_002335008.1| 50S ribosomal protein L16 [Thermosipho africanus TCF52B]
 gi|226712366|sp|B7IHV3|RL16_THEAB RecName: Full=50S ribosomal protein L16
 gi|217037145|gb|ACJ75667.1| ribosomal protein L16 [Thermosipho africanus TCF52B]
          Length = 142

 Score =  191 bits (485), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 70/134 (52%), Positives = 93/134 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY KQ +GR+KG AKGG+ + FG + LKA E++ I + +IEA R AI+R +K+
Sbjct: 1   MLMPKRVKYRKQHRGRMKGNAKGGALVNFGEYGLKAMESHWITAQQIEACRIAITRTLKK 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD   T  P E ++GKGKGNVE WV  VKPG+ILFEI GV E++AR A   
Sbjct: 61  TGKLWIRVFPDKSYTKHPAESKLGKGKGNVEGWVAVVKPGKILFEIGGVDEKLAREALEY 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + TK ++R
Sbjct: 121 AATKLPIRTKIVKR 134


>gi|208751307|gb|ACI31266.1| ribosomal protein L16 [Volvox carteri]
 gi|261888166|gb|ACY06021.1| ribosomal protein L16 [Volvox carteri f. nagariensis]
          Length = 136

 Score =  191 bits (485), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 65/136 (47%), Positives = 92/136 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY K  +G ++G A  G+ I FG+FAL+AQE   I S +IEA RR ++R ++R
Sbjct: 1   MLSPKRTKYRKPHRGHLRGKATRGNTIVFGDFALQAQEPCWITSRQIEAGRRVLTRYVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD  VT +P   RMG GKG  + WV  V PG+IL+E+ GVSE +AR+A R+
Sbjct: 61  GGKLWIRIFPDKAVTMRPAGTRMGSGKGAPDYWVAVVHPGKILYEMQGVSETIARQAMRI 120

Query: 122 GAAKLSVVTKFIQRVV 137
            A K+ V TKF+ + +
Sbjct: 121 AAYKMPVKTKFLTKNI 136


>gi|160881778|ref|YP_001560746.1| 50S ribosomal protein L16 [Clostridium phytofermentans ISDg]
 gi|189041455|sp|A9KJI7|RL16_CLOPH RecName: Full=50S ribosomal protein L16
 gi|160430444|gb|ABX44007.1| ribosomal protein L16 [Clostridium phytofermentans ISDg]
          Length = 145

 Score =  191 bits (485), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 69/134 (51%), Positives = 89/134 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K  KQF+G + G A  G+ I  G + + A E+  I S++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKRRKQFRGSMAGKAMRGNTISHGEYGIVAMESAWIKSNQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT KP E RMG GKG++E WV  VKPGR++FEI GV+EE AR A RL
Sbjct: 61  GGKVWIKIFPDKPVTTKPAETRMGSGKGSLEYWVAVVKPGRVMFEIAGVAEETAREALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL V  K + R
Sbjct: 121 ATHKLPVKCKIVSR 134


>gi|27380504|ref|NP_772033.1| 50S ribosomal protein L16 [Bradyrhizobium japonicum USDA 110]
 gi|81736395|sp|Q89J91|RL16_BRAJA RecName: Full=50S ribosomal protein L16
 gi|27353668|dbj|BAC50658.1| 50S ribosomal protein L16 [Bradyrhizobium japonicum USDA 110]
          Length = 136

 Score =  191 bits (485), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 82/136 (60%), Positives = 102/136 (75%)

Query: 3   RQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKRA 62
            QPK TK+ K  KGRI GVA  G+ + FG + LKA E  R+ + +IEAARRA++R MKRA
Sbjct: 1   MQPKKTKFRKAHKGRIHGVASSGATLAFGQYGLKATEPERVTARQIEAARRALTRHMKRA 60

Query: 63  GRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRLG 122
           GRVWI VFPD+PV+ KP EVRMG GKG+ E WV RVKPGR+LFEIDGV+ + AR A  L 
Sbjct: 61  GRVWIRVFPDLPVSKKPAEVRMGSGKGSPELWVARVKPGRVLFEIDGVNTQTAREALTLA 120

Query: 123 AAKLSVVTKFIQRVVE 138
           AAKL + T+F++R+ E
Sbjct: 121 AAKLPIKTRFVERIAE 136


>gi|227876208|ref|ZP_03994324.1| ribosomal protein L16 [Mobiluncus mulieris ATCC 35243]
 gi|269976886|ref|ZP_06183860.1| ribosomal protein L16 [Mobiluncus mulieris 28-1]
 gi|306819484|ref|ZP_07453191.1| 50S ribosomal protein L16 [Mobiluncus mulieris ATCC 35239]
 gi|307701225|ref|ZP_07638247.1| ribosomal protein L16 [Mobiluncus mulieris FB024-16]
 gi|227843169|gb|EEJ53362.1| ribosomal protein L16 [Mobiluncus mulieris ATCC 35243]
 gi|269934717|gb|EEZ91277.1| ribosomal protein L16 [Mobiluncus mulieris 28-1]
 gi|304647776|gb|EFM45094.1| 50S ribosomal protein L16 [Mobiluncus mulieris ATCC 35239]
 gi|307613619|gb|EFN92866.1| ribosomal protein L16 [Mobiluncus mulieris FB024-16]
          Length = 138

 Score =  191 bits (485), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 67/135 (49%), Positives = 90/135 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+ TK+ +Q +    G AKGG+ I FG F ++A E   + + +IEAAR A++R +KR
Sbjct: 1   MLIPRRTKWRRQHRPGRSGYAKGGTEIAFGEFGIQALEGAYLTNRQIEAARIAVTRHVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T KP E RMG GKG+VE WV  VKPGRIL EI GVSEE+AR A   
Sbjct: 61  GGKIWINIFPDRPLTKKPAETRMGSGKGSVEWWVAPVKPGRILLEISGVSEELAREALSR 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL + T+F+ R 
Sbjct: 121 AQHKLPIKTRFVTRE 135


>gi|323149190|ref|YP_004222019.1| ribosomal protein L16 [Coccomyxa sp. C-169]
 gi|317467246|gb|ADV29867.1| ribosomal protein L16 [Coccomyxa sp. C-169]
          Length = 135

 Score =  191 bits (485), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 66/134 (49%), Positives = 95/134 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ KQ +GR+KG A  G+++ FG+FAL+A E   I S +IEA RRA++R  +R
Sbjct: 1   MLSPKRTKFRKQQRGRMKGKALRGNKVSFGDFALQALEPCWITSRQIEAGRRAMTRYARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVT +  + RMG GKG+ E WV  VKPG+IL+E+ GVSE VAR A R+
Sbjct: 61  GGKLWIRIFPDKPVTMRAADTRMGSGKGSPEYWVAVVKPGKILYEMKGVSEAVARAAMRI 120

Query: 122 GAAKLSVVTKFIQR 135
            + K+ + T+F+ +
Sbjct: 121 ASYKMPIKTQFVVK 134


>gi|311748507|ref|ZP_07722292.1| ribosomal protein L16 [Algoriphagus sp. PR1]
 gi|126577023|gb|EAZ81271.1| ribosomal protein L16 [Algoriphagus sp. PR1]
          Length = 139

 Score =  191 bits (485), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 78/134 (58%), Positives = 96/134 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TKY K  KGR+KG+A+ G  + FGNF +K+ EA  I S +IEAAR A++R MKR
Sbjct: 1   MLQPKRTKYRKMQKGRVKGIAQRGHTLSFGNFGIKSLEAGWITSRQIEAARIAMTRAMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T KP EVRMGKGKG  E WV  +KPG ILFE  GVS+E+A+ A RL
Sbjct: 61  EGQVWIRIFPDKPITKKPAEVRMGKGKGAPEYWVAVIKPGTILFEATGVSKELAQEALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL V TKF+ R
Sbjct: 121 AQQKLPVSTKFVVR 134


>gi|60117157|ref|YP_209491.1| ribosomal protein L16 [Huperzia lucidula]
 gi|75286717|sp|Q5SD18|RK16_HUPLU RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|50659965|gb|AAT80687.1| ribosomal protein L16 [Huperzia lucidula]
          Length = 142

 Score =  191 bits (485), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 69/133 (51%), Positives = 93/133 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ KQ +GR+ GV+  G+RICFG FAL+A E   I S +IEA RRAI+R  +R
Sbjct: 1   MLSPKRTKFRKQHRGRLGGVSTRGNRICFGRFALQALEPAWITSRQIEAGRRAITRYARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T +P E RMG GKG+ E WV  VKPGRIL+E+ G+ E +AR A ++
Sbjct: 61  GGKIWIRIFPDKPITVRPAETRMGSGKGSPEYWVSVVKPGRILYEVGGIPETIARAAMKI 120

Query: 122 GAAKLSVVTKFIQ 134
            A K+ V T+ I 
Sbjct: 121 AAYKMPVRTQIIV 133


>gi|91214178|ref|YP_538802.1| ribosomal protein L16 [Glycine max]
 gi|115502631|sp|Q2PMP8|RK16_SOYBN RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|83595779|gb|ABC25160.1| ribosomal protein L16 [Glycine max]
          Length = 135

 Score =  191 bits (485), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 65/132 (49%), Positives = 97/132 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+ T++ KQ +GR+KG++  G+ ICFG +AL+A E   I S +IEA RRA+SR ++R
Sbjct: 1   MLSPQRTRFRKQHRGRMKGISYRGNHICFGRYALQALEPAWITSRQIEAGRRAMSRNVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +PTE RMG GKG+ E WV  VKPG+IL+E+ GV E +AR+A  +
Sbjct: 61  GGQIWVRIFPDKPVTVRPTETRMGSGKGSPEYWVAVVKPGKILYEMGGVPENIARKAISI 120

Query: 122 GAAKLSVVTKFI 133
            ++K+ + T+FI
Sbjct: 121 ASSKMPIRTQFI 132


>gi|259500899|ref|ZP_05743801.1| 50S ribosomal protein L16 [Lactobacillus iners DSM 13335]
 gi|302190648|ref|ZP_07266902.1| 50S ribosomal protein L16 [Lactobacillus iners AB-1]
 gi|309803672|ref|ZP_07697762.1| ribosomal protein L16 [Lactobacillus iners LactinV 11V1-d]
 gi|309804967|ref|ZP_07699025.1| ribosomal protein L16 [Lactobacillus iners LactinV 09V1-c]
 gi|309806695|ref|ZP_07700690.1| ribosomal protein L16 [Lactobacillus iners LactinV 03V1-b]
 gi|309808440|ref|ZP_07702339.1| ribosomal protein L16 [Lactobacillus iners LactinV 01V1-a]
 gi|309809121|ref|ZP_07702994.1| ribosomal protein L16 [Lactobacillus iners SPIN 2503V10-D]
 gi|312871276|ref|ZP_07731374.1| ribosomal protein L16 [Lactobacillus iners LEAF 3008A-a]
 gi|312872790|ref|ZP_07732855.1| ribosomal protein L16 [Lactobacillus iners LEAF 2062A-h1]
 gi|312874118|ref|ZP_07734153.1| ribosomal protein L16 [Lactobacillus iners LEAF 2052A-d]
 gi|312874820|ref|ZP_07734839.1| ribosomal protein L16 [Lactobacillus iners LEAF 2053A-b]
 gi|315654019|ref|ZP_07906935.1| 50S ribosomal protein L16 [Lactobacillus iners ATCC 55195]
 gi|325912350|ref|ZP_08174746.1| ribosomal protein L16 [Lactobacillus iners UPII 143-D]
 gi|325913231|ref|ZP_08175600.1| ribosomal protein L16 [Lactobacillus iners UPII 60-B]
 gi|329920623|ref|ZP_08277310.1| ribosomal protein L16 [Lactobacillus iners SPIN 1401G]
 gi|259167593|gb|EEW52088.1| 50S ribosomal protein L16 [Lactobacillus iners DSM 13335]
 gi|308164270|gb|EFO66527.1| ribosomal protein L16 [Lactobacillus iners LactinV 11V1-d]
 gi|308165727|gb|EFO67952.1| ribosomal protein L16 [Lactobacillus iners LactinV 09V1-c]
 gi|308166875|gb|EFO69059.1| ribosomal protein L16 [Lactobacillus iners LactinV 03V1-b]
 gi|308168268|gb|EFO70387.1| ribosomal protein L16 [Lactobacillus iners LactinV 01V1-a]
 gi|308170566|gb|EFO72586.1| ribosomal protein L16 [Lactobacillus iners SPIN 2503V10-D]
 gi|311089565|gb|EFQ47990.1| ribosomal protein L16 [Lactobacillus iners LEAF 2053A-b]
 gi|311090458|gb|EFQ48867.1| ribosomal protein L16 [Lactobacillus iners LEAF 2052A-d]
 gi|311091832|gb|EFQ50211.1| ribosomal protein L16 [Lactobacillus iners LEAF 2062A-h1]
 gi|311093290|gb|EFQ51636.1| ribosomal protein L16 [Lactobacillus iners LEAF 3008A-a]
 gi|315488715|gb|EFU78361.1| 50S ribosomal protein L16 [Lactobacillus iners ATCC 55195]
 gi|325475821|gb|EGC78991.1| ribosomal protein L16 [Lactobacillus iners UPII 143-D]
 gi|325477495|gb|EGC80638.1| ribosomal protein L16 [Lactobacillus iners UPII 60-B]
 gi|328935881|gb|EGG32341.1| ribosomal protein L16 [Lactobacillus iners SPIN 1401G]
          Length = 145

 Score =  191 bits (485), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 70/137 (51%), Positives = 95/137 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ ++F+G+++G AKGG  I FG + L+A E++ I + +IEAAR A++R MKR
Sbjct: 1   MLVPKRVKHRREFRGKMRGEAKGGKTIAFGEYGLQAVESSWITNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FP    TAK   VRMG GKG  E WV  VK  +I+FEI GVSE+VAR A RL
Sbjct: 61  GGRVWIKIFPHKSYTAKGVGVRMGSGKGAPEGWVAVVKRSKIMFEIGGVSEDVAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            + KL + TKF+++ VE
Sbjct: 121 ASNKLPIKTKFVKKNVE 137


>gi|124112097|ref|YP_001019088.1| ribosomal protein L16 [Chlorokybus atmophyticus]
 gi|215275627|sp|Q19VB1|RK16_CHLAT RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|124012208|gb|ABD62229.2| ribosomal protein L16 [Chlorokybus atmophyticus]
          Length = 143

 Score =  191 bits (485), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 69/135 (51%), Positives = 97/135 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+ TK+ K  +GR+KG+A  G++I FG+FAL+A E   I S +IE+ RRA++R  KR
Sbjct: 1   MLSPRRTKFRKHHRGRMKGLAARGNQISFGDFALRALEPAWITSRQIESGRRAMTRYAKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVT +P E RMG GKG+ E WV  VKPG+IL+E+ GVSE VAR A R+
Sbjct: 61  GGKIWIRIFPDKPVTMRPAETRMGSGKGSPEYWVAVVKPGKILYEMKGVSETVARAAMRI 120

Query: 122 GAAKLSVVTKFIQRV 136
            + K+ + T+FI R+
Sbjct: 121 ASYKMPIKTQFITRI 135


>gi|209884820|ref|YP_002288677.1| ribosomal protein L16 [Oligotropha carboxidovorans OM5]
 gi|226712329|sp|B6JEU0|RL16_OLICO RecName: Full=50S ribosomal protein L16
 gi|209873016|gb|ACI92812.1| ribosomal protein L16 [Oligotropha carboxidovorans OM5]
          Length = 137

 Score =  191 bits (485), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 84/137 (61%), Positives = 102/137 (74%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGRI GVA  G+ + FG F LKA    RI + +IEAARRA++R MKR
Sbjct: 1   MMQPKKTKFRKAHKGRIHGVASSGATLSFGQFGLKAMAPERITARQIEAARRALTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI VFPDVPV+ KP EVRMG GKG+ E WV RVKPGRILFEIDGV++++AR A  L
Sbjct: 61  VGRVWIRVFPDVPVSKKPAEVRMGSGKGSPELWVVRVKPGRILFEIDGVNDQIAREALTL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            AAKL + T+F+ R+ E
Sbjct: 121 AAAKLPIKTRFVARIAE 137


>gi|91977645|ref|YP_570304.1| 50S ribosomal protein L16 [Rhodopseudomonas palustris BisB5]
 gi|115502784|sp|Q37M36|RL16_RHOPS RecName: Full=50S ribosomal protein L16
 gi|91684101|gb|ABE40403.1| LSU ribosomal protein L16P [Rhodopseudomonas palustris BisB5]
          Length = 137

 Score =  191 bits (485), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 82/137 (59%), Positives = 103/137 (75%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGRI GVA  G+ + FG F LKA E  R+ + +IEAARRA++R MKR
Sbjct: 1   MMQPKKTKFRKAHKGRIHGVASSGATLAFGQFGLKAMEPERVTARQIEAARRALTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AGRVWI +FPDVPV+ KP EVRMG GKG  E WV RVKPGR++FEIDGV++++AR A  L
Sbjct: 61  AGRVWIRIFPDVPVSKKPAEVRMGSGKGAPELWVARVKPGRVMFEIDGVNQQIAREALTL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            AAKL + T+F+ R+ E
Sbjct: 121 AAAKLPIKTRFVARIAE 137


>gi|90962399|ref|YP_536315.1| 50S ribosomal protein L16 [Lactobacillus salivarius UCC118]
 gi|227891551|ref|ZP_04009356.1| 50S ribosomal protein L16 [Lactobacillus salivarius ATCC 11741]
 gi|301300232|ref|ZP_07206444.1| ribosomal protein L16 [Lactobacillus salivarius ACS-116-V-Col5a]
 gi|115502757|sp|Q1WS97|RL16_LACS1 RecName: Full=50S ribosomal protein L16
 gi|90821593|gb|ABE00232.1| LSU ribosomal protein L16P [Lactobacillus salivarius UCC118]
 gi|227866698|gb|EEJ74119.1| 50S ribosomal protein L16 [Lactobacillus salivarius ATCC 11741]
 gi|300852173|gb|EFK79845.1| ribosomal protein L16 [Lactobacillus salivarius ACS-116-V-Col5a]
          Length = 144

 Score =  191 bits (485), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 72/135 (53%), Positives = 95/135 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ ++F+G+++G AKGG  + FG + LKA +++ I + +IEAAR A++R MKR
Sbjct: 1   MLVPKRVKHRREFRGKMRGEAKGGKEVTFGKYGLKALDSHWITNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP    TAK   VRMG GKG  E WV  VK G++LFEIDGVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVAPVKRGKVLFEIDGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL V TKF+QR 
Sbjct: 121 ASHKLPVKTKFVQRE 135


>gi|313199739|ref|YP_004021353.1| ribosomal protein L16 [Theobroma cacao]
 gi|309321303|gb|ADO64846.1| ribosomal protein L16 [Theobroma cacao]
 gi|328924816|gb|ADO64927.2| ribosomal protein L16 [Theobroma cacao]
          Length = 135

 Score =  190 bits (484), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 68/132 (51%), Positives = 99/132 (75%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+RICFG +AL+A E   I S +IEA RRA++R ++R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGISYRGNRICFGRYALQALEPAWITSRQIEAGRRAMTRNVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +PTE RMG GKG+ E WV  VKPGRIL+E+ GV+E +AR+A  +
Sbjct: 61  GGKIWVRIFPDKPVTVRPTETRMGSGKGSPEYWVAVVKPGRILYEMSGVAENIARKAISI 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+FI
Sbjct: 121 AASKMPIKTQFI 132


>gi|293375396|ref|ZP_06621677.1| ribosomal protein L16 [Turicibacter sanguinis PC909]
 gi|325844423|ref|ZP_08168150.1| ribosomal protein L16 [Turicibacter sp. HGF1]
 gi|292645949|gb|EFF63978.1| ribosomal protein L16 [Turicibacter sanguinis PC909]
 gi|325489097|gb|EGC91481.1| ribosomal protein L16 [Turicibacter sp. HGF1]
          Length = 143

 Score =  190 bits (484), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 69/135 (51%), Positives = 92/135 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY +  +   +G AKGG+ + FG + ++A     + + +IEAAR A++R MKR
Sbjct: 1   MLVPKRTKYRRPHRLSYEGQAKGGTTVVFGEYGIQATTGAWVTNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FP    TAKP EVRMG GKG  + WV  VKPG+++FEI GVSEE+AR A RL
Sbjct: 61  NGRVWIKIFPHQAKTAKPLEVRMGSGKGAPDGWVAVVKPGKVMFEIGGVSEEIAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL V TKF++RV
Sbjct: 121 ASHKLPVQTKFVKRV 135


>gi|87199277|ref|YP_496534.1| 50S ribosomal protein L16 [Novosphingobium aromaticivorans DSM
           12444]
 gi|115502773|sp|Q2G8X3|RL16_NOVAD RecName: Full=50S ribosomal protein L16
 gi|87134958|gb|ABD25700.1| LSU ribosomal protein L16P [Novosphingobium aromaticivorans DSM
           12444]
          Length = 144

 Score =  190 bits (484), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 78/137 (56%), Positives = 101/137 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K FKGRI G+AKGG+ + FG++ LKA E  R+ + +IEAARRAI+R ++R
Sbjct: 1   MLQPKKTKFRKAFKGRIHGLAKGGTDLNFGSYGLKALEPERVTARQIEAARRAITRHIRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI VFPDVPV+ KP EVR GKGKG++E W  RVKPGRILFE+DGV   +A  AF  
Sbjct: 61  QGRLWIRVFPDVPVSKKPAEVRQGKGKGSIEYWAARVKPGRILFELDGVPGPLAAEAFSR 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            A KL + TK + R+ +
Sbjct: 121 AAMKLPIKTKVVARLGD 137


>gi|304391460|ref|ZP_07373402.1| ribosomal protein L16 [Ahrensia sp. R2A130]
 gi|303295689|gb|EFL90047.1| ribosomal protein L16 [Ahrensia sp. R2A130]
          Length = 137

 Score =  190 bits (484), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 89/137 (64%), Positives = 106/137 (77%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGRI G  KGGS + FG + LKA E +R+ + +IEAARRAI+R MKR
Sbjct: 1   MLQPKRTKFRKAHKGRIHGNTKGGSTLTFGAYGLKALEPDRVNARQIEAARRAITRQMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPD+P++AKPTEVRMGKGKG  E W  RV PGRI+FEIDGVSE +AR A RL
Sbjct: 61  QGRVWIRIFPDLPISAKPTEVRMGKGKGAPEYWAARVAPGRIMFEIDGVSEPIAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
           GA KLSV TKFIQR+ +
Sbjct: 121 GAMKLSVKTKFIQRIAD 137


>gi|159901433|ref|YP_001547680.1| 50S ribosomal protein L16 [Herpetosiphon aurantiacus ATCC 23779]
 gi|226710736|sp|A9B419|RL16_HERA2 RecName: Full=50S ribosomal protein L16
 gi|159894472|gb|ABX07552.1| ribosomal protein L16 [Herpetosiphon aurantiacus ATCC 23779]
          Length = 145

 Score =  190 bits (484), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 67/138 (48%), Positives = 94/138 (68%), Gaps = 1/138 (0%)

Query: 2   LRQPKNTKYPKQFKGR-IKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMK 60
           +  PK  KY +  + R IKG+A+ G+ + FG+F L + EA  I S +IE+ARR I+  +K
Sbjct: 1   MLMPKQMKYRRPHRPRNIKGIAQRGATVAFGDFGLVSLEAGWITSRQIESARRTITNYVK 60

Query: 61  RAGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFR 120
           R G+VWI +FPD P+T KP E RMG GKG+VE +V  +KPGR+LFE++GV E+VA+ A R
Sbjct: 61  RGGKVWIRIFPDRPITQKPAETRMGSGKGSVEYYVAVIKPGRVLFELNGVPEDVAQEALR 120

Query: 121 LGAAKLSVVTKFIQRVVE 138
             A KL V  KF+ +  +
Sbjct: 121 RAAQKLPVKCKFVTKASQ 138


>gi|89053083|ref|YP_508534.1| 50S ribosomal protein L16 [Jannaschia sp. CCS1]
 gi|115502755|sp|Q28UV3|RL16_JANSC RecName: Full=50S ribosomal protein L16
 gi|88862632|gb|ABD53509.1| LSU ribosomal protein L16P [Jannaschia sp. CCS1]
          Length = 137

 Score =  190 bits (484), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 82/135 (60%), Positives = 103/135 (76%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGRI+G AKGGS + FG + LKA +  R+ + +IEAARRA++R MKR
Sbjct: 1   MLQPKRTKFRKMQKGRIRGEAKGGSDLTFGTYGLKALQPERVTARQIEAARRAMTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPD PVT+KP EVRMGKGKG+V+ W C+VKPGR++FEIDGVSE +AR A RL
Sbjct: 61  QGRVWIRIFPDTPVTSKPVEVRMGKGKGSVDFWACKVKPGRVMFEIDGVSEPIAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL V T+ + R 
Sbjct: 121 AAMKLPVKTRTVVRE 135


>gi|331268147|ref|YP_004347796.1| ribosomal protein L16 [Chlorella variabilis]
 gi|325296324|gb|ADZ05044.1| ribosomal protein L16 [Chlorella variabilis]
          Length = 134

 Score =  190 bits (484), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 68/134 (50%), Positives = 96/134 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY K  +GR++G A  G+ + FG++AL++ EA+ I S +IEAARRA++R ++R
Sbjct: 1   MLSPKRTKYRKHHRGRMRGKASRGNTLVFGDYALQSLEASWITSRQIEAARRAMTRQVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVT +P E RMG GKG  E WV  VKPG++L+E+ GV E VAR A RL
Sbjct: 61  GGQIWIRLFPDKPVTMRPAETRMGSGKGAPEFWVAVVKPGKVLYELKGVPESVARVALRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A+KL V T+ + +
Sbjct: 121 AASKLPVKTQILVK 134


>gi|156743941|ref|YP_001434070.1| 50S ribosomal protein L16 [Roseiflexus castenholzii DSM 13941]
 gi|189041478|sp|A7NR56|RL16_ROSCS RecName: Full=50S ribosomal protein L16
 gi|156235269|gb|ABU60052.1| ribosomal protein L16 [Roseiflexus castenholzii DSM 13941]
          Length = 141

 Score =  190 bits (484), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 67/135 (49%), Positives = 87/135 (64%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY KQ +G  +G+A  G+ + FG + L A EA  + S +IEAARRAIS  +KR
Sbjct: 1   MLMPKRVKYRKQQRGHNRGMAHRGNTVAFGEYGLMAIEATWMTSRQIEAARRAISHHVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVTAKP E RMG GKG V+ +V  +KPGRILFE+ GV  E+A  A   
Sbjct: 61  GGKIWIRIFPDKPVTAKPAETRMGSGKGAVDHYVAVIKPGRILFELAGVRPEIAHEALER 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL +  K + R 
Sbjct: 121 AAQKLPIKCKIVARE 135


>gi|33594486|ref|NP_882130.1| 50S ribosomal protein L16 [Bordetella pertussis Tohama I]
 gi|33594758|ref|NP_882401.1| 50S ribosomal protein L16 [Bordetella parapertussis 12822]
 gi|33599029|ref|NP_886589.1| 50S ribosomal protein L16 [Bordetella bronchiseptica RB50]
 gi|81578322|sp|Q7VTC6|RL16_BORPE RecName: Full=50S ribosomal protein L16
 gi|81578965|sp|Q7W2E9|RL16_BORPA RecName: Full=50S ribosomal protein L16
 gi|81580341|sp|Q7WRB8|RL16_BORBR RecName: Full=50S ribosomal protein L16
 gi|33564562|emb|CAE43878.1| 50S ribosomal protein L16 [Bordetella pertussis Tohama I]
 gi|33564834|emb|CAE39777.1| 50S ribosomal protein L16 [Bordetella parapertussis]
 gi|33575075|emb|CAE30538.1| 50S ribosomal protein L16 [Bordetella bronchiseptica RB50]
          Length = 138

 Score =  190 bits (484), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 73/136 (53%), Positives = 98/136 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QP   KY K+ KGR  G+A  G+ + FG F LKA    R+ + +IEAARRAI+R +KR
Sbjct: 1   MLQPSRRKYRKEQKGRNTGLASRGTHVSFGEFGLKATGRGRLTARQIEAARRAINRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI +FPD P++ KP EVRMG GKGN E WV  ++PG++L+E++GVSEE+AR AFRL
Sbjct: 61  GGRIWIRIFPDKPISQKPAEVRMGNGKGNPEYWVAEIQPGKVLYEMEGVSEELAREAFRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + T F+ R +
Sbjct: 121 AAAKLPISTTFVARHI 136


>gi|290487916|gb|ADD30342.1| ribosomal protein L16 [Trochodendron aralioides]
          Length = 135

 Score =  190 bits (484), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 70/132 (53%), Positives = 97/132 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+RICFG +AL+A E   I S +IEA RRA++R  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGISYRGNRICFGRYALQALEPTWITSRQIEAGRRAMTRYARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +PTE RMG GKG+ E WV  VKPGRIL+E+ GVSE VAR A  +
Sbjct: 61  GGKIWVRIFPDKPVTVRPTETRMGSGKGSPEYWVSVVKPGRILYEMGGVSEIVAREAIEI 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+FI
Sbjct: 121 AASKMPIRTQFI 132


>gi|81301605|ref|YP_398901.1| ribosomal protein L16 [Nicotiana tomentosiformis]
 gi|85541792|sp|Q33BZ5|RK16_NICTO RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|80750964|dbj|BAE48040.1| ribosomal protein L16 [Nicotiana tomentosiformis]
          Length = 134

 Score =  190 bits (484), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 67/132 (50%), Positives = 95/132 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+ I FG +AL+A E   I S +IEA RRA++R  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGISHRGNHISFGKYALQALEPAWITSRQIEAGRRAMTRNARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +P E RMG GKG+ E WV  VKPGRIL+E+ GV+E +ARRA  L
Sbjct: 61  GGKIWVRIFPDKPVTLRPAETRMGSGKGSPEYWVAVVKPGRILYEMGGVTENIARRAISL 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+FI
Sbjct: 121 AASKMPIQTQFI 132


>gi|11466741|ref|NP_039337.1| ribosomal protein L16 [Marchantia polymorpha]
 gi|132710|sp|P06383|RK16_MARPO RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|453595|emb|CAA28123.1| rpl16 [Marchantia polymorpha]
          Length = 143

 Score =  190 bits (484), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 68/133 (51%), Positives = 93/133 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ KQ  G +KG++  G+ ICFG F L+A E + I S +IEA RRAI+R  +R
Sbjct: 1   MLSPKRTKFRKQHCGNLKGISTRGNVICFGKFPLQALEPSWITSRQIEAGRRAITRYARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T +P E RMG GKG+ E WV  VKPG+IL+EI GVSE +AR A ++
Sbjct: 61  GGKLWIRIFPDKPITIRPAETRMGSGKGSPEYWVAVVKPGKILYEISGVSENIARAAMKI 120

Query: 122 GAAKLSVVTKFIQ 134
            A K+ + T+FI 
Sbjct: 121 AAYKMPIRTQFIT 133


>gi|260905714|ref|ZP_05914036.1| LSU ribosomal protein L16P [Brevibacterium linens BL2]
          Length = 138

 Score =  190 bits (484), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 65/135 (48%), Positives = 91/135 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  KY KQ   +  G AKGG+++ FG++ ++A E   I + +IEAAR A++R +KR
Sbjct: 1   MLIPRRVKYRKQHHPKRGGAAKGGTKVSFGDYGIQATEPAYITNRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI ++PD P+T KP E RMG GKG+ E WV  VKPGR++FE+ GVSEEVAR A RL
Sbjct: 61  GGKVWINIYPDRPLTKKPAETRMGSGKGSPEWWVANVKPGRVMFELAGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  + + R 
Sbjct: 121 AIHKLPLKARIVARE 135


>gi|322436539|ref|YP_004218751.1| ribosomal protein L16 [Acidobacterium sp. MP5ACTX9]
 gi|321164266|gb|ADW69971.1| ribosomal protein L16 [Acidobacterium sp. MP5ACTX9]
          Length = 144

 Score =  190 bits (484), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 71/134 (52%), Positives = 93/134 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY KQ +GR+KG A  GS I FG+F LK  E   I   +IEA+R A++R +KR
Sbjct: 1   MLSPKKVKYRKQQRGRMKGKAWRGSDISFGDFGLKVMECGYITDRQIEASRIAMTRFIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VW+ +FPD P+T KP E RMGKGKG  + WVC V+PGRILFE++GV+ E+A+ A RL
Sbjct: 61  GGKVWLRIFPDKPITKKPAETRMGKGKGAPDHWVCVVRPGRILFEMEGVTPELAKEAMRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + T F+ R
Sbjct: 121 AAHKLPLKTSFVMR 134


>gi|325210984|ref|YP_004286041.1| ribosomal protein L16 [Gossypium thurberi]
 gi|290775846|gb|ADD62342.1| ribosomal protein L16 [Gossypium thurberi]
          Length = 135

 Score =  190 bits (484), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 67/132 (50%), Positives = 98/132 (74%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+ G++  G+RICFG +AL+A E   I S +IEA RRA++R ++R
Sbjct: 1   MLSPKRTRFRKQHRGRMNGISYRGNRICFGRYALQALEPAWITSRQIEAGRRAMTRNVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +PTE RMG GKG+ E WV  VKPGRIL+E+ GV+E +AR+A  +
Sbjct: 61  GGKIWVRIFPDKPVTVRPTETRMGSGKGSPEYWVAVVKPGRILYEMSGVAENIARKAISI 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+FI
Sbjct: 121 AASKMPIKTQFI 132


>gi|312115694|ref|YP_004013290.1| ribosomal protein L16 [Rhodomicrobium vannielii ATCC 17100]
 gi|311220823|gb|ADP72191.1| ribosomal protein L16 [Rhodomicrobium vannielii ATCC 17100]
          Length = 143

 Score =  190 bits (484), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 86/137 (62%), Positives = 107/137 (78%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K FKGR+ G AKGG+ + FG++ LKA E  R+ + +IEAARRAI+R MKR
Sbjct: 1   MLQPKKTKFRKAFKGRMNGNAKGGTSLNFGSYGLKALEPERVTARQIEAARRAITRQMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AGRVWI +FPD+PV+ KPTEVRMGKGKG+ E W  RVKPG+I+FEIDGV EE AR A RL
Sbjct: 61  AGRVWIRIFPDLPVSKKPTEVRMGKGKGSPEFWAARVKPGKIMFEIDGVGEETAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
           GAAKL + T+ + R+ E
Sbjct: 121 GAAKLPIRTRVVVRLGE 137


>gi|11465994|ref|NP_054536.1| ribosomal protein L16 [Nicotiana tabacum]
 gi|78102575|ref|YP_358715.1| ribosomal protein L16 [Nicotiana sylvestris]
 gi|132715|sp|P06384|RK16_TOBAC RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|85541791|sp|Q3C1L8|RK16_NICSY RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|435268|emb|CAA77380.1| ribosomal protein L16 [Nicotiana tabacum]
 gi|77799602|dbj|BAE46691.1| ribosomal protein L16 [Nicotiana sylvestris]
 gi|225234|prf||1211235BR ribosomal protein L16
          Length = 134

 Score =  190 bits (484), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 67/132 (50%), Positives = 95/132 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+ I FG +AL+A E   I S +IEA RRA++R  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGISHRGNHISFGKYALQALEPAWITSRQIEAGRRAMTRNARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +P E RMG GKG+ E WV  VKPGRIL+E+ GV+E +ARRA  L
Sbjct: 61  GGKIWVRIFPDKPVTLRPAETRMGSGKGSPEYWVAVVKPGRILYEMGGVTENIARRAISL 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+FI
Sbjct: 121 AASKMPIRTQFI 132


>gi|329850214|ref|ZP_08265059.1| ribosomal protein L16 [Asticcacaulis biprosthecum C19]
 gi|328840529|gb|EGF90100.1| ribosomal protein L16 [Asticcacaulis biprosthecum C19]
          Length = 143

 Score =  190 bits (484), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 84/134 (62%), Positives = 100/134 (74%), Gaps = 1/134 (0%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY K FKGRI G AKGG  + FG++ LK  E  R+ + +IEAARRAI+R MKR
Sbjct: 1   ML-PKRTKYRKAFKGRIHGNAKGGYTLNFGSYGLKTVEPERLTARQIEAARRAITRQMKR 59

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPD+PVT KP EVRMGKGKG V+ W  RV PGRILFEIDGV +++AR A RL
Sbjct: 60  QGRVWIRIFPDLPVTGKPAEVRMGKGKGAVDYWAARVHPGRILFEIDGVPDDIAREALRL 119

Query: 122 GAAKLSVVTKFIQR 135
           GAAKL V T+ + R
Sbjct: 120 GAAKLPVSTRVVTR 133


>gi|156619293|gb|ABU88326.1| ribosomal protein L16 [Chlamydomonas moewusii]
          Length = 136

 Score =  190 bits (484), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 62/132 (46%), Positives = 87/132 (65%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY +  +G +KG A  G+ I FG F L+A E   + S +IE+ RR ++R ++R
Sbjct: 1   MLSPKRTKYRRHHRGNLKGKATRGNTIAFGEFGLQALEPCWVTSRQIESGRRVLTRYVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVT +P   RMG GKG  E WV  V PG+IL+E+ GV E +AR+A R+
Sbjct: 61  TGKLWIRIFPDKPVTMRPAGTRMGSGKGAPEYWVAVVHPGKILYEMKGVPESIARQALRI 120

Query: 122 GAAKLSVVTKFI 133
            A K+ + TKFI
Sbjct: 121 AAYKMPLKTKFI 132


>gi|34541534|ref|NP_906013.1| 50S ribosomal protein L16 [Porphyromonas gingivalis W83]
 gi|188995725|ref|YP_001929977.1| 50S ribosomal protein L16 [Porphyromonas gingivalis ATCC 33277]
 gi|81572009|sp|Q7MTM0|RL16_PORGI RecName: Full=50S ribosomal protein L16
 gi|226712335|sp|B2RLY5|RL16_PORG3 RecName: Full=50S ribosomal protein L16
 gi|34397851|gb|AAQ66912.1| ribosomal protein L16 [Porphyromonas gingivalis W83]
 gi|188595405|dbj|BAG34380.1| 50S ribosomal protein L16 [Porphyromonas gingivalis ATCC 33277]
          Length = 144

 Score =  190 bits (484), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 67/134 (50%), Positives = 96/134 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ +Q KGR+KG A+ G+++ FG+F +K+ ++  I   +IEAAR A++R M+R
Sbjct: 1   MLQPKKTKFRRQQKGRMKGFAQRGNQLSFGSFGIKSLQSKWITGRQIEAARIAVTRYMQR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VW+ +FPD P+T K   VRMGKGKG  E +V  + PGRI+FE++GV  E+A+ A RL
Sbjct: 61  QGQVWVRIFPDKPITKKGEGVRMGKGKGAPEGFVAPITPGRIIFEVEGVPYEIAKEALRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL V TKF+ R
Sbjct: 121 AAQKLPVTTKFVVR 134


>gi|330997358|ref|ZP_08321209.1| ribosomal protein L16 [Paraprevotella xylaniphila YIT 11841]
 gi|329570732|gb|EGG52448.1| ribosomal protein L16 [Paraprevotella xylaniphila YIT 11841]
          Length = 141

 Score =  190 bits (484), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 71/134 (52%), Positives = 96/134 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TKY +  KGR KG A+ G+++ FG F +K+ E + I   +IEAAR A++R M+R
Sbjct: 1   MLQPKRTKYRRPQKGRCKGNAQRGNQLAFGTFGIKSLETHWITGRQIEAARIAVTRYMQR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVT KP +VRMGKGKG+   +V  + PGRI+FE++GVS E+A+ A RL
Sbjct: 61  EGQIWIRIFPDKPVTKKPADVRMGKGKGDPVGYVFPITPGRIIFEVEGVSYEIAKEALRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL V TKFI R
Sbjct: 121 AAQKLPVTTKFIVR 134


>gi|317125865|ref|YP_004099977.1| 50S ribosomal protein L16P [Intrasporangium calvum DSM 43043]
 gi|315589953|gb|ADU49250.1| LSU ribosomal protein L16P [Intrasporangium calvum DSM 43043]
          Length = 139

 Score =  190 bits (484), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 62/135 (45%), Positives = 90/135 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  K+ KQ      G AKGG+ I FG++ ++A E   + + +IE+AR A++R +KR
Sbjct: 1   MLIPRRVKHRKQHHPNRHGAAKGGTTIAFGDYGIQALEPAYVTNRQIESARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI ++PD P+T KP E RMG GKG+ E W+  VKPGR++FE+ GV+E VAR A RL
Sbjct: 61  GGKVWINIYPDRPLTKKPAETRMGSGKGSPEWWIANVKPGRVMFELSGVTEPVAREAMRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  +F+QR 
Sbjct: 121 AMHKLPMKCRFVQRE 135


>gi|189424417|ref|YP_001951594.1| 50S ribosomal protein L16 [Geobacter lovleyi SZ]
 gi|226710731|sp|B3E7U2|RL16_GEOLS RecName: Full=50S ribosomal protein L16
 gi|189420676|gb|ACD95074.1| ribosomal protein L16 [Geobacter lovleyi SZ]
          Length = 140

 Score =  190 bits (484), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 73/134 (54%), Positives = 96/134 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQ KGR+ G A     I +G FAL+A E   + S +IEAAR A++R +KR
Sbjct: 1   MLMPKRVKHRKQMKGRMTGAACRRIEISYGEFALQATECGWVDSRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+TAKP E RMGKGKG+ + WVC VKPG +L+E++GV+EE+AR AFRL
Sbjct: 61  GGKIWIRMFPDKPLTAKPAETRMGKGKGSPDSWVCVVKPGMVLYEMEGVTEEIAREAFRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + TKFI R
Sbjct: 121 AAHKLPISTKFITR 134


>gi|115604971|ref|YP_784424.1| ribosomal protein L16 [Drimys granadensis]
 gi|122164403|sp|Q06GV9|RK16_DRIGR RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|112032699|gb|ABH88334.1| ribosomal protein L16 [Drimys granadensis]
          Length = 135

 Score =  190 bits (484), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 68/132 (51%), Positives = 95/132 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+ ICFG +AL+A E   I S +IEA RRA++R  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGISYRGNYICFGRYALQALEPAWITSRQIEAGRRAMTRYARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +PTE RMG GKG+ E WV  VKPGRIL+E+ GVSE VAR A  +
Sbjct: 61  GGKIWVRIFPDKPVTVRPTETRMGSGKGSPEYWVSVVKPGRILYEMGGVSETVARAAIEI 120

Query: 122 GAAKLSVVTKFI 133
            A K+ + T+F+
Sbjct: 121 AACKMPIRTQFV 132


>gi|114107170|ref|YP_740155.1| ribosomal protein L16 [Daucus carota]
 gi|122221302|sp|Q0G9S4|RK16_DAUCA RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|113200945|gb|ABI32461.1| ribosomal protein L16 [Daucus carota]
          Length = 135

 Score =  190 bits (484), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 65/132 (49%), Positives = 95/132 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+ I FG +AL+A E   I S +IEA RRA++R  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGISYRGNHISFGKYALQALEPAWITSRQIEAGRRAMTRNARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +P E RMG GKG+ E WV  VKPGRIL+E+ GV+E +ARRA  +
Sbjct: 61  GGKIWVRIFPDKPVTVRPAETRMGSGKGSPEYWVAVVKPGRILYEMGGVTENIARRAISI 120

Query: 122 GAAKLSVVTKFI 133
            ++K+ + T+FI
Sbjct: 121 ASSKMPIRTQFI 132


>gi|193214807|ref|YP_001996006.1| 50S ribosomal protein L16 [Chloroherpeton thalassium ATCC 35110]
 gi|193088284|gb|ACF13559.1| ribosomal protein L16 [Chloroherpeton thalassium ATCC 35110]
          Length = 144

 Score =  190 bits (484), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 75/134 (55%), Positives = 94/134 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY K  +GR+KG A  G+ I FG+FALKA E   I S +IEAAR A++R MKR
Sbjct: 1   MLMPKRVKYRKVQRGRMKGNAARGTEINFGSFALKALEPAWITSRQIEAARVAMNRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVT KP E RMG GKG+ E WV  VKPGRI+FE+DGVS+EVA    RL
Sbjct: 61  DGKIWIRIFPDKPVTKKPAETRMGSGKGSPEFWVAVVKPGRIMFEVDGVSKEVAMEGLRL 120

Query: 122 GAAKLSVVTKFIQR 135
            + K+ + TKF+ R
Sbjct: 121 ASKKMPIKTKFVVR 134


>gi|229915444|gb|ACQ90789.1| ribosomal protein L16 [Oocystis solitaria]
          Length = 138

 Score =  190 bits (483), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 65/135 (48%), Positives = 95/135 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY K  +G+++G AK G+ + FG+FAL+A E + I S +IEA RRAI+R  +R
Sbjct: 1   MLSPKRTKYKKPHRGKMRGKAKRGNILSFGDFALQALEPSWITSRQIEAGRRAITRYARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD  +T +  E RMG GKG+ E WV  VKPG+IL+E+ GV E++AR A R+
Sbjct: 61  GGKLWIRIFPDKAITMRAAETRMGSGKGSPEYWVAVVKPGKILYELQGVPEKIAREAMRI 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL + T+FI++ 
Sbjct: 121 ASYKLPIRTQFIKKE 135


>gi|122894027|ref|YP_001004223.1| ribosomal protein L16 [Ranunculus macranthus]
 gi|215274772|sp|A1XGS5|RK16_RANMC RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|85540841|gb|ABC70793.1| ribosomal protein L16 [Ranunculus macranthus]
          Length = 135

 Score =  190 bits (483), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 69/132 (52%), Positives = 96/132 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+RICFG +AL+A E   I S +IEA RRA++R  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGISYRGNRICFGGYALQALEPAWITSRQIEAGRRAMTRYARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +P E RMG GKG+ E WV  VKPGRIL+E+ GVSE VAR A  +
Sbjct: 61  GGKIWVRIFPDKPVTVRPAETRMGSGKGSPEFWVFVVKPGRILYEMGGVSEIVAREAISI 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+FI
Sbjct: 121 AASKMPIRTQFI 132


>gi|52220847|ref|YP_087003.1| ribosomal protein L16 [Panax ginseng]
 gi|75254102|sp|Q68RW9|RK16_PANGI RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|51235350|gb|AAT98546.1| ribosomal protein L16 [Panax ginseng]
          Length = 135

 Score =  190 bits (483), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 64/132 (48%), Positives = 95/132 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+ I FG +AL+A E   I S +IEA RRA++R  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGISYRGNHISFGKYALQALEPAWITSRQIEAGRRAMTRNARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +P E RMG GKG+ E WV  VKPGRIL+E+ GV+E +AR+A  +
Sbjct: 61  GGKIWVRIFPDKPVTVRPAETRMGSGKGSPEYWVAVVKPGRILYEMGGVTENIARKAISI 120

Query: 122 GAAKLSVVTKFI 133
            ++K+ + T+FI
Sbjct: 121 ASSKMPIRTQFI 132


>gi|15889235|ref|NP_354916.1| 50S ribosomal protein L16 [Agrobacterium tumefaciens str. C58]
 gi|81591393|sp|Q8UE25|RL16_AGRT5 RecName: Full=50S ribosomal protein L16
 gi|15157062|gb|AAK87701.1| 50S ribosomal protein L16 [Agrobacterium tumefaciens str. C58]
          Length = 137

 Score =  190 bits (483), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 103/137 (75%), Positives = 118/137 (86%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TKY KQFKGRIKGVAKGG  + FG F LK+QE NR+ + EIEAARRAI+R MKR
Sbjct: 1   MLQPKRTKYRKQFKGRIKGVAKGGFDLAFGEFGLKSQEPNRVNAREIEAARRAITRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AGRVWI VFPDVPVTAKPTEVRMGKGKG+VE W C+VKPGR++FEIDGV+EE+AR A RL
Sbjct: 61  AGRVWIRVFPDVPVTAKPTEVRMGKGKGSVEYWACKVKPGRMMFEIDGVTEEIAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
           GAAKLSV T+F+QR+ E
Sbjct: 121 GAAKLSVKTRFVQRIAE 137


>gi|310817002|ref|YP_003964966.1| 50S ribosomal protein L16 [Ketogulonicigenium vulgare Y25]
 gi|308755737|gb|ADO43666.1| 50S ribosomal protein L16 [Ketogulonicigenium vulgare Y25]
          Length = 137

 Score =  190 bits (483), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 88/135 (65%), Positives = 103/135 (76%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGRI G AKGGS + FG FALK+ E  R+ + +IEAARRAI+R MKR
Sbjct: 1   MLQPKRTKFRKLHKGRIHGEAKGGSTLAFGTFALKSTEPERVTARQIEAARRAITRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPD PVT KPTEVRMGKGKG++E W  +VKPGRILFEIDGVSE +AR A RL
Sbjct: 61  QGRVWIRIFPDTPVTGKPTEVRMGKGKGSIEYWAAKVKPGRILFEIDGVSETIAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
           GA KL V T+ + R 
Sbjct: 121 GAMKLPVKTRTVVRE 135


>gi|85713142|ref|ZP_01044174.1| 50S ribosomal protein L16 [Idiomarina baltica OS145]
 gi|85693012|gb|EAQ30978.1| 50S ribosomal protein L16 [Idiomarina baltica OS145]
          Length = 137

 Score =  190 bits (483), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 76/136 (55%), Positives = 103/136 (75%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K   GR +G+A+ G+++ FG+F LKA +  R+ + +IEA RRA++R +KR
Sbjct: 1   MLQPKRTKFRKVHTGRNRGLAQSGNKVSFGSFGLKAVDRGRMTARQIEAGRRAMTRHVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD P+T KP EVRMGKGKGNVE WV +++PGR+L+E+DGVSEE+AR AFRL
Sbjct: 61  QGKIWIRVFPDKPITKKPLEVRMGKGKGNVEYWVAQIQPGRVLYEMDGVSEELAREAFRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            A KL   T F+ R V
Sbjct: 121 AARKLPFKTTFVTRTV 136


>gi|290487914|gb|ADD30341.1| ribosomal protein L16 [Staphylea colchica]
          Length = 135

 Score =  190 bits (483), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 68/132 (51%), Positives = 97/132 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+ ICFG +AL+A E   I S +IEA RRA++R  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGISYRGNHICFGRYALQALEPAWITSKQIEAGRRAMTRNARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVT +PTE RMG GKG+ E WV  VKPGRIL+E+ GV+E +AR+A  +
Sbjct: 61  GGKLWIRIFPDKPVTVRPTETRMGSGKGSPEYWVAVVKPGRILYEMSGVAENIARKAISI 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+FI
Sbjct: 121 AASKMPIRTQFI 132


>gi|91984029|ref|YP_567115.1| ribosomal protein L16 [Vitis vinifera]
 gi|224365674|ref|YP_002608401.1| ribosomal protein L16 [Vitis vinifera]
 gi|115502632|sp|Q0ZIY1|RK16_VITVI RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|91701687|gb|ABE47571.1| ribosomal protein L16 [Vitis vinifera]
 gi|209954198|emb|CAQ77667.1| ribosomal protein L16 [Vitis vinifera]
          Length = 135

 Score =  190 bits (483), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 68/132 (51%), Positives = 99/132 (75%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+RICFG +AL+A E   I S +IEA RRA++R ++R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGISYRGNRICFGRYALQALEPAWITSRQIEAGRRAMTRNVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +PTE RMG GKG+ E WV  VKPGRIL+E+ GV+E +AR+A  +
Sbjct: 61  GGKIWVRIFPDKPVTVRPTETRMGSGKGSPEYWVAVVKPGRILYEMGGVAENIARKAISI 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+FI
Sbjct: 121 AASKMPIRTQFI 132


>gi|154253184|ref|YP_001414008.1| 50S ribosomal protein L16 [Parvibaculum lavamentivorans DS-1]
 gi|171769632|sp|A7HWR8|RL16_PARL1 RecName: Full=50S ribosomal protein L16
 gi|154157134|gb|ABS64351.1| ribosomal protein L16 [Parvibaculum lavamentivorans DS-1]
          Length = 139

 Score =  190 bits (483), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 90/137 (65%), Positives = 103/137 (75%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGRI G AKGG  + FG F LKAQE  RI + +IEAARRAI+R MKR
Sbjct: 1   MLQPKRTKFRKAHKGRIHGKAKGGMHLDFGAFGLKAQEPARITARQIEAARRAITRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AGRVWI +FPDVPV++KPTEVRMGKGKG  E W  RVKPGRI+FEIDGV   VA  A RL
Sbjct: 61  AGRVWIRIFPDVPVSSKPTEVRMGKGKGAPEYWAARVKPGRIMFEIDGVPLAVAEEAMRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
           GAAKL + T+F+ R  E
Sbjct: 121 GAAKLPIKTRFVARPGE 137


>gi|108802678|ref|YP_636336.1| ribosomal protein L16 [Eucalyptus globulus subsp. globulus]
 gi|309322483|ref|YP_003933997.1| ribosomal protein L16 [Eucalyptus grandis]
 gi|85541789|sp|Q49KW1|RK16_EUCGG RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|60460844|gb|AAX21064.1| ribosomal protein L16 [Eucalyptus globulus subsp. globulus]
 gi|308223317|gb|ADO23625.1| ribosomal protein L16 [Eucalyptus grandis]
          Length = 135

 Score =  190 bits (483), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 68/132 (51%), Positives = 99/132 (75%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+RICFG +AL+A E   I S +IEA RRA++R ++R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGISYRGNRICFGKYALQALEPAWITSRQIEAGRRAMTRNVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +PTE RMG GKG+ E WV  VKPGRIL+E+ GV+E +AR+A  +
Sbjct: 61  GGKIWVRIFPDKPVTVRPTETRMGSGKGSPEYWVAVVKPGRILYEMGGVAENIARKAISI 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+FI
Sbjct: 121 AASKMPIRTQFI 132


>gi|50346821|ref|YP_053192.1| ribosomal protein L16 [Nymphaea alba]
 gi|75275856|sp|Q6EW14|RK16_NYMAL RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|50250366|emb|CAF28632.1| ribosomal protein L16 [Nymphaea alba]
          Length = 135

 Score =  190 bits (483), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 71/132 (53%), Positives = 94/132 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KGV+  G+RICFG +AL+A E   I S +IEA RRAISR  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGVSYRGNRICFGRYALQALEPAWITSRQIEAGRRAISRYARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +P E RMG GKG+ E WV  VKP RIL+E+ GVSE VAR A  +
Sbjct: 61  GGKIWVRIFPDKPVTLRPAETRMGSGKGSPEYWVSVVKPDRILYEMGGVSETVARAAMEI 120

Query: 122 GAAKLSVVTKFI 133
            A K+ + TKF+
Sbjct: 121 AARKMPIRTKFV 132


>gi|259502538|ref|ZP_05745440.1| 50S ribosomal protein L16 [Lactobacillus antri DSM 16041]
 gi|259169490|gb|EEW53985.1| 50S ribosomal protein L16 [Lactobacillus antri DSM 16041]
          Length = 144

 Score =  190 bits (483), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 67/135 (49%), Positives = 90/135 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ K  +G ++G AKGG  + FG F L+A +++ I + +IEAAR A++R MKR
Sbjct: 1   MLVPKRVKHRKVQRGHMRGEAKGGKTVNFGEFGLQALDSHWISNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP +  T+K   VRMG GKG  E WV  VK G+++FE+ GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPQLSYTSKGVGVRMGNGKGAPEGWVAPVKRGKVMFEVGGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL V TK +QR 
Sbjct: 121 AGHKLPVRTKIVQRE 135


>gi|290487896|gb|ADD30332.1| ribosomal protein L16 [Cornus florida]
          Length = 135

 Score =  190 bits (483), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 67/132 (50%), Positives = 97/132 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+ ICFG +AL+A E   I S +IEA RRA++R  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGISYRGNHICFGKYALQALEPAWITSRQIEAGRRAMTRNARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +PTE RMG GKG+ E WV  VKPGRIL+E+ GV+E +AR+A  +
Sbjct: 61  GGKIWVRIFPDKPVTVRPTETRMGSGKGSPEFWVAVVKPGRILYEMSGVTETIARKAISI 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+FI
Sbjct: 121 AASKMPIRTQFI 132


>gi|56461017|ref|YP_156298.1| 50S ribosomal protein L16 [Idiomarina loihiensis L2TR]
 gi|81600113|sp|Q5QXY4|RL16_IDILO RecName: Full=50S ribosomal protein L16
 gi|56180027|gb|AAV82749.1| Ribosomal protein L16 [Idiomarina loihiensis L2TR]
          Length = 137

 Score =  190 bits (483), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 75/136 (55%), Positives = 101/136 (74%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K   GR +G+A+ G+++ FG F LKA +  R+ + +IEA RRA++R +KR
Sbjct: 1   MLQPKRTKFRKVHTGRNRGLAQSGNKVSFGTFGLKATDRGRMTARQIEAGRRAMTRHVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD P+T KP EVRMGKGKGNVE WV +++PGR+L+E+DGV EE+AR AFRL
Sbjct: 61  QGKIWIRVFPDKPITKKPLEVRMGKGKGNVEYWVAQIQPGRVLYEMDGVPEELAREAFRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            A KL   T F+ R V
Sbjct: 121 AARKLPFKTTFVTRTV 136


>gi|290487884|gb|ADD30326.1| ribosomal protein L16 [Nerium oleander]
          Length = 135

 Score =  190 bits (483), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 68/132 (51%), Positives = 97/132 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+RICFG +AL+A E   I S +IEA RRA++R  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGISYRGNRICFGKYALQALEPAWITSRQIEAGRRAMTRNARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +P E RMG GKG+ E WV  VKPGRIL+E+ GV+E +ARRA  +
Sbjct: 61  GGKLWVRIFPDKPVTLRPAETRMGSGKGSPEYWVAVVKPGRILYEMGGVTENIARRAISI 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+FI
Sbjct: 121 AASKMPIRTQFI 132


>gi|290487900|gb|ADD30334.1| ribosomal protein L16 [Ficus sp. Moore 315]
          Length = 135

 Score =  190 bits (483), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 67/132 (50%), Positives = 96/132 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ K  +GR+KG++  G+RICFG +AL+A E   I S +IEA RRA++R  +R
Sbjct: 1   MLSPKRTRFRKHHRGRMKGISYRGNRICFGRYALQALEPAWITSRQIEAGRRAMTRNARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +PTE RMG GKG+ E WV  VKPGRIL+E+ GV E +AR+A  +
Sbjct: 61  GGKIWVRIFPDKPVTVRPTETRMGSGKGSPEYWVAVVKPGRILYEMSGVPENIARKAISI 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+FI
Sbjct: 121 AASKMPIRTQFI 132


>gi|326388204|ref|ZP_08209807.1| 50S ribosomal protein L16 [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326207370|gb|EGD58184.1| 50S ribosomal protein L16 [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 144

 Score =  190 bits (483), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 75/137 (54%), Positives = 100/137 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K FKGR+ G AKGG+ + FG++ LKA E  R+ + +IEAARRAI+R ++R
Sbjct: 1   MLQPKKTKFRKAFKGRLHGNAKGGTDLNFGSYGLKALEPERVTARQIEAARRAITRHIRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI VFPD+PV+ KP EVR GKGKG++E W  RVKPG+ILFE+DGV   +A  AF  
Sbjct: 61  QGRLWIRVFPDLPVSKKPAEVRQGKGKGSIEYWAARVKPGKILFELDGVPGPLAAEAFSR 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            A KL + TK + R+ +
Sbjct: 121 AAMKLPIKTKVVARLGD 137


>gi|302036672|ref|YP_003796994.1| 50S ribosomal protein L16 [Candidatus Nitrospira defluvii]
 gi|300604736|emb|CBK41068.1| 50S ribosomal protein L16 [Candidatus Nitrospira defluvii]
          Length = 138

 Score =  190 bits (483), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 70/134 (52%), Positives = 91/134 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ K  KGR++G A  G  I  G F LKA E   + S +IEAAR AI+R +KR
Sbjct: 1   MLAPKKVKFRKMQKGRMRGKAYRGGAITLGEFGLKALEPGWVTSRQIEAARIAITRFVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VW  +FPD P+T KP E RMGKGKGN E WV  VKPGRI++E+ GV+ +VA++A +L
Sbjct: 61  GGQVWTRIFPDKPITKKPAETRMGKGKGNPEYWVAVVKPGRIMYEMSGVAPDVAKQALKL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + TKF+ R
Sbjct: 121 AAYKLPIATKFVVR 134


>gi|139389301|ref|YP_001123067.1| ribosomal protein L16 [Aethionema grandiflorum]
 gi|139390385|ref|YP_001122983.1| ribosomal protein L16 [Aethionema cordifolium]
 gi|215275542|sp|A4QJF2|RK16_AETCO RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|215275543|sp|A4QJN6|RK16_AETGR RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|134286178|dbj|BAF49807.1| ribosomal protein L16 [Aethionema cordifolium]
 gi|134286263|dbj|BAF49891.1| ribosomal protein L16 [Aethionema grandiflorum]
          Length = 135

 Score =  190 bits (483), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 65/132 (49%), Positives = 96/132 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+RICFG +AL+  E   I S +IEA RRA++R ++R
Sbjct: 1   MLSPKRTRFRKQHRGRLKGISYRGNRICFGRYALQTLEPAWITSRQIEAGRRAMTRNVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +P E RMG GKG+ E WV  VKPG+IL+E+ GV E +AR+A  +
Sbjct: 61  GGKIWVRIFPDKPVTVRPAETRMGSGKGSPEYWVAVVKPGKILYEMGGVPENIARKAISI 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+FI
Sbjct: 121 AASKMPIKTQFI 132


>gi|126724870|ref|ZP_01740713.1| 50S ribosomal protein L16 [Rhodobacterales bacterium HTCC2150]
 gi|126706034|gb|EBA05124.1| 50S ribosomal protein L16 [Rhodobacterales bacterium HTCC2150]
          Length = 137

 Score =  189 bits (482), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 86/135 (63%), Positives = 103/135 (76%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K FKGRI G AKGGS + FG + LKA +  RI + +IEAARRA++R MKR
Sbjct: 1   MLQPKRTKFRKMFKGRIHGEAKGGSDLNFGTYGLKATQPERITARQIEAARRAMTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPDVPVTAKP EVRMGKGKG+V++W  +VKPGRI+FEIDGV E VAR A RL
Sbjct: 61  QGRVWIRIFPDVPVTAKPIEVRMGKGKGSVDRWTAKVKPGRIMFEIDGVDESVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL V T+ + R 
Sbjct: 121 AAMKLPVKTRTVVRE 135


>gi|33866606|ref|NP_898165.1| 50S ribosomal protein L16 [Synechococcus sp. WH 8102]
 gi|81573914|sp|Q7U4J3|RL16_SYNPX RecName: Full=50S ribosomal protein L16
 gi|33633384|emb|CAE08589.1| 50S ribosomal protein L16 [Synechococcus sp. WH 8102]
          Length = 158

 Score =  189 bits (482), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 69/134 (51%), Positives = 92/134 (68%), Gaps = 2/134 (1%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ K  +GR++GVA  G+ I FG FAL+AQE   I S +IEA+RRA++R +KR
Sbjct: 1   MLSPKRVKFRKMQRGRMRGVATRGNTIAFGEFALQAQECGWITSRQIEASRRAMTRYVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDG--VSEEVARRAF 119
            G++WI +FPD  +T +  E RMG GKGN E WV  +KPGRILFE+ G  ++ E+A+ A 
Sbjct: 61  GGKIWIRIFPDKSITMRAAETRMGSGKGNPEFWVAVIKPGRILFEMGGAEITPEIAKEAM 120

Query: 120 RLGAAKLSVVTKFI 133
           RL   KL V TKFI
Sbjct: 121 RLAQYKLPVKTKFI 134


>gi|229821616|ref|YP_002883142.1| ribosomal protein L16 [Beutenbergia cavernae DSM 12333]
 gi|259645641|sp|C5C0I4|RL16_BEUC1 RecName: Full=50S ribosomal protein L16
 gi|229567529|gb|ACQ81380.1| ribosomal protein L16 [Beutenbergia cavernae DSM 12333]
          Length = 139

 Score =  189 bits (482), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 63/135 (46%), Positives = 91/135 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+ TK+ KQ   R  G A GG+ I FG++ ++A E   + + +IEAAR A++R +KR
Sbjct: 1   MLIPRRTKHRKQHHPRRTGAASGGTTIAFGDYGIQAVEGGYLTNRQIEAARIAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI ++PD P+T KP E RMG GKG+VE W+  +KPGR+LFE+ GV E +AR A R 
Sbjct: 61  GGKVWINIYPDRPLTKKPAETRMGSGKGSVEWWIANIKPGRVLFELAGVDEPLAREAMRR 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL + T+F++R 
Sbjct: 121 AQHKLPMKTRFVRRE 135


>gi|32480880|ref|NP_862791.1| ribosomal protein L16 [Calycanthus floridus var. glaucus]
 gi|75233678|sp|Q7YJU1|RK16_CALFG RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|32399416|emb|CAD28758.1| ribosomal protein L16 [Calycanthus floridus var. glaucus]
          Length = 135

 Score =  189 bits (482), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 69/132 (52%), Positives = 96/132 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+ ICFG +AL+A E + I S +IEA RRA++R  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGISYRGNHICFGRYALQALEPSWITSRQIEAGRRAMTRYARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +PTE RMG GKG+ E WV  VKPGRIL+E+ GVSE VAR A  +
Sbjct: 61  GGKIWVRIFPDKPVTVRPTETRMGSGKGSPEYWVSVVKPGRILYEMGGVSETVARAAISI 120

Query: 122 GAAKLSVVTKFI 133
            A K+ + T+FI
Sbjct: 121 AACKMPIRTQFI 132


>gi|303233110|ref|ZP_07319783.1| ribosomal protein L16 [Atopobium vaginae PB189-T1-4]
 gi|302480695|gb|EFL43782.1| ribosomal protein L16 [Atopobium vaginae PB189-T1-4]
          Length = 141

 Score =  189 bits (482), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 71/134 (52%), Positives = 95/134 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK   + K  +G +KG AKG + + FG++ L A EA+ I + +IEAAR A++R MKR
Sbjct: 1   MLAPKRVLHRKVQRGSMKGHAKGNTELHFGSYGLVALEAHWITNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPD P++ KP E RMG GKGN E+WV  VKPGRI+FEIDGV+EEVA+ A RL
Sbjct: 61  GGRVWITIFPDKPISKKPAETRMGSGKGNPEEWVAVVKPGRIMFEIDGVTEEVAKEALRL 120

Query: 122 GAAKLSVVTKFIQR 135
            + K+ + TK + R
Sbjct: 121 ASHKMPIKTKVVMR 134


>gi|159161199|ref|YP_001542485.1| ribosomal protein L16 [Ceratophyllum demersum]
 gi|215275552|sp|A8SEE1|RK16_CERDE RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|148508482|gb|ABQ81489.1| ribosomal protein L16 [Ceratophyllum demersum]
 gi|227481156|emb|CAP62535.1| ribosomal protein L16 [Ceratophyllum demersum]
          Length = 135

 Score =  189 bits (482), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 68/132 (51%), Positives = 97/132 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+RICFG +AL+A E   I S +IEA RRA++R  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGISSRGNRICFGRYALQALEPAWITSRQIEAGRRAMTRYARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +PTE RMG GKG+ E WV  VKPGRIL+E+ G+SE VAR A  +
Sbjct: 61  GGKIWVRIFPDKPVTVRPTETRMGSGKGSPEYWVSVVKPGRILYEMGGISETVARAAIEI 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+F+
Sbjct: 121 AASKMPIRTQFV 132


>gi|237743906|ref|ZP_04574387.1| LSU ribosomal protein L16P [Fusobacterium sp. 7_1]
 gi|256027483|ref|ZP_05441317.1| 50S ribosomal protein L16 [Fusobacterium sp. D11]
 gi|260495196|ref|ZP_05815324.1| ribosomal protein L16 [Fusobacterium sp. 3_1_33]
 gi|289765445|ref|ZP_06524823.1| LSU ribosomal protein L16P [Fusobacterium sp. D11]
 gi|229432937|gb|EEO43149.1| LSU ribosomal protein L16P [Fusobacterium sp. 7_1]
 gi|260197253|gb|EEW94772.1| ribosomal protein L16 [Fusobacterium sp. 3_1_33]
 gi|289717000|gb|EFD81012.1| LSU ribosomal protein L16P [Fusobacterium sp. D11]
          Length = 141

 Score =  189 bits (482), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 67/135 (49%), Positives = 93/135 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ K F+GR+KG A  G+ + FG++ L+A E + I + +IE+ R AI+R  KR
Sbjct: 1   MLMPKRTKHRKMFRGRMKGTAHKGNFVAFGDYGLQALEPSWITNRQIESCRVAINRTFKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+ +I +FPD P+TA+P  VRMGKGKGNVE WV  V+PGRILFE+ GV E+ A  A R 
Sbjct: 61  EGKTYIRIFPDKPITARPAGVRMGKGKGNVEGWVSVVRPGRILFEVSGVDEQTATEALRK 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL +  KF+++ 
Sbjct: 121 AAMKLPIRCKFVRKE 135


>gi|149371636|ref|ZP_01891052.1| 50S ribosomal protein L16 [unidentified eubacterium SCB49]
 gi|149355263|gb|EDM43823.1| 50S ribosomal protein L16 [unidentified eubacterium SCB49]
          Length = 139

 Score =  189 bits (482), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 73/133 (54%), Positives = 94/133 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQ KGR+KG A  G+++ +G F +K+ ++N + + +IEAAR A +R MKR
Sbjct: 1   MLQPKRTKFRKQQKGRMKGNAGRGNQLSYGTFGIKSLDSNFLTARQIEAARIAATRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G +WI +FPD P+T KP EVRMGKGKG VE W   VKPGR+LFEI GV  E A+ A RL
Sbjct: 61  EGSIWIMIFPDKPITKKPLEVRMGKGKGGVEYWAAVVKPGRVLFEISGVPMETAKEALRL 120

Query: 122 GAAKLSVVTKFIQ 134
            A KL V TKF+ 
Sbjct: 121 AAQKLPVKTKFVV 133


>gi|258648152|ref|ZP_05735621.1| ribosomal protein L16 [Prevotella tannerae ATCC 51259]
 gi|260852033|gb|EEX71902.1| ribosomal protein L16 [Prevotella tannerae ATCC 51259]
          Length = 141

 Score =  189 bits (482), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 66/134 (49%), Positives = 95/134 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TKY +  KGR KG A+ G+++ FG+F +K+ + + +   +IEAAR A++R M+R
Sbjct: 1   MLQPKRTKYRRPQKGRCKGNAQRGNQLAFGSFGIKSLQTHWLTGRQIEAARVAMTRYMQR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+ WI +FPD P+T KP +VRMGKGKG+   +V  + PGRI+FE++GV  EVA+ A RL
Sbjct: 61  EGQSWIRIFPDKPITKKPADVRMGKGKGDPVGYVFPITPGRIIFEVEGVPFEVAKEALRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + TKF+ R
Sbjct: 121 AAQKLPITTKFVVR 134


>gi|149922204|ref|ZP_01910642.1| 50S ribosomal protein L16 [Plesiocystis pacifica SIR-1]
 gi|149816944|gb|EDM76429.1| 50S ribosomal protein L16 [Plesiocystis pacifica SIR-1]
          Length = 138

 Score =  189 bits (482), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 67/135 (49%), Positives = 95/135 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P   KY K  KGR++G AKGG+ + +G+F L+A E   + S +IEAAR AI+R +KR
Sbjct: 1   MLSPNRVKYRKIHKGRMRGTAKGGTEVSYGDFGLQALECGWLTSRQIEAARIAINRRVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+++I VFPD P++ KP E RMGKGK   E WV  V+PGR+L+EI+G+ EE+AR+AF L
Sbjct: 61  GGKLYIRVFPDKPISKKPAETRMGKGKSGPEYWVAVVRPGRMLYEIEGIDEELARKAFLL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL + T+F++R 
Sbjct: 121 AHHKLPIKTRFVKRE 135


>gi|323148942|ref|YP_004222496.1| ribosomal protein L16 [Smilax china]
 gi|308742633|gb|ADO33484.1| ribosomal protein L16 [Smilax china]
          Length = 134

 Score =  189 bits (482), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 66/132 (50%), Positives = 93/132 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ KQ +GR+KG++  G+ ICFG +AL+A E   I + +IEA RRA++R  +R
Sbjct: 1   MLSPKRTKFRKQHRGRMKGISCRGNHICFGRYALQALEPAWITARQIEAGRRAMTRYARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +P E RMG GKG  E WV  VKPGR+L+E+ GVSE VAR A  +
Sbjct: 61  GGKIWVRIFPDKPVTVRPAETRMGSGKGAPEYWVSVVKPGRLLYEMGGVSETVARAAISI 120

Query: 122 GAAKLSVVTKFI 133
            A K+ + T+F+
Sbjct: 121 AACKMPIRTQFV 132


>gi|317496183|ref|ZP_07954543.1| ribosomal protein L16 [Gemella moribillum M424]
 gi|329768280|ref|ZP_08259781.1| 50S ribosomal protein L16 [Gemella haemolysans M341]
 gi|316913758|gb|EFV35244.1| ribosomal protein L16 [Gemella moribillum M424]
 gi|328837479|gb|EGF87108.1| 50S ribosomal protein L16 [Gemella haemolysans M341]
          Length = 141

 Score =  189 bits (482), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 73/135 (54%), Positives = 94/135 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +Q +   KG +KGG+ + FG + L+A  A R+ S +IEAAR A++R MKR
Sbjct: 1   MLMPKRVKYRRQHRQSTKGKSKGGNVVDFGEYGLQATTAARVTSRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP +P T KP EVRMG GKG VE WV  VKPGR++FE+ GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPHMPYTKKPLEVRMGSGKGAVEGWVAIVKPGRVMFEVAGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL V  KF++R 
Sbjct: 121 ASHKLPVKCKFVKRE 135


>gi|108773252|ref|YP_635787.1| ribosomal protein L16 [Chara vulgaris]
 gi|115502620|sp|Q1ACG0|RK16_CHAVU RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|77157908|gb|ABA61949.1| ribosomal protein L16 [Chara vulgaris]
          Length = 144

 Score =  189 bits (482), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 66/134 (49%), Positives = 94/134 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+ TK+ K  +GR+KG++  G+ I FG FAL+A E + I S +IEA RR+++R  +R
Sbjct: 1   MLSPRKTKFRKHHRGRMKGISTRGNSIVFGKFALQALEPSWITSRQIEAGRRSMTRYARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVT +P E RMG GKG+ E WV  VKPGRIL+E+DGV E +AR A ++
Sbjct: 61  GGKIWIRIFPDKPVTMRPAETRMGSGKGSPEYWVAVVKPGRILYEMDGVPENIARAAMKI 120

Query: 122 GAAKLSVVTKFIQR 135
            A K+   T+F+ R
Sbjct: 121 AAYKMPNKTQFLIR 134


>gi|224179440|ref|YP_002600843.1| ribosomal protein L16 [Pycnococcus provasolii]
 gi|217314483|gb|ACK36825.1| ribosomal protein L16 [Pycnococcus provasolii]
          Length = 139

 Score =  189 bits (482), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 68/135 (50%), Positives = 96/135 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ +  +GR++G    G++  FGNFAL+A E + + S ++EA RRAI+R ++R
Sbjct: 1   MLSPKRTKFRRYHRGRMRGRTLRGNKPVFGNFALRATECSWVTSRQLEAGRRAITRYVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD P+T +P E RMG GKG  E WV  V+PGRI++EIDGVSE VAR A RL
Sbjct: 61  GGKLWIRVFPDRPITMRPAETRMGSGKGAPEYWVAVVRPGRIIYEIDGVSESVARAAMRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A K+ + T+F+ R+
Sbjct: 121 AAYKMPMKTQFVSRM 135


>gi|7525070|ref|NP_051095.1| ribosomal protein L16 [Arabidopsis thaliana]
 gi|139387289|ref|YP_001123410.1| ribosomal protein L16 [Capsella bursa-pastoris]
 gi|139388131|ref|YP_001123323.1| ribosomal protein L16 [Barbarea verna]
 gi|139389133|ref|YP_001123851.1| ribosomal protein L16 [Nasturtium officinale]
 gi|139389455|ref|YP_001123152.1| ribosomal protein L16 [Olimarabidopsis pumila]
 gi|139389679|ref|YP_001123236.1| ribosomal protein L16 [Arabis hirsuta]
 gi|139389838|ref|YP_001123499.1| ribosomal protein L16 [Crucihimalaya wallichii]
 gi|139389987|ref|YP_001123587.1| ribosomal protein L16 [Draba nemorosa]
 gi|139390189|ref|YP_001123762.1| ribosomal protein L16 [Lobularia maritima]
 gi|297837923|ref|XP_002886843.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gi|297848250|ref|XP_002892006.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gi|6685863|sp|P56793|RK16_ARATH RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|215275546|sp|A4QK55|RK16_ARAHI RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|215275547|sp|A4QKE2|RK16_BARVE RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|215275550|sp|A4QKM9|RK16_CAPBU RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|215275555|sp|A4QKW8|RK16_CRUWA RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|215275563|sp|A4QL56|RK16_DRANE RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|215275573|sp|A4QLN1|RK16_LOBMA RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|215275576|sp|A4QLX0|RK16_NASOF RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|215275585|sp|A4QJW8|RK16_OLIPU RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|5881731|dbj|BAA84422.1| ribosomal protein L16 [Arabidopsis thaliana]
 gi|134286349|dbj|BAF49976.1| ribosomal protein L16 [Olimarabidopsis pumila]
 gi|134286434|dbj|BAF50060.1| ribosomal protein L16 [Arabis hirsuta]
 gi|134286522|dbj|BAF50147.1| ribosomal protein L16 [Barbarea verna]
 gi|134286610|dbj|BAF50234.1| ribosomal protein L16 [Capsella bursa-pastoris]
 gi|134286700|dbj|BAF50323.1| ribosomal protein L16 [Crucihimalaya wallichii]
 gi|134286789|dbj|BAF50411.1| ribosomal protein L16 [Draba nemorosa]
 gi|134286966|dbj|BAF50586.1| ribosomal protein L16 [Lobularia maritima]
 gi|134287056|dbj|BAF50675.1| ribosomal protein L16 [Nasturtium officinale]
 gi|297332684|gb|EFH63102.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gi|297337848|gb|EFH68265.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
          Length = 135

 Score =  189 bits (482), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 65/132 (49%), Positives = 96/132 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+RICFG +AL+  E   I S +IEA RRA++R ++R
Sbjct: 1   MLSPKRTRFRKQHRGRLKGISSRGNRICFGRYALQTLEPAWITSRQIEAGRRAMTRNVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +P E RMG GKG+ E WV  VKPG+IL+E+ GV E +AR+A  +
Sbjct: 61  GGKIWVRIFPDKPVTVRPAETRMGSGKGSPEYWVAVVKPGKILYEMGGVPENIARKAISI 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+FI
Sbjct: 121 AASKMPIKTQFI 132


>gi|239618258|ref|YP_002941580.1| ribosomal protein L16 [Kosmotoga olearia TBF 19.5.1]
 gi|259646053|sp|C5CGQ7|RL16_KOSOT RecName: Full=50S ribosomal protein L16
 gi|239507089|gb|ACR80576.1| ribosomal protein L16 [Kosmotoga olearia TBF 19.5.1]
          Length = 141

 Score =  189 bits (482), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 70/134 (52%), Positives = 95/134 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY KQ +G+++G AKGG+ + FG++ LKA E + I + +IEA R AI R +KR
Sbjct: 1   MLMPKRVKYRKQQRGKMRGKAKGGTLVHFGDWGLKALEPHWITAQQIEACRIAIMRTLKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI VFPD P+T+K   VRMGKGKG+VE WV  VKPG+ILFEI G+++E+A+ A   
Sbjct: 61  NGKVWIRVFPDKPITSKGIGVRMGKGKGDVEGWVAVVKPGKILFEIGGINDELAKEALAY 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + TK + R
Sbjct: 121 AATKLPIKTKIVPR 134


>gi|157325567|ref|YP_001468345.1| ribosomal protein L16 [Ipomoea purpurea]
 gi|215275569|sp|A7Y3I8|RK16_IPOPU RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|157056795|gb|ABV02385.1| ribosomal protein L16 [Ipomoea purpurea]
          Length = 147

 Score =  189 bits (482), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 68/137 (49%), Positives = 100/137 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++ GG+ ICFG +AL+A E   I S +IEA RRA++R  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGISSGGNHICFGKYALQALEPAWITSRQIEAGRRAMTRNARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +P E RMG GKG+ E WV  VKPGRIL+E+ GV++++ARRA  +
Sbjct: 61  GGKIWVRIFPDKPVTVRPAETRMGSGKGSPEYWVAVVKPGRILYEMGGVTKKIARRAISI 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            A+K+ + T+FI   +E
Sbjct: 121 AASKMPIRTQFISSEIE 137


>gi|78103287|ref|YP_358619.1| ribosomal protein L16 [Phalaenopsis aphrodite subsp. formosana]
 gi|85541793|sp|Q3BAJ9|RK16_PHAAO RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|58802817|gb|AAW82537.1| ribosomal protein L16 [Phalaenopsis aphrodite subsp. formosana]
          Length = 135

 Score =  189 bits (482), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 65/132 (49%), Positives = 95/132 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+ ICFG +AL+A E   I + +IEA RRA++R  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGISCRGNHICFGRYALQALEPAWITARQIEAGRRAMTRYARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +PTE RMG GKG+ E WV  VKPGRI++E+ GVSE VA+ A  +
Sbjct: 61  GGKIWVRIFPDKPVTVRPTETRMGSGKGSPEYWVSVVKPGRIIYEMSGVSEAVAKAAMEI 120

Query: 122 GAAKLSVVTKFI 133
            A K+ + T+F+
Sbjct: 121 AACKMPIRTQFV 132


>gi|124268620|ref|YP_001022624.1| 50S ribosomal protein L16 [Methylibium petroleiphilum PM1]
 gi|166199683|sp|A2SLF0|RL16_METPP RecName: Full=50S ribosomal protein L16
 gi|124261395|gb|ABM96389.1| LSU ribosomal protein L16P [Methylibium petroleiphilum PM1]
          Length = 138

 Score =  189 bits (482), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 71/136 (52%), Positives = 97/136 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QP   K+ K+ KGR  G+A  G+ + FG+F LKA E  R+ + +IEAARRAISR +KR
Sbjct: 1   MLQPSRRKFRKEQKGRNTGIATRGANVSFGDFGLKATERGRLTARQIEAARRAISRHVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI +FPD P++ KP EVRMG GKGN E +V  ++PG++L+EI+GV EE+AR AF L
Sbjct: 61  GGRIWIRIFPDKPISQKPAEVRMGNGKGNPEYYVAEIQPGKVLYEINGVPEELAREAFTL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL +   F+ R +
Sbjct: 121 AAAKLPLRCTFVSRQI 136


>gi|114330007|ref|YP_740688.1| ribosomal protein L16 [Nandina domestica]
 gi|122165924|sp|Q09FS3|RK16_NANDO RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|114054509|gb|ABI49902.1| ribosomal protein L16 [Nandina domestica]
          Length = 135

 Score =  189 bits (482), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 66/132 (50%), Positives = 95/132 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+ ICFG +AL+A E   I S +IEA R++++R  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGISYRGNHICFGRYALQALEPAWITSRQIEAGRKSMARYARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVT +PTE RMG GKG+ E WV  VKPGRIL+E+ GVSE  AR A  +
Sbjct: 61  GGKIWIRIFPDKPVTVRPTETRMGSGKGSPEYWVSVVKPGRILYEMGGVSEIAAREAISI 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+F+
Sbjct: 121 AASKMPIRTQFV 132


>gi|167391843|ref|YP_001671720.1| ribosomal protein L16 [Carica papaya]
 gi|215275551|sp|B1A972|RK16_CARPA RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|166344170|gb|ABY86820.1| ribosomal protein L16 [Carica papaya]
          Length = 135

 Score =  189 bits (482), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 69/132 (52%), Positives = 99/132 (75%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+RICFG +AL+A E   I S +IEA RRA++R ++R
Sbjct: 1   MLSPKRTRFRKQHRGRLKGISYRGNRICFGRYALQALEPTWITSRQIEAGRRAMTRNIRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +PTE RMG GKG+ E WV  VKPGRIL+E+ GV+E +ARRA  +
Sbjct: 61  GGKIWVRIFPDKPVTLRPTETRMGSGKGSPEYWVAVVKPGRILYEMSGVAENIARRAISI 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+FI
Sbjct: 121 AASKMPIKTQFI 132


>gi|41179016|ref|NP_958371.1| ribosomal protein L16 [Chlamydomonas reinhardtii]
 gi|132701|sp|P05726|RK16_CHLRE RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|11456|emb|CAA28835.1| unnamed protein product [Chlamydomonas reinhardtii]
 gi|895616|gb|AAA84151.1| putative [Chlamydomonas reinhardtii]
 gi|28269739|tpg|DAA00917.1| TPA_inf: ribosomal protein L16 [Chlamydomonas reinhardtii]
 gi|213517398|gb|ACJ50104.1| ribosomal protein L16 [Chlamydomonas reinhardtii]
 gi|225187|prf||1210360A ORF,replication origin
          Length = 136

 Score =  189 bits (482), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 65/136 (47%), Positives = 93/136 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ K  +G ++G A  G++I FG+FAL+AQE   I S +IEA RR ++R ++R
Sbjct: 1   MLSPKRTKFRKPHRGHLRGKATRGNKIVFGDFALQAQEPCWITSRQIEAGRRVLTRYVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD  VT +P   RMG GKG  + WV  V PG+IL+E+ GVSE +AR+A R+
Sbjct: 61  GGKLWIRIFPDKAVTMRPAGTRMGSGKGAPDYWVAVVHPGKILYEMQGVSETIARQAMRI 120

Query: 122 GAAKLSVVTKFIQRVV 137
            A K+ V TKF+ + V
Sbjct: 121 AAYKMPVKTKFLTKTV 136


>gi|92112561|ref|YP_572489.1| 50S ribosomal protein L16 [Chromohalobacter salexigens DSM 3043]
 gi|115502743|sp|Q1R0G8|RL16_CHRSD RecName: Full=50S ribosomal protein L16
 gi|91795651|gb|ABE57790.1| LSU ribosomal protein L16P [Chromohalobacter salexigens DSM 3043]
          Length = 137

 Score =  189 bits (482), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 76/136 (55%), Positives = 101/136 (74%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGR +G+A  GS++ FG + LKA    RI + +IEA RRAI+R +KR
Sbjct: 1   MLQPKRTKFRKVQKGRNRGLAHRGSKVSFGEYGLKATGRGRITARQIEAGRRAITRHVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD P+T KP EVRMGKGKG+VE WV +++PG++L+EI+GVSEE+AR AF L
Sbjct: 61  GGKIWIRVFPDKPITEKPLEVRMGKGKGSVEYWVAQIQPGKVLYEIEGVSEELAREAFDL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            A K  V T F++R V
Sbjct: 121 AAQKFPVSTTFVKRTV 136


>gi|153805620|ref|YP_001382204.1| ribosomal protein L16 [Leptosira terrestris]
 gi|215275571|sp|A6YGC7|RK16_LEPTE RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|134270151|gb|ABO69340.1| ribosomal protein L16 [Leptosira terrestris]
          Length = 139

 Score =  189 bits (482), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 68/134 (50%), Positives = 94/134 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY K  +GR+KG A  G++I FG+FAL+A E   I S +IEA RRA++R  +R
Sbjct: 1   MLSPKRTKYRKHHRGRMKGKATRGNKIVFGDFALQALEPAWITSRQIEAGRRAMTRYARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVT +P E RMG GKG+ E WV  VKPG+IL+E+ GVSE +AR A R+
Sbjct: 61  GGKLWIRIFPDKPVTMRPAESRMGSGKGSPEYWVAVVKPGKILYEMKGVSEIIARAAMRI 120

Query: 122 GAAKLSVVTKFIQR 135
            + K+ + T F+ +
Sbjct: 121 ASYKMPIKTNFLVK 134


>gi|45477208|sp|Q9RXJ5|RL16_DEIRA RecName: Full=50S ribosomal protein L16
 gi|28948893|pdb|1NJM|K Chain K, The Crystal Structure Of The 50s Large Ribosomal Subunit
           From Deinococcus Radiodurans Complexed With A Trna
           Acceptor Stem Mimic (Asm) And The Antibiotic Sparsomycin
 gi|28948899|pdb|1NJP|K Chain K, The Crystal Structure Of The 50s Large Ribosomal Subunit
           From Deinococcus Radiodurans Complexed With A Trna
           Acceptor Stem Mimic (Asm)
 gi|29726798|pdb|1NWX|K Chain K, Complex Of The Large Ribosomal Subunit From Deinococcus
           Radiodurans With Abt-773
 gi|29726829|pdb|1NWY|K Chain K, Complex Of The Large Ribosomal Subunit From Deinococcus
           Radiodurans With Azithromycin
 gi|61680346|pdb|1XBP|K Chain K, Inhibition Of Peptide Bond Formation By Pleuromutilins:
           The Structure Of The 50s Ribosomal Subunit From
           Deinococcus Radiodurans In Complex With Tiamulin
 gi|61680521|pdb|1Y69|K Chain K, Rrf Domain I In Complex With The 50s Ribosomal Subunit
           From Deinococcus Radiodurans
 gi|323714550|pdb|3PIO|J Chain J, Crystal Structure Of The Synergistic Antibiotic Pair
           Lankamycin And Lankacidin In Complex With The Large
           Ribosomal Subunit
 gi|323714580|pdb|3PIP|J Chain J, Crystal Structure Of The Synergistic Antibiotic Pair
           Lankamycin And Lankacidin In Complex With The Large
           Ribosomal Subunit
          Length = 141

 Score =  189 bits (482), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 72/136 (52%), Positives = 95/136 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ KQF+GR+ G AKGG  + FG++ L A E   I S++IEA R  +SR  +R
Sbjct: 1   MLLPKRTKFRKQFRGRMTGDAKGGDYVAFGDYGLIAMEPAWIKSNQIEACRIVMSRHFRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+++I +FPD PVT KP E RMGKGKG VE WV  VKPGR++FE+ GV+EE A+ AFRL
Sbjct: 61  GGKIYIRIFPDKPVTKKPAETRMGKGKGAVEYWVSVVKPGRVMFEVAGVTEEQAKEAFRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
              KL + TK ++R V
Sbjct: 121 AGHKLPIQTKMVKREV 136


>gi|90424930|ref|YP_533300.1| 50S ribosomal protein L16 [Rhodopseudomonas palustris BisB18]
 gi|115502783|sp|Q211F5|RL16_RHOPB RecName: Full=50S ribosomal protein L16
 gi|90106944|gb|ABD88981.1| LSU ribosomal protein L16P [Rhodopseudomonas palustris BisB18]
          Length = 137

 Score =  189 bits (482), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 81/137 (59%), Positives = 101/137 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGRI GVA  G+ + FG F LKA    RI + +IEAARRA++R MKR
Sbjct: 1   MMQPKKTKFRKAHKGRIHGVATSGATLSFGQFGLKAMAPERITARQIEAARRALTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AGRVWI +FPD+PV+ KP EVRMG GKG  E WV RVKPGR++FEIDGV+ +VA+ A  L
Sbjct: 61  AGRVWIRIFPDLPVSKKPAEVRMGSGKGTPELWVARVKPGRVIFEIDGVNVQVAKEALTL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            AAKL + T+F+ R+ E
Sbjct: 121 AAAKLPIKTRFVARIAE 137


>gi|303237515|ref|ZP_07324080.1| ribosomal protein L16 [Prevotella disiens FB035-09AN]
 gi|302482335|gb|EFL45365.1| ribosomal protein L16 [Prevotella disiens FB035-09AN]
          Length = 142

 Score =  189 bits (481), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 71/135 (52%), Positives = 92/135 (68%), Gaps = 1/135 (0%)

Query: 2   LRQPKNTKYPKQFKGR-IKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMK 60
           + QPK  KY +   GR  KG A  G+++ FG+F +K  E   I S +IEAAR A++R M 
Sbjct: 1   MLQPKRVKYRRPQDGRGNKGNAHRGTQLAFGSFGIKTLEPKWIDSRQIEAARIAVNRYMN 60

Query: 61  RAGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFR 120
           R G+VWI +FPD P+T KP +VRMGKGKG+   WV  V PGRILFE++GVS ++A+ A R
Sbjct: 61  RQGQVWIRIFPDKPITRKPADVRMGKGKGDPAGWVAPVTPGRILFEVEGVSFDIAKEALR 120

Query: 121 LGAAKLSVVTKFIQR 135
           L A KL V TKF+ R
Sbjct: 121 LAAQKLPVKTKFVVR 135


>gi|296268557|ref|YP_003651189.1| 50S ribosomal protein L16 [Thermobispora bispora DSM 43833]
 gi|296091344|gb|ADG87296.1| ribosomal protein L16 [Thermobispora bispora DSM 43833]
          Length = 139

 Score =  189 bits (481), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 63/136 (46%), Positives = 93/136 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  K+ KQ + R  G+AKGG+R+ FG++ ++A E   + + +IEAAR A++R ++R
Sbjct: 1   MLIPRKVKHRKQHRPRRSGMAKGGTRVVFGDYGIQALEHAYVTNRQIEAARIAMTRHIRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T KP E RMG GKG+ E W+  VKPGR++FE+ GV E VAR A R 
Sbjct: 61  GGKVWINIFPDRPLTKKPAETRMGSGKGSPEWWIANVKPGRVMFELSGVPEPVAREALRR 120

Query: 122 GAAKLSVVTKFIQRVV 137
              KL +  +F++R V
Sbjct: 121 AMHKLPMKCRFVKREV 136


>gi|226968671|ref|YP_002808631.1| large subunit ribosomal protein 16 [Micromonas sp. RCC299]
 gi|226431149|gb|ACO55555.1| large subunit ribosomal protein 16 [Micromonas sp. RCC299]
          Length = 139

 Score =  189 bits (481), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 71/135 (52%), Positives = 92/135 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY K  +GR+KG A  G++I FG+F L+A E   I S +IEA RRA+SR  +R
Sbjct: 1   MLSPKRTKYRKPHRGRLKGQAMRGNKISFGDFGLQALEPGWITSRQIEAGRRAMSRYARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD  +TA+  E RMG GKG  + WV  VKPG+IL+E+ GVSE VAR + R+
Sbjct: 61  GGKLWIRVFPDKSITARAAETRMGAGKGAPDYWVAVVKPGKILYEMRGVSEAVARSSMRI 120

Query: 122 GAAKLSVVTKFIQRV 136
            A K+ V TKFI R 
Sbjct: 121 AAYKMPVKTKFIIRE 135


>gi|75755697|ref|YP_319801.1| ribosomal protein L16 [Acorus calamus]
 gi|161622347|ref|YP_001586219.1| ribosomal protein L16 [Acorus americanus]
 gi|85541763|sp|Q3V4Z6|RK16_ACOCL RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|215275541|sp|A9LYD8|RK16_ACOAM RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|74381747|emb|CAI53832.1| ribosomal protein L16 [Acorus calamus]
 gi|160369890|gb|ABX38781.1| ribosomal protein L16 [Acorus americanus]
          Length = 135

 Score =  189 bits (481), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 69/132 (52%), Positives = 96/132 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  GS ICFG +AL+A E + I S +IEA RRA++R  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGMSYRGSHICFGRYALQALEPSWITSRQIEAGRRAMTRYARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +P E RMG GKG+ E WV  VKPGRIL+E+ GVSE VAR A  +
Sbjct: 61  GGKIWVRIFPDKPVTIRPAETRMGSGKGSPEYWVSVVKPGRILYEMGGVSETVARAAIEI 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+FI
Sbjct: 121 AASKMPIRTQFI 132


>gi|89280672|ref|YP_514889.1| ribosomal protein L16 [Solanum lycopersicum]
 gi|115502624|sp|Q2MI63|RK16_SOLLC RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|84372020|gb|ABC56337.1| ribosomal protein L16 [Solanum lycopersicum]
 gi|89241708|emb|CAJ32431.1| ribosomal protein L16 [Solanum lycopersicum]
          Length = 134

 Score =  189 bits (481), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 68/132 (51%), Positives = 96/132 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+RI FG +AL+A E   I S +IEA RRA++R  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGISYRGNRISFGKYALQALEPAWITSRQIEAGRRAMTRNARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +P E RMG GKG+ E WV  VKPGRIL+E+ GV+E +ARRA  L
Sbjct: 61  GGKIWVRIFPDKPVTLRPAETRMGSGKGSPEYWVAVVKPGRILYEMGGVTENIARRAISL 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+FI
Sbjct: 121 AASKMPIRTQFI 132


>gi|217976760|ref|YP_002360907.1| 50S ribosomal protein L16 [Methylocella silvestris BL2]
 gi|254799211|sp|B8ELF6|RL16_METSB RecName: Full=50S ribosomal protein L16
 gi|217502136|gb|ACK49545.1| ribosomal protein L16 [Methylocella silvestris BL2]
          Length = 137

 Score =  189 bits (481), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 86/137 (62%), Positives = 104/137 (75%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K FKGRI G AKGG  + FG F LKA E  RI + +IEAARRA++R MKR
Sbjct: 1   MLQPKRTKFRKAFKGRIHGAAKGGFELSFGQFGLKALEPERITARQIEAARRAMTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AGRVWI +FPDVPV+ KPTEVRMGKGKG  E W  RV PGRI+FE+DGV  ++AR A +L
Sbjct: 61  AGRVWIRIFPDVPVSKKPTEVRMGKGKGAPELWAVRVAPGRIMFELDGVPVDLAREALQL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            +AKL + T+FIQR+ E
Sbjct: 121 ASAKLPIKTRFIQRIQE 137


>gi|187476546|ref|YP_784570.1| 50S ribosomal protein L16 [Bordetella avium 197N]
 gi|115502734|sp|Q2L2B8|RL16_BORA1 RecName: Full=50S ribosomal protein L16
 gi|115421132|emb|CAJ47616.1| 50S ribosomal protein L16 [Bordetella avium 197N]
          Length = 138

 Score =  189 bits (481), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 73/136 (53%), Positives = 99/136 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QP   KY K+ KGR  G+A  G+++ FG F LKA    R+ + +IEAARRAI+R +KR
Sbjct: 1   MLQPSRRKYRKEQKGRNTGLATRGAQVSFGEFGLKATGRGRLTARQIEAARRAINRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI +FPD P++ KP EVRMG GKGN E WV  ++PG++L+E++GVSEE+AR AFRL
Sbjct: 61  GGRIWIRIFPDKPISQKPAEVRMGNGKGNPEYWVAEIQPGKVLYEMEGVSEELAREAFRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + T F+ R +
Sbjct: 121 AAAKLPISTTFVARHI 136


>gi|117927522|ref|YP_872073.1| 50S ribosomal protein L16 [Acidothermus cellulolyticus 11B]
 gi|166234537|sp|A0LRM7|RL16_ACIC1 RecName: Full=50S ribosomal protein L16
 gi|117647985|gb|ABK52087.1| LSU ribosomal protein L16P [Acidothermus cellulolyticus 11B]
          Length = 139

 Score =  189 bits (481), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 64/137 (46%), Positives = 92/137 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  K+ KQ   +  GVAKGG+R+ FG + ++A E   + + +IE+AR A++R ++R
Sbjct: 1   MLIPRKVKHRKQHHPKRSGVAKGGTRVVFGEYGIQALEPAYVTNRQIESARIAMTRHIRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T KP E RMG GKG+ E WV  VKPGR++FE+ GV E VAR A R 
Sbjct: 61  GGKVWITIFPDRPLTKKPAETRMGSGKGSPEWWVANVKPGRVMFELAGVPEPVAREALRR 120

Query: 122 GAAKLSVVTKFIQRVVE 138
              KL +  +F++R VE
Sbjct: 121 AMHKLPMKCRFVRREVE 137


>gi|132702|sp|P05727|RK16_CHLSP RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|11467|emb|CAA28834.1| unnamed protein product [Chlamydomonas sp. WXM]
          Length = 136

 Score =  189 bits (481), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 64/136 (47%), Positives = 91/136 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ K  +G ++G A  G+ I FG+FAL+AQE   I S +IEA RR ++R ++R
Sbjct: 1   MLSPKRTKFRKPHRGHLRGKATRGNTIVFGDFALQAQEPCWITSRQIEAGRRVLTRYVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD  VT +P   RMG GKG  + WV  V PG+IL+E+ GVSE +AR+A R+
Sbjct: 61  GGKLWIRIFPDKAVTMRPAGTRMGSGKGAPDYWVAVVHPGKILYEMQGVSETIARQAMRI 120

Query: 122 GAAKLSVVTKFIQRVV 137
            A K+ V TKF+ +  
Sbjct: 121 AAYKMPVKTKFLTKQA 136


>gi|86749422|ref|YP_485918.1| 50S ribosomal protein L16 [Rhodopseudomonas palustris HaA2]
 gi|115502782|sp|Q2IXQ3|RL16_RHOP2 RecName: Full=50S ribosomal protein L16
 gi|86572450|gb|ABD07007.1| LSU ribosomal protein L16P [Rhodopseudomonas palustris HaA2]
          Length = 137

 Score =  189 bits (481), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 81/137 (59%), Positives = 102/137 (74%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGRI GVA  G+ + FG F LKA E  R+ + +IEAARRA++R MKR
Sbjct: 1   MMQPKKTKFRKAHKGRIHGVASSGATLAFGQFGLKAMEPERVTARQIEAARRALTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AGRVWI +FPDVPV+ KP EVRMG GKG  E WV RVKPGR++FEIDGV+++ A+ A  L
Sbjct: 61  AGRVWIRIFPDVPVSKKPAEVRMGSGKGAPELWVARVKPGRVMFEIDGVNQQTAKEALTL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            AAKL + T+F+ R+ E
Sbjct: 121 AAAKLPIKTRFVARIAE 137


>gi|315125269|ref|YP_004067272.1| 50S ribosomal protein L16 [Pseudoalteromonas sp. SM9913]
 gi|315013782|gb|ADT67120.1| 50S ribosomal protein L16 [Pseudoalteromonas sp. SM9913]
          Length = 137

 Score =  189 bits (481), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 74/136 (54%), Positives = 101/136 (74%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGR +G+A+ G+++ FG F LKA    R+ + +IEAARRA++R +KR
Sbjct: 1   MLQPKRTKFRKMHKGRNRGLAQNGNKVSFGTFGLKATGRGRMTARQIEAARRAMTRHVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD P+T KP EVRMGKGKG+VE WV  ++PG++L+E++GVSEE+AR AF L
Sbjct: 61  QGKIWIRVFPDKPITEKPLEVRMGKGKGSVEYWVAEIQPGKVLYEMEGVSEELAREAFNL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            A KL   T F+ R V
Sbjct: 121 AARKLPFKTTFVTRTV 136


>gi|320335516|ref|YP_004172227.1| 50S ribosomal protein L16 [Deinococcus maricopensis DSM 21211]
 gi|319756805|gb|ADV68562.1| 50S ribosomal protein L16 [Deinococcus maricopensis DSM 21211]
          Length = 141

 Score =  189 bits (481), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 71/136 (52%), Positives = 94/136 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY K F+GR+ G AKGG  + FG++ L A E   I S++IEA R  +SR  +R
Sbjct: 1   MLLPKRTKYRKMFRGRMTGDAKGGDYVAFGDYGLIATEPAWIKSNQIEACRIVMSRHFRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+++I +FPD P+T KP E RMGKGKG VE WV  VKPGR++FE+ GV+EE A+ AFRL
Sbjct: 61  GGKIYIRIFPDKPITKKPAETRMGKGKGAVEYWVAVVKPGRVMFEVAGVTEEQAKEAFRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
              KL + TK ++R V
Sbjct: 121 AGHKLPIATKMVKREV 136


>gi|88860952|ref|ZP_01135588.1| 50S ribosomal protein L16 [Pseudoalteromonas tunicata D2]
 gi|88817165|gb|EAR26984.1| 50S ribosomal protein L16 [Pseudoalteromonas tunicata D2]
          Length = 137

 Score =  189 bits (481), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 73/136 (53%), Positives = 102/136 (75%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGR +G+A+ G+++ FG+F LKA    R+ + +IEAARRA++R +KR
Sbjct: 1   MLQPKRTKFRKMHKGRNRGLAQNGNKVSFGSFGLKATGRGRMTARQIEAARRAMTRHVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD P+T KP EVRMGKGKG+VE WV  ++PGR+L+E++GVSE++AR AF L
Sbjct: 61  QGKIWIRVFPDKPITEKPLEVRMGKGKGSVEYWVAEIQPGRVLYEMEGVSEQIAREAFDL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            + KL   T F+ R V
Sbjct: 121 ASRKLPFKTTFVTRTV 136


>gi|326332198|ref|ZP_08198478.1| ribosomal protein L16 [Nocardioidaceae bacterium Broad-1]
 gi|325949904|gb|EGD41964.1| ribosomal protein L16 [Nocardioidaceae bacterium Broad-1]
          Length = 139

 Score =  189 bits (481), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 63/136 (46%), Positives = 91/136 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  K+ KQ   +  GVAKGG+++ FG++ ++A E + + + +IEAAR A++R +KR
Sbjct: 1   MLMPRRVKHRKQHHPKRTGVAKGGTKLAFGDYGIQAIEGHYVTNRQIEAARIAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI ++PDVP+T KP E RMG GKG+ E WV  VKPGR++FE+ GV E  AR A R 
Sbjct: 61  GGKVWINIYPDVPLTKKPAETRMGSGKGSPEWWVANVKPGRVMFELSGVDENTAREAMRR 120

Query: 122 GAAKLSVVTKFIQRVV 137
              KL +  +FI R  
Sbjct: 121 AIHKLPMKCRFITREA 136


>gi|256825879|ref|YP_003149839.1| 50S ribosomal protein L16P [Kytococcus sedentarius DSM 20547]
 gi|256689272|gb|ACV07074.1| LSU ribosomal protein L16P [Kytococcus sedentarius DSM 20547]
          Length = 139

 Score =  189 bits (481), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 59/135 (43%), Positives = 91/135 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  K+ KQ   +  G +KGG+++ FG++ ++A     + + +IE+AR A++R +KR
Sbjct: 1   MLIPRRVKHRKQHHPKRGGASKGGTQLAFGDYGIQALGPAYVTNRQIESARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI ++PD P+T KP EVRMG GKG+ E WV  VKPGRI+FE+ GV+++VAR A RL
Sbjct: 61  GGKVWINIYPDRPLTKKPAEVRMGSGKGSPEWWVANVKPGRIMFELSGVTDDVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  + + R 
Sbjct: 121 AMHKLPMKCRIVARE 135


>gi|309322142|ref|YP_003934057.1| ribosomal protein L16 [Geranium palmatum]
 gi|197131820|gb|ACH47428.1| ribosomal protein L16 [Geranium palmatum]
 gi|300069235|gb|ADJ66356.1| ribosomal protein L16 [Geranium palmatum]
          Length = 137

 Score =  189 bits (481), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 70/137 (51%), Positives = 98/137 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ K+ +GR+KG+A  GSRI FG +AL+A E   I S +IEA RRAI+R ++R
Sbjct: 1   MLSPKRTKFRKEHRGRMKGIASKGSRISFGRYALQALEPAWITSRQIEAGRRAITRNVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+C+FPD PVT + TE RMG GKG+ E WV  VKPGRIL+E+ GV+E +AR+A  +
Sbjct: 61  GGKIWVCIFPDKPVTVRSTETRMGSGKGSPEYWVAVVKPGRILYEMGGVTENIARKAISI 120

Query: 122 GAAKLSVVTKFIQRVVE 138
             +K+ + T+FI    E
Sbjct: 121 AGSKMPIRTQFIIADSE 137


>gi|228472308|ref|ZP_04057074.1| ribosomal protein L16 [Capnocytophaga gingivalis ATCC 33624]
 gi|228276511|gb|EEK15235.1| ribosomal protein L16 [Capnocytophaga gingivalis ATCC 33624]
          Length = 139

 Score =  189 bits (481), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 74/133 (55%), Positives = 95/133 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TKY K  KGR+KGV++ G ++  G F +K+ E+  I + +IE+AR A +R MKR
Sbjct: 1   MLQPKRTKYRKDQKGRMKGVSQRGHQLSNGTFGIKSLESAFITARQIESARVAATRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T KP EVRMGKGKG VE WV  VKPGRILFE+ GV  E+A+ A RL
Sbjct: 61  EGQLWIKIFPDKPITKKPLEVRMGKGKGAVEYWVAVVKPGRILFEVGGVPLEIAKEALRL 120

Query: 122 GAAKLSVVTKFIQ 134
            A KL V TKF+ 
Sbjct: 121 AAQKLPVTTKFVV 133


>gi|184155984|ref|YP_001844324.1| 50S ribosomal protein L16 [Lactobacillus fermentum IFO 3956]
 gi|227515494|ref|ZP_03945543.1| ribosomal protein L16 [Lactobacillus fermentum ATCC 14931]
 gi|260662759|ref|ZP_05863653.1| 50S ribosomal protein L16 [Lactobacillus fermentum 28-3-CHN]
 gi|226710740|sp|B2GDW2|RL16_LACF3 RecName: Full=50S ribosomal protein L16
 gi|183227328|dbj|BAG27844.1| 50S ribosomal protein L16 [Lactobacillus fermentum IFO 3956]
 gi|227086107|gb|EEI21419.1| ribosomal protein L16 [Lactobacillus fermentum ATCC 14931]
 gi|260552840|gb|EEX25839.1| 50S ribosomal protein L16 [Lactobacillus fermentum 28-3-CHN]
          Length = 144

 Score =  189 bits (481), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 63/135 (46%), Positives = 88/135 (65%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ K  +G+++G AKGG  + FG F L+A +++ I + +IEAAR A++R MKR
Sbjct: 1   MLVPKRVKHRKVQRGKMRGEAKGGKTVTFGEFGLQALDSHWISNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP +  T+K    RMG GKG  E WV  VK  +++FE+ GV EEVAR A RL
Sbjct: 61  GGKVWIKIFPHLSYTSKGVGTRMGNGKGAPEGWVAPVKRMKVMFEVAGVPEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL V TK ++R 
Sbjct: 121 AGNKLPVRTKIVKRE 135


>gi|313158333|gb|EFR57735.1| ribosomal protein L16 [Alistipes sp. HGB5]
          Length = 142

 Score =  189 bits (481), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 76/134 (56%), Positives = 101/134 (75%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ +  KGR+KG+A+ G+++ +G+FA+KA E+  I   +IEAAR+AI+R MKR
Sbjct: 1   MLQPKKTKFRRMQKGRMKGIAQRGNQLAYGSFAIKALESTWITGRQIEAARQAITRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T KP EVRMGKGKGN E +V  V PGRILFE +GV  E+A+ A RL
Sbjct: 61  EGQLWIRIFPDKPITKKPAEVRMGKGKGNPEGFVAPVTPGRILFEAEGVPLEIAQEALRL 120

Query: 122 GAAKLSVVTKFIQR 135
           GA KL + TKFI R
Sbjct: 121 GAQKLPITTKFIVR 134


>gi|91209025|ref|YP_538887.1| ribosomal protein L16 [Solanum bulbocastanum]
 gi|115502630|sp|Q2MIF0|RK16_SOLBU RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|84371932|gb|ABC56250.1| ribosomal protein L16 [Solanum bulbocastanum]
          Length = 134

 Score =  189 bits (481), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 68/132 (51%), Positives = 96/132 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+RI FG +AL+A E   I S +IEA RRA++R  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGISSRGNRISFGKYALQALEPAWITSRQIEAGRRAMTRNARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +P E RMG GKG+ E WV  VKPGRIL+E+ GV+E +ARRA  L
Sbjct: 61  GGKIWVRIFPDKPVTLRPAETRMGSGKGSPEYWVAVVKPGRILYEMGGVTENIARRAISL 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+FI
Sbjct: 121 AASKMPIRTQFI 132


>gi|108796829|ref|YP_636423.1| ribosomal protein L16 [Staurastrum punctulatum]
 gi|85541795|sp|Q32RV3|RK16_STAPU RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|61393597|gb|AAX45738.1| ribosomal protein L16 [Staurastrum punctulatum]
          Length = 141

 Score =  189 bits (481), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 69/133 (51%), Positives = 94/133 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+ TKY KQ +GR+KG A  G+RICFG FAL+A E + I S +IEA RRA++R  +R
Sbjct: 1   MLSPRRTKYRKQHRGRLKGTATRGNRICFGRFALQALEPSWITSRQIEAGRRAMTRYARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD  +T +P E RMG GKG  E WV  VKPGRIL+E+ GVSE VAR A ++
Sbjct: 61  GGKLWIRIFPDKSITMRPAETRMGSGKGAPEYWVAVVKPGRILYEMSGVSETVARSAMKI 120

Query: 122 GAAKLSVVTKFIQ 134
            + K+ + T+F+ 
Sbjct: 121 ASYKMPIKTQFLV 133


>gi|116493156|ref|YP_804891.1| 50S ribosomal protein L16 [Pediococcus pentosaceus ATCC 25745]
 gi|122265380|sp|Q03EC3|RL16_PEDPA RecName: Full=50S ribosomal protein L16
 gi|116103306|gb|ABJ68449.1| LSU ribosomal protein L16P [Pediococcus pentosaceus ATCC 25745]
          Length = 144

 Score =  189 bits (481), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 65/135 (48%), Positives = 89/135 (65%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ ++ +GR++G AKGG  + FG + L+A  ++ I + +IEAAR A++R MKR
Sbjct: 1   MLVPKRVKHRREHRGRMRGAAKGGKTVAFGEYGLQALTSSWITNRQIEAARVAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP    T+K   VRMG GKG  E WV  VK  +++FE+ GV EEVAR A RL
Sbjct: 61  GGKVWIKIFPHKSYTSKGVGVRMGNGKGTPEGWVAPVKREKVMFEVAGVPEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL V TK I+R 
Sbjct: 121 AAMKLPVKTKIIERE 135


>gi|325981812|ref|YP_004294214.1| 50S ribosomal protein L16 [Nitrosomonas sp. AL212]
 gi|325531331|gb|ADZ26052.1| ribosomal protein L16 [Nitrosomonas sp. AL212]
          Length = 138

 Score =  189 bits (481), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 72/136 (52%), Positives = 100/136 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QP  TKY KQ KGR  G+A  G+++ FG F LKA E  R+ S +IEAARRA++R +KR
Sbjct: 1   MLQPARTKYRKQQKGRNTGIATRGAKVSFGEFGLKAIERGRLTSRQIEAARRAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI +FPD P++ KP EVRMG GKG+ E +V  ++PG++L+E+DGV+EE+A+ AF+L
Sbjct: 61  GGRIWIRIFPDKPISQKPAEVRMGNGKGSPEYYVAEIQPGKVLYEMDGVTEELAKEAFQL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + T F  R +
Sbjct: 121 AAAKLPIKTTFTVRQI 136


>gi|226939193|ref|YP_002794264.1| 50S ribosomal protein L16 [Laribacter hongkongensis HLHK9]
 gi|254799206|sp|C1DAS4|RL16_LARHH RecName: Full=50S ribosomal protein L16
 gi|226714117|gb|ACO73255.1| RplP [Laribacter hongkongensis HLHK9]
          Length = 138

 Score =  189 bits (481), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 75/136 (55%), Positives = 100/136 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QP   KY K  KGR  G+A  G+++ FG+F LKA    R+ + +IEAARRA++R +KR
Sbjct: 1   MLQPTRLKYRKVHKGRNTGIATRGTKVSFGDFGLKAVGRGRLTARQIEAARRAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI VFPD P+T KP EVRMG GKG+VE WV  ++PG++L+E++GVSEE+AR AFRL
Sbjct: 61  GGRIWIRVFPDKPITKKPAEVRMGNGKGSVEYWVAEIQPGKMLYEMEGVSEELAREAFRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + T F+ R V
Sbjct: 121 AAAKLPIATTFVVRQV 136


>gi|313183859|ref|YP_004021702.1| ribosomal protein L16 [Prunus persica]
 gi|309321471|gb|ADO65012.1| ribosomal protein L16 [Prunus persica]
          Length = 135

 Score =  189 bits (481), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 69/132 (52%), Positives = 98/132 (74%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+RICFG +AL+A E   I S +IEA RRA++R  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGISYRGNRICFGRYALQALEPAWITSRQIEAGRRAMTRNARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +PTE RMG GKG+ E WV  VKPGRIL+E+ GV+E +ARRA  +
Sbjct: 61  GGKIWVRIFPDKPVTVRPTETRMGSGKGSPEYWVAVVKPGRILYEMSGVAENIARRAISI 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+FI
Sbjct: 121 AASKMPIRTQFI 132


>gi|139388947|ref|YP_001123674.1| ribosomal protein L16 [Lepidium virginicum]
 gi|215275572|sp|A4QLE3|RK16_LEPVR RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|134286877|dbj|BAF50498.1| ribosomal protein L16 [Lepidium virginicum]
          Length = 135

 Score =  189 bits (481), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 66/132 (50%), Positives = 96/132 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+RICFG +AL+  E   I S +IEA RRA+SR ++R
Sbjct: 1   MLSPKRTRFRKQHRGRLKGISSRGNRICFGRYALQTLEPAWITSRQIEAGRRAMSRNVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +P E RMG GKG+ E WV  VKPG+IL+E+ GV E +AR+A  +
Sbjct: 61  GGKIWVRIFPDKPVTVRPAETRMGSGKGSPEYWVAVVKPGKILYEMGGVPENIARKAISI 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+FI
Sbjct: 121 AASKMPIKTQFI 132


>gi|294790418|ref|ZP_06755576.1| ribosomal protein L16 [Scardovia inopinata F0304]
 gi|294458315|gb|EFG26668.1| ribosomal protein L16 [Scardovia inopinata F0304]
          Length = 139

 Score =  189 bits (481), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 64/135 (47%), Positives = 87/135 (64%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY KQ + + +G++KGG+ I FG+F ++A     I + +IEAAR A++R +KR
Sbjct: 1   MLIPKRVKYRKQQRPKRRGMSKGGNEINFGDFGIQALAPAYITNRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPD P+T  P   RMG GKG  E W+  V PGR++FEI GVSE+VAR A R 
Sbjct: 61  GGRVWITIFPDRPLTKHPLGSRMGSGKGAPEFWIANVHPGRVMFEISGVSEDVAREALRR 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  + I R 
Sbjct: 121 AIDKLPMKCRIIARE 135


>gi|255264159|ref|ZP_05343501.1| ribosomal protein L16 [Thalassiobium sp. R2A62]
 gi|255106494|gb|EET49168.1| ribosomal protein L16 [Thalassiobium sp. R2A62]
          Length = 137

 Score =  189 bits (481), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 82/135 (60%), Positives = 102/135 (75%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGRIKG AKGGS + FG + LKA E  R+ + +IE+ARRA++R MKR
Sbjct: 1   MLQPKRTKHRKIHKGRIKGQAKGGSDLNFGTYGLKAIEPERVTARQIESARRAMTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPD PVT+KP EVRMGKGKG+V+ W  +VKPGR++FEIDGV+E +AR A RL
Sbjct: 61  QGRVWIRIFPDTPVTSKPVEVRMGKGKGSVDFWAAKVKPGRVMFEIDGVAEPIAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL V T+ I R 
Sbjct: 121 AAMKLPVKTRTIVRE 135


>gi|254492313|ref|ZP_05105486.1| ribosomal protein L16 [Methylophaga thiooxidans DMS010]
 gi|224462485|gb|EEF78761.1| ribosomal protein L16 [Methylophaga thiooxydans DMS010]
          Length = 137

 Score =  189 bits (481), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 76/136 (55%), Positives = 104/136 (76%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQ K R +G+A  G+++ FG + LK+ E  RI + +IEAARRA++R +KR
Sbjct: 1   MLQPKRTKFRKQQKLRNRGLAHRGAKVSFGEYGLKSLERGRITARQIEAARRAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD P+++KP EVR GKGKGNVE WV  V+PGR+L+E++GV+E+VAR AFRL
Sbjct: 61  GGKIWIRVFPDKPISSKPLEVRQGKGKGNVEYWVANVQPGRMLYEMEGVAEDVAREAFRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL V T F+ R +
Sbjct: 121 AAAKLPVKTTFVTRAI 136


>gi|119368536|ref|YP_913224.1| ribosomal protein L16 [Gossypium barbadense]
 gi|125987538|sp|A0ZZ72|RK16_GOSBA RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|119224898|dbj|BAF41284.1| Ribosomal protein L16 [Gossypium barbadense]
          Length = 135

 Score =  189 bits (481), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 68/132 (51%), Positives = 99/132 (75%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+RICFG +AL+A E   I S +IEA RRA++R ++R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGISYRGNRICFGRYALQALEPAWITSRQIEAGRRAMTRNVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +PTE RMG GKG+ E WV  VKPGRIL+E+ GV+E +AR+A  +
Sbjct: 61  GGKIWVRIFPDKPVTVRPTETRMGSGKGSPEYWVAVVKPGRILYEMSGVAENIARKAISI 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+FI
Sbjct: 121 VASKMPIKTQFI 132


>gi|119468273|ref|ZP_01611399.1| 50S ribosomal protein L16 [Alteromonadales bacterium TW-7]
 gi|119448266|gb|EAW29530.1| 50S ribosomal protein L16 [Alteromonadales bacterium TW-7]
 gi|332038830|gb|EGI75272.1| 50S ribosomal protein L16 [Pseudoalteromonas haloplanktis ANT/505]
          Length = 137

 Score =  189 bits (480), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 74/136 (54%), Positives = 101/136 (74%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGR +G+A+ G+++ FG F LKA    R+ + +IEAARRA++R +KR
Sbjct: 1   MLQPKRTKFRKMHKGRNRGLAQNGNKVSFGTFGLKATGRGRMTARQIEAARRAMTRHVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD P+T KP EVRMGKGKG+VE WV  ++PG++L+E++GVSEE+AR AF L
Sbjct: 61  QGKIWIRVFPDKPITEKPLEVRMGKGKGSVEYWVAEIQPGKVLYEMEGVSEELAREAFDL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            A KL   T F+ R V
Sbjct: 121 AARKLPFKTTFVTRTV 136


>gi|197294148|ref|YP_002149769.1| ribosomal protein L16 [Cicer arietinum]
 gi|215275554|sp|B5LMR0|RK16_CICAR RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|197089836|gb|ACH41106.1| ribosomal protein L16 [Cicer arietinum]
          Length = 139

 Score =  189 bits (480), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 69/132 (52%), Positives = 98/132 (74%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG A  G++ICFG +AL+A E   I S +IEA RRA+SR ++R
Sbjct: 1   MLSPKKTRFRKQHRGRMKGKACRGNKICFGKYALQALEPAWITSRQIEAGRRAMSRNVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVT +PTE RMG GKG+ E WV  +KPG+IL+E+ GV+E +AR+A  L
Sbjct: 61  GGQIWIRIFPDKPVTVRPTETRMGSGKGSPEYWVAVIKPGKILYEMGGVAENIARKAISL 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+FI
Sbjct: 121 AASKMPIRTQFI 132


>gi|323136093|ref|ZP_08071176.1| ribosomal protein L16 [Methylocystis sp. ATCC 49242]
 gi|322399184|gb|EFY01703.1| ribosomal protein L16 [Methylocystis sp. ATCC 49242]
          Length = 137

 Score =  189 bits (480), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 85/137 (62%), Positives = 101/137 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ K FKGRI G AKGG  + FG F LKA E  RI + +IEAARRA++R MKR
Sbjct: 1   MLSPKRTKFRKAFKGRIHGAAKGGFSLNFGQFGLKALEPERITARQIEAARRAMTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AGRVWI +FPDVPV+ KPTEVRMGKGKG  E W  RV PGRI+FE+DGV   +AR A  L
Sbjct: 61  AGRVWIRIFPDVPVSKKPTEVRMGKGKGAPELWAVRVAPGRIMFEVDGVPAPLAREALTL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            AAKL + T+FI+R+ E
Sbjct: 121 AAAKLPIKTRFIERIAE 137


>gi|281423832|ref|ZP_06254745.1| ribosomal protein L16 [Prevotella oris F0302]
 gi|299141154|ref|ZP_07034291.1| ribosomal protein L16 [Prevotella oris C735]
 gi|317503973|ref|ZP_07961981.1| 50S ribosomal protein L16 [Prevotella salivae DSM 15606]
 gi|281402059|gb|EFB32890.1| ribosomal protein L16 [Prevotella oris F0302]
 gi|298577114|gb|EFI48983.1| ribosomal protein L16 [Prevotella oris C735]
 gi|315664999|gb|EFV04658.1| 50S ribosomal protein L16 [Prevotella salivae DSM 15606]
          Length = 142

 Score =  189 bits (480), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 71/135 (52%), Positives = 92/135 (68%), Gaps = 1/135 (0%)

Query: 2   LRQPKNTKYPKQFKGR-IKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMK 60
           + QPK  KY +   GR  KG A  G+++ FG+F +K  E   I S +IEAAR A++R M 
Sbjct: 1   MLQPKRVKYRRPQDGRGNKGNAHRGTQLAFGSFGIKTLEPKWINSRQIEAARVAVNRYMN 60

Query: 61  RAGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFR 120
           R G+VWI +FPD P+T KP +VRMGKGKG+   WV  V PGRILFE++GVS ++A+ A R
Sbjct: 61  RQGQVWIRIFPDKPITRKPADVRMGKGKGDPAGWVAPVTPGRILFEVEGVSFDIAKEALR 120

Query: 121 LGAAKLSVVTKFIQR 135
           L A KL V TKF+ R
Sbjct: 121 LAAQKLPVKTKFVVR 135


>gi|332042713|gb|EGI78913.1| ribosomal protein L16 [Lacinutrix algicola 5H-3-7-4]
          Length = 139

 Score =  189 bits (480), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 77/138 (55%), Positives = 96/138 (69%), Gaps = 1/138 (0%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQ KGR+KG A  G ++  G F +K+ ++N + S +IEAAR A +R MKR
Sbjct: 1   MLQPKRTKFRKQQKGRMKGNAGRGHQLSNGTFGIKSLDSNFLTSRQIEAARIAATRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T KP EVRMGKGKG VE W   VKPGR+LFEI GV  +VA+ A RL
Sbjct: 61  EGQLWIKIFPDKPITKKPLEVRMGKGKGAVEYWAAVVKPGRVLFEIGGVPLDVAKEALRL 120

Query: 122 GAAKLSVVTKF-IQRVVE 138
            A KL V TKF I R  E
Sbjct: 121 AAQKLPVKTKFLIARDYE 138


>gi|329770033|ref|ZP_08261428.1| 50S ribosomal protein L16 [Gemella sanguinis M325]
 gi|328837344|gb|EGF86974.1| 50S ribosomal protein L16 [Gemella sanguinis M325]
          Length = 141

 Score =  189 bits (480), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 73/135 (54%), Positives = 94/135 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +Q +   KG +KGG+ + FG + L+A  A R+ S +IEAAR A++R MKR
Sbjct: 1   MLMPKRVKYRRQHRQSTKGKSKGGNVVDFGQYGLQATTAARVTSRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP +P T KP EVRMG GKG VE WV  VKPGR++FE+ GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPHMPYTKKPLEVRMGSGKGAVEGWVAIVKPGRVMFEVAGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL V  KF++R 
Sbjct: 121 ASHKLPVKCKFVKRE 135


>gi|241888938|ref|ZP_04776242.1| ribosomal protein L16 [Gemella haemolysans ATCC 10379]
 gi|241864187|gb|EER68565.1| ribosomal protein L16 [Gemella haemolysans ATCC 10379]
          Length = 141

 Score =  189 bits (480), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 74/135 (54%), Positives = 94/135 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +Q +   KG +KGG+ + FG F L+A  A R+ S +IEAAR A++R MKR
Sbjct: 1   MLMPKRVKYRRQHRQSTKGKSKGGNVVDFGEFGLQATTAARVTSRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP +P T KP EVRMG GKG VE WV  VKPGR++FE+ GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPHMPYTKKPLEVRMGSGKGAVEGWVAIVKPGRVMFEVAGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL V  KF++R 
Sbjct: 121 ASHKLPVKCKFVKRE 135


>gi|7524927|ref|NP_045929.1| ribosomal protein L16 [Chlorella vulgaris]
 gi|3024548|sp|P56364|RK16_CHLVU RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|2224521|dbj|BAA58005.1| 50S ribosomal protein L16 [Chlorella vulgaris]
          Length = 134

 Score =  189 bits (480), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 67/134 (50%), Positives = 96/134 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY K  +GR++G A  G+ + FG++AL++ EA+ I S +IEAARRA++R ++R
Sbjct: 1   MLSPKRTKYRKHHRGRMRGKASRGNTVVFGDYALQSLEASWITSRQIEAARRAMTRQVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVT +P E RMG GKG  E WV  V+PG++L+E+ GV E VAR A RL
Sbjct: 61  GGQIWIRLFPDKPVTMRPAETRMGSGKGAPEFWVAVVRPGKVLYELKGVPESVARVALRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A+KL V T+ + +
Sbjct: 121 AASKLPVKTQILVK 134


>gi|290487906|gb|ADD30337.1| ribosomal protein L16 [Liquidambar styraciflua]
          Length = 135

 Score =  189 bits (480), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 67/132 (50%), Positives = 97/132 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+RICFG +AL+A E   I S +IEA RRA++R  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGISYRGNRICFGRYALQALEPAWITSRQIEAGRRAMTRNARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +P E RMG GKG+ E WV  VKPGRIL+E+ GV+E +AR+A  +
Sbjct: 61  GGKIWVRIFPDKPVTVRPAETRMGSGKGSPEYWVAVVKPGRILYEMGGVAENIARKAISI 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+FI
Sbjct: 121 AASKMPIRTQFI 132


>gi|290487892|gb|ADD30330.1| ribosomal protein L16 [Berberidopsis corallina]
          Length = 135

 Score =  189 bits (480), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 68/132 (51%), Positives = 98/132 (74%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+RICFG +AL+A E   I S +IEA RRA++R  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGISYRGNRICFGRYALQALEPAWITSRQIEAGRRAMTRNARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +PTE RMG GKG+ E WV  VKPGRIL+E+ GV+E +AR+A  +
Sbjct: 61  GGKIWVRIFPDKPVTVRPTETRMGSGKGSPEYWVAVVKPGRILYEMGGVAENIARKAISI 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+FI
Sbjct: 121 AASKMPIRTQFI 132


>gi|292492428|ref|YP_003527867.1| ribosomal protein L16 [Nitrosococcus halophilus Nc4]
 gi|291581023|gb|ADE15480.1| ribosomal protein L16 [Nitrosococcus halophilus Nc4]
          Length = 137

 Score =  189 bits (480), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 76/136 (55%), Positives = 100/136 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQ KGR +G +  G+++ FG + LKA    +I + +IEAARRA++R +KR
Sbjct: 1   MLQPKRTKFRKQQKGRNRGQSLRGNQVDFGEYGLKAIGRGKITARQIEAARRAMTRYVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T KP EVR GKGKGNVE W   V+PGR+L+E++GV EEVARRAF L
Sbjct: 61  GGKIWIRIFPDKPITQKPLEVRQGKGKGNVEYWAANVQPGRVLYEMEGVPEEVARRAFEL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL V T F+ R V
Sbjct: 121 AAAKLPVKTVFVTRAV 136


>gi|119960997|ref|YP_948650.1| 50S ribosomal protein L16 [Arthrobacter aurescens TC1]
 gi|166234544|sp|A1R8T8|RL16_ARTAT RecName: Full=50S ribosomal protein L16
 gi|119947856|gb|ABM06767.1| ribosomal protein L16 [Arthrobacter aurescens TC1]
          Length = 138

 Score =  189 bits (480), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 60/135 (44%), Positives = 88/135 (65%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  K+ KQ      G A GG+++ FG + ++A     + + +IE+AR A++R +KR
Sbjct: 1   MLIPRRVKHRKQHHPGRSGAATGGTKVSFGEYGIQALSPAYVTNRQIESARIAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI ++PD P+T KP E RMG GKG+ E WV  VKPGR+LFE+ GV+EEVAR A RL
Sbjct: 61  GGKVWINIYPDRPLTKKPAETRMGSGKGSPEWWVANVKPGRVLFELSGVNEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  + ++R 
Sbjct: 121 AIHKLPLKARIVRRE 135


>gi|206900349|ref|YP_002250708.1| ribosomal protein L16 [Dictyoglomus thermophilum H-6-12]
 gi|206739452|gb|ACI18510.1| ribosomal protein L16 [Dictyoglomus thermophilum H-6-12]
          Length = 139

 Score =  189 bits (480), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 67/135 (49%), Positives = 91/135 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY KQ +GR+KG A  G+R+ FG++ ++A     I S +IEA RR ++R   +
Sbjct: 1   MLMPKRVKYRKQHRGRMKGKASRGNRVVFGDYGIQALAPAWITSEQIEAVRRTLTRHAGK 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPD  VTA+P E RMG GKG+V+ WV  VKPG +LFEI GVS+EVA  A R+
Sbjct: 61  NGRVWIRIFPDKSVTARPAESRMGGGKGDVKGWVAVVKPGTVLFEIGGVSKEVAMEAIRI 120

Query: 122 GAAKLSVVTKFIQRV 136
             +KL + T+F+ R 
Sbjct: 121 AGSKLPIKTRFVTRE 135


>gi|167755919|ref|ZP_02428046.1| hypothetical protein CLORAM_01439 [Clostridium ramosum DSM 1402]
 gi|237733235|ref|ZP_04563716.1| 50S ribosomal protein L16 [Mollicutes bacterium D7]
 gi|167703911|gb|EDS18490.1| hypothetical protein CLORAM_01439 [Clostridium ramosum DSM 1402]
 gi|229383616|gb|EEO33707.1| 50S ribosomal protein L16 [Coprobacillus sp. D7]
          Length = 136

 Score =  189 bits (480), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 66/134 (49%), Positives = 89/134 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY +  + + +G AKGG+ + FG + L+A E   I S +IEAAR AI+R + R
Sbjct: 1   MLMPKRTKYRRPHRVKYEGKAKGGTEVSFGEYGLQATEGAWITSRQIEAARIAINRRLNR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP +  T KP EVRMG GKG+ E+WV  VK GR+LFE+ GV EE+AR A RL
Sbjct: 61  GGQVWIRIFPHLAKTKKPLEVRMGSGKGSPEEWVAVVKTGRVLFEVAGVDEELAREALRL 120

Query: 122 GAAKLSVVTKFIQR 135
            + KL +  K I +
Sbjct: 121 ASHKLPIKCKIIGK 134


>gi|251772497|gb|EES53063.1| ribosomal protein L16 [Leptospirillum ferrodiazotrophum]
          Length = 138

 Score =  189 bits (480), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 68/135 (50%), Positives = 91/135 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ K  KG +KG A  GS + FG++ LKA E + + S +IEA R AI+R +KR
Sbjct: 1   MLSPKKVKHRKMMKGNLKGKAYRGSELSFGDYGLKAIEPHWLTSRQIEAGRIAITRFVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI VFPD P+T KP E RMG GKGN E WV  +KPGRI++E++GV+ EVA  A RL
Sbjct: 61  GGKVWIRVFPDKPITRKPAETRMGSGKGNPEFWVAVIKPGRIIYEMEGVTPEVAEEALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + K+   TK ++R 
Sbjct: 121 ASYKMPFATKIVKRE 135


>gi|242624275|ref|YP_003002193.1| 50S ribosomal protein L16 [Aureoumbra lagunensis]
 gi|239997383|gb|ACS36905.1| 50S ribosomal protein L16 [Aureoumbra lagunensis]
          Length = 137

 Score =  189 bits (480), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 69/137 (50%), Positives = 90/137 (65%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ K  +GR+KG A   + I FG++AL+ QE   I S +IEA RR I+R  KR
Sbjct: 1   MLSPKRTKFRKTQRGRMKGRASRNNTITFGDYALQVQEPGWITSRQIEATRRTITRYTKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD  +TA+  E RMG GKG  E WV  VKPG I+FE+ GV  EVAR+A  L
Sbjct: 61  GGKLWIKIFPDKSITARAAESRMGSGKGAPEYWVAVVKPGNIIFELTGVKLEVARQAMSL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            + KL + TKFI + VE
Sbjct: 121 ASYKLPLKTKFISKSVE 137


>gi|300779838|ref|ZP_07089694.1| 50S ribosomal protein L16 [Corynebacterium genitalium ATCC 33030]
 gi|300533948|gb|EFK55007.1| 50S ribosomal protein L16 [Corynebacterium genitalium ATCC 33030]
          Length = 138

 Score =  189 bits (480), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 68/135 (50%), Positives = 90/135 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +Q +    GV+KGG+ I FG++ L+A E   I + +IE+AR AI+R +KR
Sbjct: 1   MLIPKRVKYRRQHRPNRSGVSKGGNTINFGDYGLQALEPAYITNRQIESARIAINRHVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T KP  VRMG GKG VEKWV  VKPGRILFE+   +E+VA+ A R 
Sbjct: 61  GGKVWINIFPDRPLTQKPLGVRMGSGKGPVEKWVANVKPGRILFEMSYPNEQVAQEALRR 120

Query: 122 GAAKLSVVTKFIQRV 136
             AKL   T+ I + 
Sbjct: 121 AGAKLPCKTRVISKE 135


>gi|315225408|ref|ZP_07867222.1| 50S ribosomal protein L16 [Capnocytophaga ochracea F0287]
 gi|314944681|gb|EFS96716.1| 50S ribosomal protein L16 [Capnocytophaga ochracea F0287]
          Length = 139

 Score =  189 bits (480), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 73/133 (54%), Positives = 94/133 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TKY KQ KGR+KGV+  G+ +  G F +K+ ++  I S +IE+AR A +R MKR
Sbjct: 1   MLQPKRTKYRKQQKGRMKGVSHRGALLSNGTFGIKSLDSAFITSRQIESARVAATRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T KP EVRMGKGKG VE W   VKPGRI+FE+ GV  +VA+ A RL
Sbjct: 61  EGQLWIKIFPDKPITKKPLEVRMGKGKGAVEYWAAVVKPGRIMFEVGGVPLDVAKEALRL 120

Query: 122 GAAKLSVVTKFIQ 134
            A KL V TKF+ 
Sbjct: 121 AAQKLPVKTKFVV 133


>gi|183601951|ref|ZP_02963320.1| 50S ribosomal protein L16 [Bifidobacterium animalis subsp. lactis
           HN019]
 gi|219682864|ref|YP_002469247.1| 50S ribosomal protein L16 [Bifidobacterium animalis subsp. lactis
           AD011]
 gi|241190440|ref|YP_002967834.1| 50S ribosomal protein L16 [Bifidobacterium animalis subsp. lactis
           Bl-04]
 gi|241195846|ref|YP_002969401.1| 50S ribosomal protein L16 [Bifidobacterium animalis subsp. lactis
           DSM 10140]
 gi|254799180|sp|B8DW20|RL16_BIFA0 RecName: Full=50S ribosomal protein L16
 gi|183218836|gb|EDT89478.1| 50S ribosomal protein L16 [Bifidobacterium animalis subsp. lactis
           HN019]
 gi|219620514|gb|ACL28671.1| ribosomal protein L16 [Bifidobacterium animalis subsp. lactis
           AD011]
 gi|240248832|gb|ACS45772.1| 50S ribosomal protein L16 [Bifidobacterium animalis subsp. lactis
           Bl-04]
 gi|240250400|gb|ACS47339.1| 50S ribosomal protein L16 [Bifidobacterium animalis subsp. lactis
           DSM 10140]
 gi|289178164|gb|ADC85410.1| LSU ribosomal protein L16P [Bifidobacterium animalis subsp. lactis
           BB-12]
 gi|295793427|gb|ADG32962.1| 50S ribosomal protein L16 [Bifidobacterium animalis subsp. lactis
           V9]
          Length = 139

 Score =  189 bits (480), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 64/135 (47%), Positives = 87/135 (64%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY KQ +    G++KGG+ I FG+FA++A     + + +IEAAR A++R +KR
Sbjct: 1   MLIPKRTKYRKQHRPDRHGMSKGGNEINFGDFAIQALAPAYVTNRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T  P   RMG GKG  E W+  V PGR++FEI GVSE+VAR A R 
Sbjct: 61  GGKVWITIFPDRPLTKHPLGARMGSGKGTPEFWIANVHPGRVMFEIGGVSEDVAREALRR 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  + I R 
Sbjct: 121 AIDKLPMKCRVIARE 135


>gi|296126872|ref|YP_003634124.1| ribosomal protein L16 [Brachyspira murdochii DSM 12563]
 gi|296018688|gb|ADG71925.1| ribosomal protein L16 [Brachyspira murdochii DSM 12563]
          Length = 137

 Score =  189 bits (480), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 75/136 (55%), Positives = 94/136 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QP   KY K  +GR+KG +K GS + FG++ L A E   +   +IEAAR AISR +KR
Sbjct: 1   MLQPSRMKYRKHHRGRMKGKSKRGSNLTFGDYGLMALEPVWLTDRQIEAARIAISRHVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD P T KP E RMGKGKGNVE WV  VKPG+++FEI GV EE+A+ AFRL
Sbjct: 61  VGKMWIKVFPDKPYTKKPAETRMGKGKGNVEYWVAVVKPGKVIFEISGVPEELAQSAFRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
              KL + TKFI+R  
Sbjct: 121 AGFKLPIKTKFIKREA 136


>gi|119502931|ref|ZP_01625016.1| 50S ribosomal protein L16 [marine gamma proteobacterium HTCC2080]
 gi|119461277|gb|EAW42367.1| 50S ribosomal protein L16 [marine gamma proteobacterium HTCC2080]
          Length = 137

 Score =  189 bits (480), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 78/136 (57%), Positives = 106/136 (77%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGR +G+A+ GS++ FG +ALKA    RI + +IEAARRA++R +KR
Sbjct: 1   MLQPKRTKFRKMHKGRNRGLAERGSKVSFGEYALKATGRGRITARQIEAARRAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD P+T KP EVR GKGKGNVE WV +++PGR+L+E++GVSEE+AR AF+L
Sbjct: 61  GGKIWIRVFPDKPITGKPLEVRQGKGKGNVEYWVAQIQPGRVLYEVEGVSEELAREAFQL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + T F++R V
Sbjct: 121 AAAKLPIQTTFVKRSV 136


>gi|68164841|ref|YP_247637.1| ribosomal protein L16 [Cucumis sativus]
 gi|75317316|sp|Q4VZN1|RK16_CUCSA RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|67511436|emb|CAJ00796.1| ribosomal protein L16 [Cucumis sativus]
 gi|74027137|gb|AAZ94687.1| ribosomal protein L16 [Cucumis sativus]
          Length = 135

 Score =  189 bits (480), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 65/133 (48%), Positives = 96/133 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ K  +GR+KG++  G+ ICFG +A++A E   I S +IEA RRA++R  +R
Sbjct: 1   MLSPKRTRFRKHHRGRMKGISYRGNSICFGRYAIQALEPAWITSRQIEAGRRAMTRNARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +PTE RMG GKG+ E WV  VKPGRIL+E+ GV+E +AR+A  +
Sbjct: 61  GGKIWVRIFPDKPVTLRPTETRMGSGKGSPEYWVAVVKPGRILYEMSGVAENIARKAISI 120

Query: 122 GAAKLSVVTKFIQ 134
            A+K+ + T+FI 
Sbjct: 121 AASKMPIRTQFIT 133


>gi|213962915|ref|ZP_03391175.1| ribosomal protein L16 [Capnocytophaga sputigena Capno]
 gi|256819989|ref|YP_003141268.1| 50S ribosomal protein L16 [Capnocytophaga ochracea DSM 7271]
 gi|213954572|gb|EEB65894.1| ribosomal protein L16 [Capnocytophaga sputigena Capno]
 gi|256581572|gb|ACU92707.1| ribosomal protein L16 [Capnocytophaga ochracea DSM 7271]
          Length = 139

 Score =  189 bits (480), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 74/133 (55%), Positives = 94/133 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TKY KQ KGR+KGVA  G+ +  G F +K+ ++  I S +IE+AR A +R MKR
Sbjct: 1   MLQPKRTKYRKQQKGRMKGVAHRGALLSNGTFGIKSLDSAFITSRQIESARVAATRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T KP EVRMGKGKG VE W   VKPGRI+FE+ GV  +VA+ A RL
Sbjct: 61  EGQLWIKIFPDKPITKKPLEVRMGKGKGAVEYWAAVVKPGRIMFEVGGVPLDVAKEALRL 120

Query: 122 GAAKLSVVTKFIQ 134
            A KL V TKF+ 
Sbjct: 121 AAQKLPVKTKFVV 133


>gi|162456239|ref|YP_001618606.1| 50S ribosomal protein L16 [Sorangium cellulosum 'So ce 56']
 gi|189041485|sp|A9FGJ3|RL16_SORC5 RecName: Full=50S ribosomal protein L16
 gi|161166821|emb|CAN98126.1| 50S ribosomal protein L16 [Sorangium cellulosum 'So ce 56']
          Length = 137

 Score =  189 bits (480), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 72/134 (53%), Positives = 94/134 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ K  KG  +G+A  GS + FG+FAL+  E  R+ S +IEAAR AI R +KR
Sbjct: 1   MLSPKRTKFRKMQKGNNRGLAMTGSDVSFGDFALQCVEPARVTSRQIEAARMAIQRHVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AG++WI +FPD PVT KP EVRMG GKG  E+W   V+PGR+++EI GVSEE A+ AFRL
Sbjct: 61  AGKLWIRIFPDRPVTKKPLEVRMGGGKGAPEEWCALVQPGRVMYEISGVSEETAKEAFRL 120

Query: 122 GAAKLSVVTKFIQR 135
            + KL +  KF+ R
Sbjct: 121 ASHKLPMQCKFLAR 134


>gi|229496320|ref|ZP_04390040.1| ribosomal protein L16 [Porphyromonas endodontalis ATCC 35406]
 gi|229316898|gb|EEN82811.1| ribosomal protein L16 [Porphyromonas endodontalis ATCC 35406]
          Length = 144

 Score =  189 bits (480), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 71/134 (52%), Positives = 101/134 (75%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ +Q KGR+KG A+ G+++ FG+F +K+ +   I  ++IEAAR A++R M+R
Sbjct: 1   MLQPKKTKFRRQQKGRMKGNAQRGNQLAFGSFGIKSLQTKWITGAQIEAARIAVTRYMQR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VW+ +FPD P+T+KP EVRMGKGKGN E +V  V PGR++FE++GVS E+A+ A RL
Sbjct: 61  QGQVWVRIFPDKPITSKPAEVRMGKGKGNPEGFVAPVTPGRMIFEVEGVSYEIAKEALRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL V TKF+ R
Sbjct: 121 AAQKLPVTTKFVVR 134


>gi|299820962|ref|ZP_07052851.1| 50S ribosomal protein L16 [Listeria grayi DSM 20601]
 gi|299817983|gb|EFI85218.1| 50S ribosomal protein L16 [Listeria grayi DSM 20601]
          Length = 145

 Score =  189 bits (480), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 70/135 (51%), Positives = 94/135 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY ++F+G ++G AKGG+ + FG + L+A +A+ I + +IEAAR A++R MKR
Sbjct: 1   MLVPKRVKYRREFRGNMRGRAKGGTEVAFGEYGLQAVDASWITNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP    T+KP  VRMGKGKG  E WV  VK G+I+FEI GV E+VAR A RL
Sbjct: 61  GGKVWIKIFPHKSYTSKPIGVRMGKGKGAPEGWVSPVKRGKIMFEIAGVPEDVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL V TK ++R 
Sbjct: 121 AAHKLPVKTKIVKRE 135


>gi|297623281|ref|YP_003704715.1| 50S ribosomal protein L16 [Truepera radiovictrix DSM 17093]
 gi|297164461|gb|ADI14172.1| ribosomal protein L16 [Truepera radiovictrix DSM 17093]
          Length = 141

 Score =  189 bits (480), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 72/136 (52%), Positives = 92/136 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY KQ +GR+KG  KGG  + FG++ L A E   I S++IEA R  +SR  +R
Sbjct: 1   MLLPKRVKYRKQMRGRMKGDTKGGDYVAFGDYGLVALEPAWIKSNQIEACRITMSRFFRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+++I VFPD PVT KP E RMGKGKG VE WV  VKPGR++FE+  V+EE AR AFRL
Sbjct: 61  GGKIYIRVFPDKPVTKKPAETRMGKGKGAVEYWVAVVKPGRVIFEVANVTEEQAREAFRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
              KL + TK ++R V
Sbjct: 121 AGHKLPIKTKMVKREV 136


>gi|148544689|ref|YP_001272059.1| 50S ribosomal protein L16 [Lactobacillus reuteri DSM 20016]
 gi|184154042|ref|YP_001842383.1| 50S ribosomal protein L16 [Lactobacillus reuteri JCM 1112]
 gi|194466946|ref|ZP_03072933.1| ribosomal protein L16 [Lactobacillus reuteri 100-23]
 gi|227363812|ref|ZP_03847919.1| 50S ribosomal protein L16 [Lactobacillus reuteri MM2-3]
 gi|227543616|ref|ZP_03973665.1| 50S ribosomal protein L16 [Lactobacillus reuteri CF48-3A]
 gi|300909355|ref|ZP_07126816.1| 50S ribosomal protein L16 [Lactobacillus reuteri SD2112]
 gi|312870489|ref|ZP_07730608.1| ribosomal protein L16 [Lactobacillus oris PB013-T2-3]
 gi|325683023|ref|ZP_08162539.1| 50S ribosomal protein L16 [Lactobacillus reuteri MM4-1A]
 gi|166983715|sp|A5VLJ8|RL16_LACRD RecName: Full=50S ribosomal protein L16
 gi|226710457|sp|B2G8X1|RL16_LACRJ RecName: Full=50S ribosomal protein L16
 gi|148531723|gb|ABQ83722.1| LSU ribosomal protein L16P [Lactobacillus reuteri DSM 20016]
 gi|183225386|dbj|BAG25903.1| 50S ribosomal protein L16 [Lactobacillus reuteri JCM 1112]
 gi|194453982|gb|EDX42879.1| ribosomal protein L16 [Lactobacillus reuteri 100-23]
 gi|227071169|gb|EEI09485.1| 50S ribosomal protein L16 [Lactobacillus reuteri MM2-3]
 gi|227186456|gb|EEI66527.1| 50S ribosomal protein L16 [Lactobacillus reuteri CF48-3A]
 gi|300893220|gb|EFK86579.1| 50S ribosomal protein L16 [Lactobacillus reuteri SD2112]
 gi|311093951|gb|EFQ52276.1| ribosomal protein L16 [Lactobacillus oris PB013-T2-3]
 gi|324977373|gb|EGC14324.1| 50S ribosomal protein L16 [Lactobacillus reuteri MM4-1A]
          Length = 144

 Score =  189 bits (480), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 67/135 (49%), Positives = 90/135 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ K  +G ++G AKGG  + FG F L+A +++ I + +IEAAR A++R MKR
Sbjct: 1   MLVPKRVKHRKVQRGHMRGEAKGGKTVTFGEFGLQALDSHWISNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP +  T+K   VRMG GKG  E WV  VK G+++FE+ GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPQLSYTSKGVGVRMGNGKGAPEGWVAPVKRGKVMFEVGGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL V TK +QR 
Sbjct: 121 AGHKLPVRTKIVQRE 135


>gi|221194346|ref|ZP_03567403.1| ribosomal protein L16 [Atopobium rimae ATCC 49626]
 gi|221185250|gb|EEE17640.1| ribosomal protein L16 [Atopobium rimae ATCC 49626]
          Length = 141

 Score =  189 bits (480), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 76/134 (56%), Positives = 98/134 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK   + K  +G +KG AKG +R+ FG++ ++A+EA+ I + +IEAAR AI+R MKR
Sbjct: 1   MLAPKRVLHRKVQRGSMKGQAKGNTRLHFGSWGIRAEEAHWITNRQIEAARIAITREMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PV+ KP E RMGKGKGN E+WV  VKPGRI+FEIDGVSEEVAR A RL
Sbjct: 61  GGKVWITIFPDKPVSKKPAETRMGKGKGNPEEWVAVVKPGRIMFEIDGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL + TK + R
Sbjct: 121 AQHKLPIKTKIVTR 134


>gi|88854675|ref|ZP_01129341.1| 50S ribosomal protein L16 [marine actinobacterium PHSC20C1]
 gi|88815836|gb|EAR25692.1| 50S ribosomal protein L16 [marine actinobacterium PHSC20C1]
          Length = 139

 Score =  189 bits (480), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 59/135 (43%), Positives = 82/135 (60%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  KY KQ      G A GG+ + FG + ++A     + + +IEAAR A++R +KR
Sbjct: 1   MLIPRKVKYRKQHHPSRSGHATGGTTVSFGEYGIQALTPAYVTNRQIEAARIAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI ++PD P+T KP E RMG GKG+ E WV  VKPGR+LFE+ GV E  AR A   
Sbjct: 61  GGKVWINIYPDRPLTKKPAETRMGSGKGSPEWWVANVKPGRVLFELSGVDETTAREALTR 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  + I+R 
Sbjct: 121 AIHKLPLKARIIKRE 135


>gi|323483294|ref|ZP_08088684.1| 50S ribosomal protein L16 [Clostridium symbiosum WAL-14163]
 gi|323403392|gb|EGA95700.1| 50S ribosomal protein L16 [Clostridium symbiosum WAL-14163]
          Length = 143

 Score =  189 bits (480), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 71/132 (53%), Positives = 86/132 (65%)

Query: 4   QPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKRAG 63
            PK  K  KQF+G + G A  G+ IC+G F L + E   I S++IEAAR A++R +KR G
Sbjct: 1   MPKRVKRRKQFRGSMAGKATRGNVICYGEFGLVSTEPCWIRSNQIEAARVAMTRYIKRGG 60

Query: 64  RVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRLGA 123
           +VWI +FPD PVTAKP E RMG GKG +E WV  VKPGR+LFEI GV EE AR A RL  
Sbjct: 61  KVWIKIFPDKPVTAKPAETRMGSGKGALEYWVAVVKPGRVLFEIAGVPEETAREALRLAM 120

Query: 124 AKLSVVTKFIQR 135
            KL    K   +
Sbjct: 121 HKLPCKCKIASK 132


>gi|289066806|ref|YP_003434324.1| 50S ribosomal protein L16 [Vigna radiata]
 gi|259019993|gb|ACV90191.1| 50S ribosomal protein L16 [Vigna radiata]
          Length = 135

 Score =  189 bits (480), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 65/132 (49%), Positives = 96/132 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+ T++ KQ +GR+KG++  G+ ICFG +AL+A E   I S +IEA RRA+SR ++R
Sbjct: 1   MLSPQRTRFRKQHRGRMKGISYRGNHICFGRYALQALEPAWITSRQIEAGRRAMSRNVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +PTE RMG GKG  E WV  VKPG+IL+E+ GV E +AR+A  +
Sbjct: 61  GGQIWVRIFPDKPVTVRPTETRMGSGKGFPEYWVAVVKPGKILYEMGGVPENIARKAISI 120

Query: 122 GAAKLSVVTKFI 133
            ++K+ + T+FI
Sbjct: 121 ASSKMPIRTQFI 132


>gi|290487888|gb|ADD30328.1| ribosomal protein L16 [Rhododendron simsii]
          Length = 135

 Score =  189 bits (480), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 65/132 (49%), Positives = 96/132 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+ ICFG +AL+A E   I S +IEA RRA++R  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGISYRGNHICFGKYALQALEPAWITSRQIEAGRRAMTRNARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT + TE RMG GKG+ E WV  VKPGRIL+E+ G++E +AR+A  +
Sbjct: 61  GGKIWVRIFPDKPVTIRTTETRMGSGKGSPEYWVAVVKPGRILYEMGGITENIARKAILI 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+FI
Sbjct: 121 AASKMPIRTQFI 132


>gi|309322066|ref|YP_003933884.1| ribosomal protein L16 [Erodium texanum]
 gi|197131814|gb|ACH47425.1| ribosomal protein L16 [Erodium texanum]
 gi|300069159|gb|ADJ66281.1| ribosomal protein L16 [Erodium texanum]
          Length = 137

 Score =  189 bits (480), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 65/137 (47%), Positives = 95/137 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ K+ +GR++GVA  GS I FG +AL+A E   + S +IEA RRA++R ++R
Sbjct: 1   MLSPKRTKFRKEHRGRMRGVASRGSCISFGRYALQALEPTWLTSRQIEAGRRAMTRNVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +  E RMG GKG+ E WV  VKPGRIL+E+ GV+E +AR+A  +
Sbjct: 61  GGKIWVRIFPDKPVTVRSAETRMGSGKGSPEYWVAVVKPGRILYEMGGVAENIARKAISI 120

Query: 122 GAAKLSVVTKFIQRVVE 138
             +K+ + T+FI    E
Sbjct: 121 AGSKMPIRTQFIISDSE 137


>gi|326803040|ref|YP_004320858.1| ribosomal protein L16 [Aerococcus urinae ACS-120-V-Col10a]
 gi|326651430|gb|AEA01613.1| ribosomal protein L16 [Aerococcus urinae ACS-120-V-Col10a]
          Length = 142

 Score =  189 bits (480), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 68/136 (50%), Positives = 92/136 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ ++F+G+++G AKGG  I +G + L+A ++  I + +IEAAR A++R MKR
Sbjct: 1   MLVPKRVKHRREFRGKMRGEAKGGKEIAYGEYGLQALDSKWITNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP  P +AK   VRMG GKG  E WV  VK G+ILFEI GV EEVAR A RL
Sbjct: 61  GGKVWIKIFPHKPYSAKAIGVRMGSGKGAPEGWVAPVKRGKILFEIAGVPEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            A KL +  K ++R V
Sbjct: 121 AAHKLPIRCKIVKRDV 136


>gi|116334262|ref|YP_795789.1| 50S ribosomal protein L16 [Lactobacillus brevis ATCC 367]
 gi|122269056|sp|Q03PW4|RL16_LACBA RecName: Full=50S ribosomal protein L16
 gi|116099609|gb|ABJ64758.1| LSU ribosomal protein L16P [Lactobacillus brevis ATCC 367]
          Length = 144

 Score =  189 bits (480), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 66/135 (48%), Positives = 91/135 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ +  +G+++G AKGG  + FG++ L+A +++ I + +IEAAR AI+R MKR
Sbjct: 1   MLVPKRVKFRRVHRGKLRGEAKGGKSVAFGDYGLQALDSHWISNRQIEAARVAITRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP    TAK   VRMG GKG  + WV  VK G+++FE+ GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPHKSYTAKGVGVRMGNGKGTPDGWVAPVKRGKVMFEVGGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL V TK + R 
Sbjct: 121 AAMKLPVRTKVLSRE 135


>gi|323149120|ref|YP_004222684.1| ribosomal protein L16 [Anthriscus cerefolium]
 gi|289645613|gb|ADD13676.1| ribosomal protein L16 [Anthriscus cerefolium]
          Length = 135

 Score =  188 bits (479), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 65/132 (49%), Positives = 96/132 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G++I FG +AL+A E   I S +IEA RRA++R  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGMSYRGNQISFGKYALQALEPAWITSRQIEAGRRAMTRNARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +P E RMG GKG+ E WV  VKPGRIL+E+ GV+E +ARRA  +
Sbjct: 61  GGKIWVRIFPDKPVTVRPAETRMGSGKGSPEYWVAVVKPGRILYEMGGVTENIARRAISI 120

Query: 122 GAAKLSVVTKFI 133
            ++K+ + T+FI
Sbjct: 121 ASSKMPIRTQFI 132


>gi|227509938|ref|ZP_03939987.1| 50S ribosomal protein L16 [Lactobacillus brevis subsp. gravesensis
           ATCC 27305]
 gi|227512871|ref|ZP_03942920.1| 50S ribosomal protein L16 [Lactobacillus buchneri ATCC 11577]
 gi|227522999|ref|ZP_03953048.1| 50S ribosomal protein L16 [Lactobacillus hilgardii ATCC 8290]
 gi|227083871|gb|EEI19183.1| 50S ribosomal protein L16 [Lactobacillus buchneri ATCC 11577]
 gi|227089817|gb|EEI25129.1| 50S ribosomal protein L16 [Lactobacillus hilgardii ATCC 8290]
 gi|227190544|gb|EEI70611.1| 50S ribosomal protein L16 [Lactobacillus brevis subsp. gravesensis
           ATCC 27305]
          Length = 144

 Score =  188 bits (479), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 64/135 (47%), Positives = 90/135 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ ++ +G+++G AKGG+ + FG++ L++ +++ I + +IEA R A++R MKR
Sbjct: 1   MLVPKRVKHRREHRGKLRGSAKGGTTVTFGDYGLQSLDSHWITNRQIEACRVAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FP    T K   VRMG GKG    WV  VK G+ILFEI GVSEEVA  A RL
Sbjct: 61  GGRVWIKIFPHKSYTEKGVGVRMGNGKGTPAGWVSPVKRGKILFEIGGVSEEVATEALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL V TK ++R 
Sbjct: 121 ASNKLPVRTKIVKRE 135


>gi|288942065|ref|YP_003444305.1| 50S ribosomal protein L16 [Allochromatium vinosum DSM 180]
 gi|288897437|gb|ADC63273.1| ribosomal protein L16 [Allochromatium vinosum DSM 180]
          Length = 137

 Score =  188 bits (479), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 81/136 (59%), Positives = 105/136 (77%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQ KGR +G+A+ G+R+ FG F LKA E  R+ + +IEAARRAISR +KR
Sbjct: 1   MLQPKRTKFRKQHKGRNRGLAQSGNRVSFGEFGLKATERGRLTARQIEAARRAISRSVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD P++ KP EVRMGKGKGNVE WV  ++PG +L+EI+GVSEEVAR AF+L
Sbjct: 61  GGKIWIRVFPDKPISKKPLEVRMGKGKGNVEYWVALIQPGSMLYEIEGVSEEVAREAFKL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            +AKL V T F +R +
Sbjct: 121 ASAKLPVQTTFEKRTI 136


>gi|13518371|ref|NP_084730.1| ribosomal protein L16 [Oenothera elata subsp. hookeri]
 gi|169142747|ref|YP_001687174.1| ribosomal protein L16 [Oenothera argillicola]
 gi|169142897|ref|YP_001687320.1| ribosomal protein L16 [Oenothera glazioviana]
 gi|169142982|ref|YP_001687404.1| ribosomal protein L16 [Oenothera biennis]
 gi|169143068|ref|YP_001687488.1| ribosomal protein L16 [Oenothera parviflora]
 gi|75274517|sp|Q9MTI8|RK16_OENEH RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|215275581|sp|B0Z4R3|RK16_OENAR RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|215275582|sp|B0Z4Z7|RK16_OENBI RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|215275583|sp|B0Z581|RK16_OENGL RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|215275584|sp|B0Z5G5|RK16_OENPA RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|6723787|emb|CAB67197.1| ribosomal protein L16 [Oenothera elata subsp. hookeri]
 gi|159792985|gb|ABW98741.1| ribosomal protein L16 [Oenothera argillicola]
 gi|159793155|gb|ABW98909.1| ribosomal protein L16 [Oenothera biennis]
 gi|159895509|gb|ABX10074.1| ribosomal protein L16 [Oenothera glazioviana]
 gi|159895594|gb|ABX10158.1| ribosomal protein L16 [Oenothera parviflora]
          Length = 135

 Score =  188 bits (479), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 66/132 (50%), Positives = 96/132 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR++G++  G+RICFG +AL+A E   I S +IEA RRA++R ++R
Sbjct: 1   MLSPKRTRFRKQHRGRMRGISYRGNRICFGKYALQALEPAWITSRQIEAGRRAMTRNVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+ W+ +FPD PVT +  E RMG GKGN E WV  VKPGRIL+E+ GV+E +AR+A  +
Sbjct: 61  GGKTWVRIFPDKPVTLRAAETRMGSGKGNPEYWVAVVKPGRILYEMGGVAENIARKAISI 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+FI
Sbjct: 121 AASKMPIRTQFI 132


>gi|224178077|ref|YP_002600919.1| ribosomal protein L16 [Pyramimonas parkeae]
 gi|215882744|gb|ACJ71117.1| ribosomal protein L16 [Pyramimonas parkeae]
          Length = 136

 Score =  188 bits (479), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 62/136 (45%), Positives = 88/136 (64%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ +  +G +KG +  G+ + FG F ++A EA  I S +IEA RR ++R  +R
Sbjct: 1   MLSPKRTKFRRYHRGSLKGTSGRGNTVSFGEFGIQALEAGWITSRQIEAGRRVMTRYARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T +P E RMG GKG  + WV  VKPG+ILFEI GV E +AR A R+
Sbjct: 61  GGKLWIRIFPDKPITMRPAETRMGSGKGAPDYWVAVVKPGKILFEIAGVPEPIARSAMRI 120

Query: 122 GAAKLSVVTKFIQRVV 137
              K+ V T+ I +V 
Sbjct: 121 ACYKMPVKTRIITKVS 136


>gi|330720675|gb|EGG98918.1| LSU ribosomal protein L16p (L10e) [gamma proteobacterium IMCC2047]
          Length = 137

 Score =  188 bits (479), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 78/136 (57%), Positives = 104/136 (76%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGR +G+A  GS + FG+F LKA    RI + +IEAARRA++R +KR
Sbjct: 1   MLQPKRTKFRKTMKGRNRGLAIRGSSVSFGDFGLKATGRGRITARQIEAARRAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T KP EVR GKGKG+VE WVC+++PGR+L+E+DGVSEE+AR AF L
Sbjct: 61  GGKIWIRIFPDKPITKKPLEVRQGKGKGSVEYWVCQIQPGRVLYEMDGVSEELAREAFDL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + T F++R V
Sbjct: 121 AAAKLPIETTFVKRTV 136


>gi|311744802|ref|ZP_07718598.1| 50S ribosomal protein L16 [Aeromicrobium marinum DSM 15272]
 gi|311311919|gb|EFQ81840.1| 50S ribosomal protein L16 [Aeromicrobium marinum DSM 15272]
          Length = 140

 Score =  188 bits (479), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 62/137 (45%), Positives = 91/137 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  KY KQ     +G+AKGG+ + FG++ ++A E + + + +IE+AR A++R MKR
Sbjct: 1   MLMPRRVKYRKQHHPNRRGMAKGGTTLAFGDYGIQAVEGHYVTNRQIESARIAMTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI ++PD P+T KP E RMG GKG+ E WV  VKPGR++FE+ GV E  AR + RL
Sbjct: 61  GGKVWINIYPDRPLTKKPAETRMGSGKGSPEWWVANVKPGRVMFELSGVDEATARESARL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
              KL +  +F+ R  E
Sbjct: 121 AIHKLPMKARFVSRETE 137


>gi|220913425|ref|YP_002488734.1| 50S ribosomal protein L16 [Arthrobacter chlorophenolicus A6]
 gi|254799175|sp|B8HCZ9|RL16_ARTCA RecName: Full=50S ribosomal protein L16
 gi|219860303|gb|ACL40645.1| ribosomal protein L16 [Arthrobacter chlorophenolicus A6]
          Length = 138

 Score =  188 bits (479), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 60/135 (44%), Positives = 87/135 (64%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  K+ KQ      G A GG+ + FG + ++A     + + +IE+AR A++R +KR
Sbjct: 1   MLIPRRVKHRKQHHPGRSGAATGGTEVSFGEWGIQALSPAYVTNRQIESARIAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI ++PD P+T KP E RMG GKG+ E WV  VKPGR+LFE+ GV+EEVAR A RL
Sbjct: 61  GGKVWINIYPDRPLTKKPAETRMGSGKGSPEWWVANVKPGRVLFELSGVNEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  + ++R 
Sbjct: 121 AIHKLPLKARIVRRE 135


>gi|290487878|gb|ADD30323.1| ribosomal protein L16 [Lonicera japonica]
          Length = 135

 Score =  188 bits (479), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 64/132 (48%), Positives = 94/132 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+ ICFG +AL+A E   I S +IEA RRA++R  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGISYRGNHICFGKYALQALEPTWITSRQIEAGRRAMTRNARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +  E RMG GKG+ E WV  VKPGRIL+E+ GV+E +AR+A  +
Sbjct: 61  GGKIWVRIFPDKPVTVRSAETRMGSGKGSPEYWVAVVKPGRILYEMGGVTENIARKAISI 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ +  +FI
Sbjct: 121 AASKMPIRAQFI 132


>gi|77359123|ref|YP_338698.1| 50S ribosomal protein L16 [Pseudoalteromonas haloplanktis TAC125]
 gi|85541818|sp|Q3IF18|RL16_PSEHT RecName: Full=50S ribosomal protein L16
 gi|76874034|emb|CAI85255.1| 50S ribosomal subunit protein L16 [Pseudoalteromonas haloplanktis
           TAC125]
          Length = 137

 Score =  188 bits (479), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 74/136 (54%), Positives = 101/136 (74%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGR +G+A+ G+++ FG F LKA    R+ + +IEAARRA++R +KR
Sbjct: 1   MLQPKRTKFRKTHKGRNRGLAQNGNKVSFGTFGLKATGRGRMTARQIEAARRAMTRHVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD P+T KP EVRMGKGKG+VE WV  ++PG++L+E++GVSEE+AR AF L
Sbjct: 61  QGKIWIRVFPDKPITNKPLEVRMGKGKGSVEYWVAEIQPGKVLYEMEGVSEELAREAFDL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            A KL   T F+ R V
Sbjct: 121 AARKLPFKTTFVTRTV 136


>gi|225846|prf||1401174A protein r
          Length = 136

 Score =  188 bits (479), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 65/136 (47%), Positives = 94/136 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ K  +G ++G A  G++I FG+FAL+AQE   I S +IEA RR ++R ++R
Sbjct: 1   MLSPKRTKFRKPHRGHLRGKATRGNKIVFGDFALQAQEPCWITSRQIEAGRRVLTRYVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD  VT +P + RMG GKG  + WV  V PG+IL+E+ GVSE +AR+A R+
Sbjct: 61  GGKLWIRIFPDKAVTMRPAQTRMGSGKGAPDYWVAVVHPGKILYEMQGVSETIARQAMRI 120

Query: 122 GAAKLSVVTKFIQRVV 137
            A K+ V TKF+ + V
Sbjct: 121 AAYKMPVKTKFLTKTV 136


>gi|290487880|gb|ADD30324.1| ribosomal protein L16 [Meliosma aff. cuneifolia Moore 333]
          Length = 135

 Score =  188 bits (479), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 70/132 (53%), Positives = 96/132 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG +  GSRICFG +AL+A E   I S +IEA RRA++R  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGKSYRGSRICFGRYALQALEPAWITSRQIEAGRRAMTRYARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVT +PTE RMG GKG+ E WV  VKPGRIL+E+ GVSE +AR A  +
Sbjct: 61  GGKIWIRIFPDKPVTLRPTETRMGSGKGSPEYWVSVVKPGRILYEMGGVSEIIAREAISI 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+F+
Sbjct: 121 AASKMPIRTQFV 132


>gi|260584423|ref|ZP_05852170.1| 50S ribosomal protein L16 [Granulicatella elegans ATCC 700633]
 gi|260157941|gb|EEW93010.1| 50S ribosomal protein L16 [Granulicatella elegans ATCC 700633]
          Length = 144

 Score =  188 bits (479), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 70/135 (51%), Positives = 94/135 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ ++F+G+++G AKGG  + FG + L+A E++ I + +IEAAR A++R MKR
Sbjct: 1   MLVPKRVKHRREFRGKMRGEAKGGKEVVFGTYGLQATESHWITNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP    TAK   VRMG GKG  E WV  VK G+I+FEI GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVAPVKRGKIMFEIAGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL V TKF++R 
Sbjct: 121 ASHKLPVKTKFVKRE 135


>gi|86158362|ref|YP_465147.1| 50S ribosomal protein L16 [Anaeromyxobacter dehalogenans 2CP-C]
 gi|115502729|sp|Q2IJ83|RL16_ANADE RecName: Full=50S ribosomal protein L16
 gi|85774873|gb|ABC81710.1| LSU ribosomal protein L16P [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 138

 Score =  188 bits (479), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 71/134 (52%), Positives = 93/134 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QP  TKY K  KGR++G A  GS +  G + L+A E  R+ S +IEAAR AI+R +KR
Sbjct: 1   MLQPARTKYRKMQKGRMRGKAYRGSDLAQGEYGLQATECGRLTSRQIEAARVAITRYVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD P+T KP E RMG GKGNVE +V  VKPGR+L+E+ GV +  A++AF L
Sbjct: 61  GGKLWIRVFPDKPITKKPAETRMGTGKGNVEFYVAVVKPGRVLYELAGVDDASAKKAFHL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL V TK ++R
Sbjct: 121 AAHKLPVATKLVKR 134


>gi|160895847|ref|YP_001561429.1| 50S ribosomal protein L16 [Delftia acidovorans SPH-1]
 gi|226710711|sp|A9BPS5|RL16_DELAS RecName: Full=50S ribosomal protein L16
 gi|160361431|gb|ABX33044.1| ribosomal protein L16 [Delftia acidovorans SPH-1]
          Length = 138

 Score =  188 bits (479), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 73/136 (53%), Positives = 98/136 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QP   KY K+ KGR  G+A  G+ + FG+F LK+ +  R+ + +IEAARRAISR +KR
Sbjct: 1   MLQPARRKYRKEQKGRNTGIATRGNSVAFGDFGLKSTDRGRLTARQIEAARRAISRHVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI VFPD P++ KP EVRMG GKGN E +V  ++PG++L+EI GV EE+AR AFRL
Sbjct: 61  GGRIWIRVFPDKPISTKPAEVRMGNGKGNPEYYVAEIQPGKVLYEIVGVPEELAREAFRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + T F+ R +
Sbjct: 121 AAAKLPLRTTFVSRQI 136


>gi|120609048|ref|YP_968726.1| 50S ribosomal protein L16 [Acidovorax citrulli AAC00-1]
 gi|166234536|sp|A1TJ14|RL16_ACIAC RecName: Full=50S ribosomal protein L16
 gi|120587512|gb|ABM30952.1| LSU ribosomal protein L16P [Acidovorax citrulli AAC00-1]
          Length = 138

 Score =  188 bits (479), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 75/136 (55%), Positives = 97/136 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QP   KY K+ KGR  GVA  G+ + FG+F LK  +  R+ + +IEAARRAISR +KR
Sbjct: 1   MLQPARRKYRKEQKGRNTGVATRGNSVAFGDFGLKCTDRGRLTARQIEAARRAISRHVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI VFPD P++ KP EVRMG GKGN E +V  ++PG+I+FEI GV EE+AR AFRL
Sbjct: 61  GGRIWIRVFPDKPISTKPAEVRMGNGKGNPEYYVAEIQPGKIVFEIVGVPEELAREAFRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + T F+ R +
Sbjct: 121 AAAKLPLRTTFVSRQI 136


>gi|220935485|ref|YP_002514384.1| 50S ribosomal protein L16 [Thioalkalivibrio sp. HL-EbGR7]
 gi|254799231|sp|B8GV51|RL16_THISH RecName: Full=50S ribosomal protein L16
 gi|219996795|gb|ACL73397.1| 50S ribosomal protein L16 [Thioalkalivibrio sp. HL-EbGR7]
          Length = 137

 Score =  188 bits (479), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 82/136 (60%), Positives = 110/136 (80%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQF G+ +G+A  G ++ FG +AL+AQ+  R+ + +IEAARRA++R +KR
Sbjct: 1   MLQPKRTKFRKQFTGKNRGLAFSGGKVSFGEYALRAQDRGRLTARQIEAARRAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPDVPVT KP EVRMGKGKGNVE WVC+V+PGRIL+E++GVSEE+AR AF+L
Sbjct: 61  GGKIWIRVFPDVPVTKKPLEVRMGKGKGNVEYWVCKVQPGRILYEMEGVSEEIAREAFKL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + T+F+ R V
Sbjct: 121 AAAKLPIKTQFVTRTV 136


>gi|290487894|gb|ADD30331.1| ribosomal protein L16 [Bulnesia arborea]
          Length = 135

 Score =  188 bits (479), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 68/132 (51%), Positives = 96/132 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG +  G+RICF  +AL+A E   I S +IEA RRA++R ++R
Sbjct: 1   MLSPKRTRFRKQHRGRLKGRSYRGNRICFARYALQALEPAWITSRQIEAGRRAMTRNIRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +P E RMG GKG+ E WV  VKPGRIL+E+ GVSE +ARRA  +
Sbjct: 61  GGKIWVRIFPDKPVTMRPAETRMGSGKGSPEYWVAVVKPGRILYEMGGVSENIARRAISI 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+FI
Sbjct: 121 AASKMPIRTQFI 132


>gi|290487898|gb|ADD30333.1| ribosomal protein L16 [Euonymus americanus]
          Length = 135

 Score =  188 bits (479), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 66/132 (50%), Positives = 97/132 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+ I FG +AL+A E   I S +IEA RRA++R ++R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGISYRGNHISFGRYALQALEPAWITSRQIEAGRRAMTRNVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +PTE RMG GKG+ E WV  VKPGRIL+E+DGV E +A++A  +
Sbjct: 61  GGKIWVRLFPDKPVTVRPTETRMGSGKGSPEYWVVVVKPGRILYEMDGVGENIAQKAISI 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+FI
Sbjct: 121 AASKMPIRTQFI 132


>gi|242620049|ref|YP_003002053.1| 50S ribosomal protein L16 [Aureococcus anophagefferens]
 gi|239997294|gb|ACS36817.1| 50S ribosomal protein L16 [Aureococcus anophagefferens]
          Length = 136

 Score =  188 bits (479), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 67/136 (49%), Positives = 88/136 (64%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ KQ +GR+KG A   + + FG + L+ QE   + S ++EA RR I+R  KR
Sbjct: 1   MLSPKRTKFRKQQRGRMKGRALRNNTVAFGEYGLQVQECGWLTSRQLEATRRTITRYTKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD  +TA+  E RMG GKG  E WV  VKPG I+FEI GV  +VAR+A  L
Sbjct: 61  GGKLWIKVFPDKSITARAAESRMGSGKGTPEYWVAVVKPGNIIFEIAGVKPDVARQAMNL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            A KL + TKFI +V 
Sbjct: 121 AAYKLPLKTKFISKVS 136


>gi|34500951|ref|NP_904136.1| ribosomal protein L16 [Amborella trichopoda]
 gi|75275906|sp|Q70XX3|RK16_AMBTC RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|34481666|emb|CAD45144.1| ribosomal protein L16 [Amborella trichopoda]
          Length = 135

 Score =  188 bits (479), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 67/133 (50%), Positives = 92/133 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KGV+  G+ ICFG +AL+A E   I S +IEA RRA++R  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGVSSRGNHICFGRYALQALEPAWITSRQIEAGRRAMTRYARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ VFPD P+T +P E RMG GKG+ E WV  +KPGRIL E+ GV E VAR A  +
Sbjct: 61  GGKIWVRVFPDKPITVRPAETRMGSGKGSPEYWVSVIKPGRILHEMGGVPETVARAAMEI 120

Query: 122 GAAKLSVVTKFIQ 134
            A K+ + T+FI 
Sbjct: 121 AACKMPIRTQFIS 133


>gi|261338272|ref|ZP_05966156.1| ribosomal protein L16 [Bifidobacterium gallicum DSM 20093]
 gi|270276927|gb|EFA22781.1| ribosomal protein L16 [Bifidobacterium gallicum DSM 20093]
          Length = 139

 Score =  188 bits (479), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 64/135 (47%), Positives = 87/135 (64%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY KQ +    G++KGG++I FG+F ++A     + + +IEAAR A++R +KR
Sbjct: 1   MLIPKRTKYRKQHRPDRHGMSKGGNQIAFGDFGIQALAPAYVTNRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPD P+T  P   RMG GKG  E W+  + PGR++FEI GVSEEVAR A R 
Sbjct: 61  GGRVWITIFPDRPLTKHPLGARMGSGKGAPEFWIANIHPGRVMFEIGGVSEEVAREALRR 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  + I R 
Sbjct: 121 AIDKLPMKCRVIARE 135


>gi|259047548|ref|ZP_05737949.1| 50S ribosomal protein L16 [Granulicatella adiacens ATCC 49175]
 gi|259035739|gb|EEW36994.1| 50S ribosomal protein L16 [Granulicatella adiacens ATCC 49175]
          Length = 144

 Score =  188 bits (478), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 69/135 (51%), Positives = 94/135 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ ++F+G+++G AKGG  + FG + L+A E++ I + +IEAAR A++R MKR
Sbjct: 1   MLVPKRVKHRREFRGKMRGEAKGGKEVVFGTYGLQATESHWITNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP    TAK   VRMG GKG  E WV  VK G+++FEI GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVAPVKRGKVMFEIAGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL V TKF++R 
Sbjct: 121 ASHKLPVKTKFVKRE 135


>gi|317050535|ref|YP_004111651.1| 50S ribosomal protein L16 [Desulfurispirillum indicum S5]
 gi|316945619|gb|ADU65095.1| ribosomal protein L16 [Desulfurispirillum indicum S5]
          Length = 141

 Score =  188 bits (478), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 69/135 (51%), Positives = 98/135 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY KQF+G+IKG A+ G+ + FG+F L+A E   I S +IEAAR A++R ++R
Sbjct: 1   MLMPKKQKYRKQFRGKIKGTAQKGNEVSFGDFGLQALEPAWITSRQIEAARIAMTRSIRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FP  P++A+P E RMGKGKG+VE +V  VKPG +L+E+DGVSEE+AR A RL
Sbjct: 61  GGKIWIRIFPHKPISARPAETRMGKGKGSVEGFVAVVKPGTMLYEMDGVSEELAREAMRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  +F++R 
Sbjct: 121 AMHKLPIKCRFVKRT 135


>gi|189162309|ref|YP_001936555.1| ribosomal protein L16 [Fagopyrum esculentum subsp. ancestrale]
 gi|215275564|sp|B2XWR1|RK16_FAGEA RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|166065395|gb|ABY79770.1| ribosomal protein L16 [Fagopyrum esculentum subsp. ancestrale]
          Length = 135

 Score =  188 bits (478), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 67/132 (50%), Positives = 97/132 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+RICFG +AL+A E   I S +IEA RRA++R  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGISYRGNRICFGRYALQALEPAWITSRQIEAGRRAMTRNARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +P E RMG GKG+ E WV  VKPGRIL+EI GV E++AR+A  +
Sbjct: 61  GGKLWVRIFPDKPVTVRPAETRMGSGKGSPEYWVAVVKPGRILYEISGVPEKIARKAISI 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+F+
Sbjct: 121 AASKMPIRTQFL 132


>gi|270291126|ref|ZP_06197349.1| 50S ribosomal protein L16 [Pediococcus acidilactici 7_4]
 gi|304385407|ref|ZP_07367752.1| 50S ribosomal protein L16 [Pediococcus acidilactici DSM 20284]
 gi|270280522|gb|EFA26357.1| 50S ribosomal protein L16 [Pediococcus acidilactici 7_4]
 gi|304328614|gb|EFL95835.1| 50S ribosomal protein L16 [Pediococcus acidilactici DSM 20284]
          Length = 144

 Score =  188 bits (478), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 66/135 (48%), Positives = 88/135 (65%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ ++ +GR++G AKGG  + FG F L+A  ++ I + +IEAAR A++R MKR
Sbjct: 1   MLVPKRVKHRREHRGRMRGAAKGGKTVTFGEFGLQALTSSWITNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP    T+K   VRMG GKG  E WV  VK  +++FE+ GV EEVAR A RL
Sbjct: 61  GGKVWIKIFPHKSYTSKGVGVRMGNGKGTPEGWVAPVKREKVMFEVAGVPEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL V TK I R 
Sbjct: 121 AAMKLPVKTKIIARE 135


>gi|328955907|ref|YP_004373240.1| LSU ribosomal protein L16P [Coriobacterium glomerans PW2]
 gi|328456231|gb|AEB07425.1| LSU ribosomal protein L16P [Coriobacterium glomerans PW2]
          Length = 143

 Score =  188 bits (478), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 74/134 (55%), Positives = 95/134 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK   + K  +G +KG AKG +++ FG F ++A EA+ I + +IEAAR A++R MKR
Sbjct: 1   MLAPKRVLHRKVQRGSMKGQAKGNTQLYFGEFGIRALEAHWITNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRV+I +FPD PV+ KP E RMGKGKGN E+WV  VKPGRI+FEI GVSEEVAR A RL
Sbjct: 61  GGRVYITIFPDKPVSKKPAETRMGKGKGNPEEWVAVVKPGRIMFEIAGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL + TK + R
Sbjct: 121 AQHKLPIKTKIVTR 134


>gi|325280961|ref|YP_004253503.1| 50S ribosomal protein L16 [Odoribacter splanchnicus DSM 20712]
 gi|324312770|gb|ADY33323.1| 50S ribosomal protein L16 [Odoribacter splanchnicus DSM 20712]
          Length = 140

 Score =  188 bits (478), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 72/134 (53%), Positives = 95/134 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ +  KGR+KG A+ G+++ FG+F +KA E   I   +IEAAR A++R M+R
Sbjct: 1   MLQPKRTKFRRSQKGRMKGNAQRGNQLAFGSFGIKALEEKWIEGRQIEAARVAVTRYMQR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T KP EVRMGKGKGN E +V  V PGRI+FE DGV   VA+ A RL
Sbjct: 61  QGQIWIRIFPDKPITKKPAEVRMGKGKGNPEGFVAPVTPGRIIFEADGVPYAVAKEALRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + TKF+ R
Sbjct: 121 AAQKLPITTKFVVR 134


>gi|81176289|ref|YP_398366.1| ribosomal protein L16 [Lactuca sativa]
 gi|85541790|sp|Q332T9|RK16_LACSA RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|78675207|dbj|BAE47633.1| ribosomal protein L16 [Lactuca sativa]
          Length = 135

 Score =  188 bits (478), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 66/132 (50%), Positives = 95/132 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+ ICFG +AL+A E   I S +IEA RRA++R  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGISYRGNAICFGKYALQALEPAWITSRQIEAGRRAMTRNARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +P E RMG GKG+ E WV  VKPGRIL+E+ GV+E +ARRA  +
Sbjct: 61  GGKIWVRIFPDKPVTVRPAETRMGSGKGSPEYWVAVVKPGRILYEMGGVTENIARRAISI 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ +  +FI
Sbjct: 121 AASKMPIRAQFI 132


>gi|229823528|ref|ZP_04449597.1| hypothetical protein GCWU000282_00826 [Catonella morbi ATCC 51271]
 gi|229786972|gb|EEP23086.1| hypothetical protein GCWU000282_00826 [Catonella morbi ATCC 51271]
          Length = 144

 Score =  188 bits (478), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 68/135 (50%), Positives = 95/135 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ ++F+G+++G AKGG ++ FG + L+A E++ I + +IEAAR A++R MKR
Sbjct: 1   MLVPKRVKHRREFRGKMRGEAKGGKQVDFGEYGLRATESHWITNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP    TAK   VRMG GKG  E WV  VK G+I+FE+ GVSEE+AR A RL
Sbjct: 61  GGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVAPVKRGKIMFEVAGVSEEIAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL V TKF++R 
Sbjct: 121 ASHKLPVKTKFVKRE 135


>gi|15644241|ref|NP_229293.1| 50S ribosomal protein L16 [Thermotoga maritima MSB8]
 gi|585867|sp|P38509|RL16_THEMA RecName: Full=50S ribosomal protein L16
 gi|4982057|gb|AAD36559.1|AE001798_24 ribosomal protein L16 [Thermotoga maritima MSB8]
 gi|437930|emb|CAA79784.1| ribosomal protein L16 [Thermotoga maritima]
          Length = 142

 Score =  188 bits (478), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 73/134 (54%), Positives = 92/134 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  KY KQ +GR+KG AKGG+ + FG + LKA E   I + +IEA R A+ R MKR
Sbjct: 1   MLMPRRVKYRKQQRGRMKGKAKGGTFVQFGEWGLKALEPAWITAQQIEACRIAMLRVMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           +G++WI +FPD P T KP E RMGKGKGNVE WV  VKPG+ILFE+ GV EE A  A R 
Sbjct: 61  SGKIWIRIFPDKPYTKKPPESRMGKGKGNVEGWVAVVKPGKILFEVAGVDEETAHEALRY 120

Query: 122 GAAKLSVVTKFIQR 135
            A+KL + TK + R
Sbjct: 121 AASKLPIATKIVPR 134


>gi|283795004|ref|YP_003359395.1| ribosomal protein L16 [Olea europaea]
 gi|281428723|gb|ADA69962.1| ribosomal protein L16 [Olea europaea]
          Length = 136

 Score =  188 bits (478), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 67/133 (50%), Positives = 96/133 (72%), Gaps = 1/133 (0%)

Query: 2   LRQ-PKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMK 60
           +   PK T++ KQ +GR+KG++  G+ ICFG +AL+A E   I S +IEA RRA++R  +
Sbjct: 1   MLSDPKRTRFRKQHRGRMKGISYRGNHICFGKYALQALEPAWITSRQIEAGRRAMTRNAR 60

Query: 61  RAGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFR 120
           R G++W+ +FPD PVT +P E RMG GKG+ E WV  VKPGRIL+E+ GV+E +ARRA  
Sbjct: 61  RGGKIWVRIFPDKPVTVRPAETRMGSGKGSPEYWVAVVKPGRILYEMGGVTENIARRAIS 120

Query: 121 LGAAKLSVVTKFI 133
           + A+K+ + T+FI
Sbjct: 121 IAASKMPIRTQFI 133


>gi|167752392|ref|ZP_02424519.1| hypothetical protein ALIPUT_00636 [Alistipes putredinis DSM 17216]
 gi|167660633|gb|EDS04763.1| hypothetical protein ALIPUT_00636 [Alistipes putredinis DSM 17216]
          Length = 142

 Score =  188 bits (478), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 75/134 (55%), Positives = 100/134 (74%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ +  KGR+KG+A+ G+++ +G+FA+KA ++  I   +IEAAR+AI+R MKR
Sbjct: 1   MLQPKKTKFRRMQKGRMKGIAQRGNQLAYGSFAIKALDSAWITGRQIEAARQAITRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T KP EVRMGKGKGN E +V  V PGRILFE +GV   VA+ A RL
Sbjct: 61  EGQLWIRIFPDKPITKKPAEVRMGKGKGNPEGFVAPVTPGRILFEAEGVPLAVAQEALRL 120

Query: 122 GAAKLSVVTKFIQR 135
           GA KL + TKFI R
Sbjct: 121 GAQKLPITTKFIVR 134


>gi|16801835|ref|NP_472103.1| 50S ribosomal protein L16 [Listeria innocua Clip11262]
 gi|16804663|ref|NP_466148.1| 50S ribosomal protein L16 [Listeria monocytogenes EGD-e]
 gi|46908797|ref|YP_015186.1| 50S ribosomal protein L16 [Listeria monocytogenes str. 4b F2365]
 gi|47093990|ref|ZP_00231724.1| ribosomal protein L16 [Listeria monocytogenes str. 4b H7858]
 gi|47097196|ref|ZP_00234761.1| ribosomal protein L16 [Listeria monocytogenes str. 1/2a F6854]
 gi|116873991|ref|YP_850772.1| 50S ribosomal protein L16 [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|217966176|ref|YP_002351854.1| ribosomal protein L16 [Listeria monocytogenes HCC23]
 gi|224499298|ref|ZP_03667647.1| 50S ribosomal protein L16 [Listeria monocytogenes Finland 1988]
 gi|224503581|ref|ZP_03671888.1| 50S ribosomal protein L16 [Listeria monocytogenes FSL R2-561]
 gi|226225170|ref|YP_002759277.1| ribosomal protein L16 [Listeria monocytogenes Clip81459]
 gi|254825014|ref|ZP_05230015.1| rplP [Listeria monocytogenes FSL J1-194]
 gi|254829074|ref|ZP_05233761.1| ribosomal protein L16 [Listeria monocytogenes FSL N3-165]
 gi|254830943|ref|ZP_05235598.1| 50S ribosomal protein L16 [Listeria monocytogenes 10403S]
 gi|254854169|ref|ZP_05243517.1| rplP [Listeria monocytogenes FSL R2-503]
 gi|254899924|ref|ZP_05259848.1| 50S ribosomal protein L16 [Listeria monocytogenes J0161]
 gi|254912870|ref|ZP_05262882.1| 50S ribosomal protein L16 [Listeria monocytogenes J2818]
 gi|254931105|ref|ZP_05264464.1| ribosomal protein L16 [Listeria monocytogenes HPB2262]
 gi|254937250|ref|ZP_05268947.1| ribosomal protein L16 [Listeria monocytogenes F6900]
 gi|254991847|ref|ZP_05274037.1| 50S ribosomal protein L16 [Listeria monocytogenes FSL J2-064]
 gi|255023146|ref|ZP_05295132.1| 50S ribosomal protein L16 [Listeria monocytogenes FSL J1-208]
 gi|255026652|ref|ZP_05298638.1| 50S ribosomal protein L16 [Listeria monocytogenes FSL J2-003]
 gi|255028282|ref|ZP_05300233.1| 50S ribosomal protein L16 [Listeria monocytogenes LO28]
 gi|255519647|ref|ZP_05386884.1| 50S ribosomal protein L16 [Listeria monocytogenes FSL J1-175]
 gi|284800489|ref|YP_003412354.1| 50S ribosomal protein L16 [Listeria monocytogenes 08-5578]
 gi|284993675|ref|YP_003415443.1| 50S ribosomal protein L16 [Listeria monocytogenes 08-5923]
 gi|289435891|ref|YP_003465763.1| ribosomal protein L16 [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|290891810|ref|ZP_06554807.1| rplP protein [Listeria monocytogenes FSL J2-071]
 gi|300763624|ref|ZP_07073622.1| ribosomal protein L16 [Listeria monocytogenes FSL N1-017]
 gi|315283837|ref|ZP_07871901.1| ribosomal protein L16 [Listeria marthii FSL S4-120]
 gi|315304944|ref|ZP_07875039.1| ribosomal protein L16 [Listeria ivanovii FSL F6-596]
 gi|81565232|sp|Q71WF3|RL16_LISMF RecName: Full=50S ribosomal protein L16
 gi|81571708|sp|Q7ANU4|RL16_LISIN RecName: Full=50S ribosomal protein L16
 gi|81595177|sp|Q927L4|RL16_LISMO RecName: Full=50S ribosomal protein L16
 gi|123464197|sp|A0ALW1|RL16_LISW6 RecName: Full=50S ribosomal protein L16
 gi|254799207|sp|B8DB15|RL16_LISMH RecName: Full=50S ribosomal protein L16
 gi|259646054|sp|C1KZH3|RL16_LISMC RecName: Full=50S ribosomal protein L16
 gi|16412113|emb|CAD00703.1| ribosomal protein L16 [Listeria monocytogenes EGD-e]
 gi|16415310|emb|CAC98000.1| ribosomal protein L16 [Listeria innocua Clip11262]
 gi|46882070|gb|AAT05363.1| ribosomal protein L16 [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|47014455|gb|EAL05423.1| ribosomal protein L16 [Listeria monocytogenes str. 1/2a F6854]
 gi|47017651|gb|EAL08450.1| ribosomal protein L16 [Listeria monocytogenes str. 4b H7858]
 gi|116742869|emb|CAK21993.1| ribosomal protein L16 [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|217335446|gb|ACK41240.1| ribosomal protein L16 [Listeria monocytogenes HCC23]
 gi|225877632|emb|CAS06346.1| ribosomal protein L16 [Listeria monocytogenes serotype 4b str. CLIP
           80459]
 gi|258601484|gb|EEW14809.1| ribosomal protein L16 [Listeria monocytogenes FSL N3-165]
 gi|258607561|gb|EEW20169.1| rplP [Listeria monocytogenes FSL R2-503]
 gi|258609856|gb|EEW22464.1| ribosomal protein L16 [Listeria monocytogenes F6900]
 gi|284056051|gb|ADB66992.1| 50S ribosomal protein L16 [Listeria monocytogenes 08-5578]
 gi|284059142|gb|ADB70081.1| 50S ribosomal protein L16 [Listeria monocytogenes 08-5923]
 gi|289172135|emb|CBH28681.1| ribosomal protein L16 [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|290558404|gb|EFD91921.1| rplP protein [Listeria monocytogenes FSL J2-071]
 gi|293582652|gb|EFF94684.1| ribosomal protein L16 [Listeria monocytogenes HPB2262]
 gi|293590869|gb|EFF99203.1| 50S ribosomal protein L16 [Listeria monocytogenes J2818]
 gi|293594255|gb|EFG02016.1| rplP [Listeria monocytogenes FSL J1-194]
 gi|300515901|gb|EFK42950.1| ribosomal protein L16 [Listeria monocytogenes FSL N1-017]
 gi|307572214|emb|CAR85393.1| ribosomal protein L16 [Listeria monocytogenes L99]
 gi|313612523|gb|EFR86601.1| ribosomal protein L16 [Listeria marthii FSL S4-120]
 gi|313616918|gb|EFR89565.1| ribosomal protein L16 [Listeria innocua FSL S4-378]
 gi|313622228|gb|EFR92748.1| ribosomal protein L16 [Listeria innocua FSL J1-023]
 gi|313626686|gb|EFR95724.1| ribosomal protein L16 [Listeria ivanovii FSL F6-596]
 gi|313631771|gb|EFR98959.1| ribosomal protein L16 [Listeria seeligeri FSL N1-067]
 gi|328468110|gb|EGF39116.1| 50S ribosomal protein L16 [Listeria monocytogenes 1816]
 gi|328469798|gb|EGF40715.1| 50S ribosomal protein L16 [Listeria monocytogenes 220]
          Length = 144

 Score =  188 bits (478), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 71/135 (52%), Positives = 94/135 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY ++F+G ++G AKGG+ + FG + L+A EA+ I + +IEAAR A++R MKR
Sbjct: 1   MLVPKRVKYRREFRGNMRGRAKGGTEVAFGEYGLQAVEASWITNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP    T+KP  VRMGKGKG  E WV  VK G+I+FEI GV E+VAR A RL
Sbjct: 61  GGKVWIKIFPHKSYTSKPIGVRMGKGKGAPEGWVSPVKRGKIMFEIAGVPEDVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL V TK ++R 
Sbjct: 121 AAHKLPVKTKIVKRE 135


>gi|156618860|ref|YP_001430141.1| ribosomal protein L16 [Cuscuta reflexa]
 gi|215275560|sp|A7M9A0|RK16_CUSRE RecName: Full=50S ribosomal protein L16, plastid
 gi|156556045|emb|CAM98428.1| ribosomal protein L16 [Cuscuta reflexa]
          Length = 137

 Score =  188 bits (478), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 67/137 (48%), Positives = 97/137 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +G++KG++  G+ ICFG +AL+A E   I S +IEA RRA++R  +R
Sbjct: 1   MLSPKRTRFRKQHRGKMKGISYRGNHICFGKYALQALEPAWITSRQIEAGRRAMTRKARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+ W+ +FPD PVT +P E RMG GKG  E WV  VKPGRIL+E+ GV++ +ARRAF +
Sbjct: 61  GGKFWVRIFPDKPVTVRPAETRMGSGKGCPEYWVAVVKPGRILYEMGGVTKNIARRAFSI 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            A+K+ + T+FI   +E
Sbjct: 121 AASKMPIRTQFIILEIE 137


>gi|269991350|emb|CAX12534.1| 50S ribosomal protein L16 [Fucus vesiculosus]
          Length = 141

 Score =  188 bits (478), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 62/136 (45%), Positives = 91/136 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ KQ +GR+KG     + I FG++A++A E   + S +IEA RR I+R  KR
Sbjct: 1   MLSPKRTKFRKQHRGRLKGKVSNRNNINFGDYAIQALEPTWLTSRQIEATRRTITRYTKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD P+TA+  E RMG GKG V+ WV  +KPG ILFE+ GV  ++A+ A ++
Sbjct: 61  GGKLWITVFPDKPITARAAESRMGSGKGAVDYWVAVIKPGTILFELSGVPLKLAKEAMQI 120

Query: 122 GAAKLSVVTKFIQRVV 137
            + KL + TKF+ + +
Sbjct: 121 ASYKLPIKTKFLIKEI 136


>gi|169830443|ref|YP_001716425.1| 50S ribosomal protein L16 [Candidatus Desulforudis audaxviator
           MP104C]
 gi|226710713|sp|B1I1J5|RL16_DESAP RecName: Full=50S ribosomal protein L16
 gi|169637287|gb|ACA58793.1| ribosomal protein L16 [Candidatus Desulforudis audaxviator MP104C]
          Length = 143

 Score =  188 bits (478), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 70/135 (51%), Positives = 92/135 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ +Q +    G AKGG++I FG+ AL++ +   I S +IEAAR A++R +KR
Sbjct: 1   MLTPKRVKWRRQHRPDRAGKAKGGTKIQFGDLALQSLDVAWISSRQIEAARIAMTRHVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+TAKP E RMG GKG+ E WV  VKPGRI+FEI GV EE AR A RL
Sbjct: 61  GGKVWIRIFPDRPITAKPAETRMGSGKGSPEYWVAVVKPGRIMFEIAGVPEETAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL   TK ++R 
Sbjct: 121 ASHKLPCRTKIVKRQ 135


>gi|303256457|ref|ZP_07342471.1| ribosomal protein L16 [Burkholderiales bacterium 1_1_47]
 gi|331000651|ref|ZP_08324304.1| ribosomal protein L16 [Parasutterella excrementihominis YIT 11859]
 gi|302859948|gb|EFL83025.1| ribosomal protein L16 [Burkholderiales bacterium 1_1_47]
 gi|329570863|gb|EGG52574.1| ribosomal protein L16 [Parasutterella excrementihominis YIT 11859]
          Length = 138

 Score =  188 bits (478), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 75/136 (55%), Positives = 99/136 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QP  TKY K  KGR  G+A+ G+++ FG F LK  E  R+ + +IEAARRAI+R +KR
Sbjct: 1   MLQPNRTKYRKDQKGRNYGLAQRGAKVSFGQFGLKVTERGRLTARQIEAARRAITRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI VFPD P+++KP EVRMG GKGN E WV  V+PGR+++E+DGV E +AR AFRL
Sbjct: 61  GGRVWIRVFPDKPISSKPAEVRMGNGKGNPEFWVALVQPGRVIYELDGVDEALAREAFRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + + F+ R +
Sbjct: 121 AAAKLPLKSMFVTRQI 136


>gi|149390479|ref|YP_001294308.1| ribosomal protein L16 [Illicium oligandrum]
 gi|215275568|sp|A6MMY2|RK16_ILLOL RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|147917432|gb|ABQ52556.1| ribosomal protein L16 [Illicium oligandrum]
          Length = 136

 Score =  188 bits (478), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 70/133 (52%), Positives = 96/133 (72%), Gaps = 1/133 (0%)

Query: 2   LRQ-PKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMK 60
           +   PK T++ KQ +GR+KGV+  G+ ICFG +AL+A E   I S +IEA RRA++R  +
Sbjct: 1   MLSNPKRTRFRKQHRGRMKGVSYRGNHICFGRYALQALEPAWITSRQIEAGRRAMTRYAR 60

Query: 61  RAGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFR 120
           R GR+W+ +FPD PVT +PTE RMG GKG+ E WV  VKPGRIL+E+ GVSE VAR A  
Sbjct: 61  RGGRIWVRIFPDKPVTVRPTETRMGSGKGSPEYWVSVVKPGRILYEMGGVSETVARSAIS 120

Query: 121 LGAAKLSVVTKFI 133
           + A+K+ + T+F+
Sbjct: 121 IAASKMPIRTQFV 133


>gi|73748323|ref|YP_307562.1| 50S ribosomal protein L16 [Dehalococcoides sp. CBDB1]
 gi|147669103|ref|YP_001213921.1| 50S ribosomal protein L16 [Dehalococcoides sp. BAV1]
 gi|289432371|ref|YP_003462244.1| ribosomal protein L16 [Dehalococcoides sp. GT]
 gi|85541805|sp|Q3ZZL7|RL16_DEHSC RecName: Full=50S ribosomal protein L16
 gi|189041458|sp|A5FRY2|RL16_DEHSB RecName: Full=50S ribosomal protein L16
 gi|73660039|emb|CAI82646.1| ribosomal protein L16 [Dehalococcoides sp. CBDB1]
 gi|146270051|gb|ABQ17043.1| LSU ribosomal protein L16P [Dehalococcoides sp. BAV1]
 gi|288946091|gb|ADC73788.1| ribosomal protein L16 [Dehalococcoides sp. GT]
          Length = 149

 Score =  188 bits (478), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 66/136 (48%), Positives = 91/136 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK  K+ K  +GR  G A  G+ + FG FAL++ EA  I + +IEA RRAI+R ++R
Sbjct: 1   MLQPKRVKFRKVQRGRRDGAAHKGNTVAFGEFALQSLEAGWITARQIEATRRAITRYIRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T KP E R G GKG  E+WV  V+ GRI+FEI GV+ E A+ A RL
Sbjct: 61  GGQVWIRIFPDKPITKKPAETRQGGGKGAPEEWVAVVRRGRIMFEIGGVTPEAAKEAMRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            + K+ V T+F+ R +
Sbjct: 121 ASYKMPVKTRFVARDI 136


>gi|13518475|ref|NP_084834.1| ribosomal protein L16 [Lotus japonicus]
 gi|23822033|sp|Q9BBP9|RK16_LOTJA RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|13359016|dbj|BAB33233.1| ribosomal protein L16 [Lotus japonicus]
          Length = 135

 Score =  188 bits (478), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 66/132 (50%), Positives = 99/132 (75%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G++ICFG +AL+A E   I S +IEA RRA+SR ++R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGISHRGNQICFGRYALQALEPAWITSRQIEAGRRAMSRNVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +PTE RMG GKG+ E WV  VKPG+I++E+ GV+E +AR+A  +
Sbjct: 61  GGQIWVRIFPDKPVTVRPTETRMGSGKGSPEYWVAVVKPGKIVYEMGGVAENIARKAISI 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+FI
Sbjct: 121 AASKMPIRTQFI 132


>gi|227530212|ref|ZP_03960261.1| 50S ribosomal protein L16 [Lactobacillus vaginalis ATCC 49540]
 gi|227349887|gb|EEJ40178.1| 50S ribosomal protein L16 [Lactobacillus vaginalis ATCC 49540]
          Length = 144

 Score =  188 bits (478), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 66/135 (48%), Positives = 89/135 (65%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ K  +G ++G AKGG  + FG F L+A +++ I + +IEAAR AI+R MKR
Sbjct: 1   MLVPKRVKHRKVQRGHMRGEAKGGKTVSFGEFGLQALDSHWISNRQIEAARIAITRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP +  T+K   VRMG GKG  E WV  VK G+++FE+ GVSEE AR A RL
Sbjct: 61  GGKVWIKIFPQLSYTSKGVGVRMGNGKGAPEGWVAPVKRGKVMFEVAGVSEETAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL V TK ++R 
Sbjct: 121 AGHKLPVRTKIVKRE 135


>gi|326334538|ref|ZP_08200749.1| 50S ribosomal protein L16 [Capnocytophaga sp. oral taxon 338 str.
           F0234]
 gi|325693307|gb|EGD35235.1| 50S ribosomal protein L16 [Capnocytophaga sp. oral taxon 338 str.
           F0234]
          Length = 139

 Score =  188 bits (478), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 72/133 (54%), Positives = 95/133 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TKY K  KGR+KG+++ G ++  G F +K+ E+  I + +IE+AR A +R MKR
Sbjct: 1   MLQPKRTKYRKAQKGRMKGISQRGHQLSNGTFGVKSLESAFITARQIESARVAATRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T KP EVRMGKGKG VE WV  VKPGR+LFE+ GV  +VA+ A RL
Sbjct: 61  EGQLWIKIFPDKPITKKPLEVRMGKGKGAVEYWVAVVKPGRVLFEVGGVPLDVAKEALRL 120

Query: 122 GAAKLSVVTKFIQ 134
            A KL V TKF+ 
Sbjct: 121 AAQKLPVTTKFVV 133


>gi|295137041|ref|YP_003587588.1| ribosomal protein L16 [Pisum sativum]
 gi|293338613|gb|ADE43586.1| ribosomal protein L16 [Pisum sativum]
          Length = 135

 Score =  188 bits (478), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 66/132 (50%), Positives = 96/132 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ K  +GR+KG A  G++ICFG +AL+A E   I S ++EA RRA+SR ++R
Sbjct: 1   MLSPKRTRFRKHHRGRMKGKASRGNKICFGKYALQALEPAWITSRQLEAGRRAMSRNVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +PTE RMG GKG+ E WV  VKPG+IL+E+ GV E +AR+A  +
Sbjct: 61  GGQIWVRIFPDKPVTVRPTETRMGSGKGSPEYWVAVVKPGKILYEMGGVPENIARKAISI 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+FI
Sbjct: 121 AASKMPIRTQFI 132


>gi|198282644|ref|YP_002218965.1| 50S ribosomal protein L16 [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218666486|ref|YP_002424837.1| ribosomal protein L16 [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|226710440|sp|B7J474|RL16_ACIF2 RecName: Full=50S ribosomal protein L16
 gi|226710441|sp|B5ELY6|RL16_ACIF5 RecName: Full=50S ribosomal protein L16
 gi|198247165|gb|ACH82758.1| ribosomal protein L16 [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218518699|gb|ACK79285.1| ribosomal protein L16 [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 138

 Score =  188 bits (478), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 81/136 (59%), Positives = 103/136 (75%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQ KGR +GVA  GS++ FG F LKA    RI + ++EAARRAISR +KR
Sbjct: 1   MLQPKRTKFRKQHKGRNRGVATRGSKVSFGEFGLKAVGRGRITARQLEAARRAISRHVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI +FPD P++ KP EVRMGKGKGN E WV  ++PG++L+E++GV+EEVAR AF L
Sbjct: 61  GGRIWIRIFPDKPISKKPAEVRMGKGKGNPEYWVALIQPGKVLYEMEGVTEEVAREAFAL 120

Query: 122 GAAKLSVVTKFIQRVV 137
           GAAKL V T F+ R V
Sbjct: 121 GAAKLPVQTAFVSRRV 136


>gi|91208938|ref|YP_538973.1| ribosomal protein L16 [Gossypium hirsutum]
 gi|115502621|sp|Q2L940|RK16_GOSHI RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|85687452|gb|ABC73664.1| ribosomal protein L16 [Gossypium hirsutum]
          Length = 135

 Score =  188 bits (478), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 67/132 (50%), Positives = 98/132 (74%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  ++ KQ +GR+KG++  G+RICFG +AL+A E   I S +IEA RRA++R ++R
Sbjct: 1   MLSPKRNRFRKQHRGRMKGISYRGNRICFGRYALQALEPAWITSRQIEAGRRAMTRNVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +PTE RMG GKG+ E WV  VKPGRIL+E+ GV+E +AR+A  +
Sbjct: 61  GGKIWVRIFPDKPVTVRPTETRMGSGKGSPEYWVAVVKPGRILYEMSGVAENIARKAISI 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+FI
Sbjct: 121 AASKMPIKTQFI 132


>gi|298373705|ref|ZP_06983694.1| ribosomal protein L16 [Bacteroidetes oral taxon 274 str. F0058]
 gi|298274757|gb|EFI16309.1| ribosomal protein L16 [Bacteroidetes oral taxon 274 str. F0058]
          Length = 143

 Score =  188 bits (478), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 70/134 (52%), Positives = 98/134 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ +Q KGR+KG A+ G+++ FG+F +K+ ++  I   +IEAAR A++R M+R
Sbjct: 1   MLQPKKTKFRRQQKGRMKGNAQRGNQLSFGSFGIKSLQSKWITGRQIEAARVAVTRHMQR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VW+ +FPD P+T KP EVRMGKGKG  E +V  V PGR++ EI+GVS E+A+ A RL
Sbjct: 61  QGQVWVRIFPDKPITKKPAEVRMGKGKGAPEGFVAPVTPGRMIIEIEGVSFELAKEALRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL V TKF+ R
Sbjct: 121 AAQKLPVTTKFVVR 134


>gi|159161287|ref|YP_001542565.1| ribosomal protein L16 [Cuscuta exaltata]
 gi|215275557|sp|A8W3F8|RK16_CUSEX RecName: Full=50S ribosomal protein L16, plastid
 gi|158938712|gb|ABW83729.1| ribosomal protein L16 [Cuscuta exaltata]
          Length = 137

 Score =  187 bits (477), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 66/137 (48%), Positives = 99/137 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +G++KG++  G+ ICFG +AL+A E   + S +IEA RRA++R  +R
Sbjct: 1   MLSPKRTRFRKQHRGKLKGISYRGNHICFGRYALQALEPAWLTSRQIEAGRRAMTRNARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +P E RMG GKG  E WV  VKPGRIL+E+ GV++++ARRAF +
Sbjct: 61  GGKIWVRIFPDKPVTVRPAETRMGSGKGCPEYWVAVVKPGRILYEMGGVTKKIARRAFSI 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            A+K+ + T+FI   +E
Sbjct: 121 AASKMPIRTQFIISEIE 137


>gi|299139137|ref|ZP_07032313.1| ribosomal protein L16 [Acidobacterium sp. MP5ACTX8]
 gi|298598817|gb|EFI54979.1| ribosomal protein L16 [Acidobacterium sp. MP5ACTX8]
          Length = 144

 Score =  187 bits (477), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 68/134 (50%), Positives = 90/134 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY KQ +GR+ G A  GS I FG+F LK  E   I   +IEA+R A++R +KR
Sbjct: 1   MLLPKKVKYRKQQRGRMCGKAWRGSDISFGDFGLKVLECGYITDRQIEASRIAMTRFIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VW+ +FPD P+T KP E RMGKGKG  + WV  V+PG+ILFE++GV  E+A+ A RL
Sbjct: 61  GGKVWLRLFPDKPITKKPAETRMGKGKGAPDHWVAVVRPGKILFEMEGVPVELAKEAMRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + T F+ R
Sbjct: 121 AAHKLPLKTTFVVR 134


>gi|85374458|ref|YP_458520.1| 50S ribosomal protein L16 [Erythrobacter litoralis HTCC2594]
 gi|122544175|sp|Q2N9B8|RL16_ERYLH RecName: Full=50S ribosomal protein L16
 gi|84787541|gb|ABC63723.1| ribosomal protein L16/L10E [Erythrobacter litoralis HTCC2594]
          Length = 144

 Score =  187 bits (477), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 83/134 (61%), Positives = 99/134 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TKY K FKGRIKG AKGG+ + FG++ LKA E  R+ + +IEAARRAI+R +KR
Sbjct: 1   MLQPKKTKYRKAFKGRIKGDAKGGTTLNFGSYGLKALEPERVTARQIEAARRAITRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI VFPDVPV+ KP EVR GKGKG+VE W  RVKPGRILFE+DGV   +A  AF  
Sbjct: 61  QGRLWIRVFPDVPVSKKPAEVRQGKGKGSVEYWAARVKPGRILFELDGVPGPLAASAFER 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL V TK + R
Sbjct: 121 AAMKLPVKTKVVAR 134


>gi|15676076|ref|NP_273207.1| 50S ribosomal protein L16 [Neisseria meningitidis MC58]
 gi|59802153|ref|YP_208865.1| 50S ribosomal protein L16 [Neisseria gonorrhoeae FA 1090]
 gi|121634023|ref|YP_974268.1| 50S ribosomal protein L16 [Neisseria meningitidis FAM18]
 gi|161870908|ref|YP_001600088.1| 50S ribosomal protein L16 [Neisseria meningitidis 053442]
 gi|218767161|ref|YP_002341673.1| 50S ribosomal protein L16 [Neisseria meningitidis Z2491]
 gi|239997933|ref|ZP_04717857.1| 50S ribosomal protein L16 [Neisseria gonorrhoeae 35/02]
 gi|240015089|ref|ZP_04722002.1| 50S ribosomal protein L16 [Neisseria gonorrhoeae DGI18]
 gi|240017538|ref|ZP_04724078.1| 50S ribosomal protein L16 [Neisseria gonorrhoeae FA6140]
 gi|240081681|ref|ZP_04726224.1| 50S ribosomal protein L16 [Neisseria gonorrhoeae FA19]
 gi|240113959|ref|ZP_04728449.1| 50S ribosomal protein L16 [Neisseria gonorrhoeae MS11]
 gi|240116693|ref|ZP_04730755.1| 50S ribosomal protein L16 [Neisseria gonorrhoeae PID18]
 gi|240118915|ref|ZP_04732977.1| 50S ribosomal protein L16 [Neisseria gonorrhoeae PID1]
 gi|240122161|ref|ZP_04735123.1| 50S ribosomal protein L16 [Neisseria gonorrhoeae PID24-1]
 gi|240124453|ref|ZP_04737409.1| 50S ribosomal protein L16 [Neisseria gonorrhoeae PID332]
 gi|240124678|ref|ZP_04737564.1| 50S ribosomal protein L16 [Neisseria gonorrhoeae SK-92-679]
 gi|254494714|ref|ZP_05107885.1| 50S ribosomal protein L16 [Neisseria gonorrhoeae 1291]
 gi|254805807|ref|YP_003084028.1| 50S ribosomal protein L16 [Neisseria meningitidis alpha14]
 gi|260439548|ref|ZP_05793364.1| 50S ribosomal protein L16 [Neisseria gonorrhoeae DGI2]
 gi|268593783|ref|ZP_06127950.1| 50S ribosomal protein L16 [Neisseria gonorrhoeae 35/02]
 gi|268597778|ref|ZP_06131945.1| 50S ribosomal protein L16 [Neisseria gonorrhoeae FA19]
 gi|268600023|ref|ZP_06134190.1| 50S ribosomal protein L16 [Neisseria gonorrhoeae MS11]
 gi|268602361|ref|ZP_06136528.1| 50S ribosomal protein L16 [Neisseria gonorrhoeae PID18]
 gi|268604624|ref|ZP_06138791.1| 50S ribosomal protein L16 [Neisseria gonorrhoeae PID1]
 gi|268683082|ref|ZP_06149944.1| 50S ribosomal protein L16 [Neisseria gonorrhoeae PID332]
 gi|268683252|ref|ZP_06150114.1| 50S ribosomal protein L16 [Neisseria gonorrhoeae SK-92-679]
 gi|291042784|ref|ZP_06568525.1| 50S ribosomal protein L16 [Neisseria gonorrhoeae DGI2]
 gi|293398195|ref|ZP_06642400.1| 50S ribosomal protein L16 [Neisseria gonorrhoeae F62]
 gi|304388950|ref|ZP_07370997.1| 50S ribosomal protein L16 [Neisseria meningitidis ATCC 13091]
 gi|75432358|sp|Q5F5T4|RL16_NEIG1 RecName: Full=50S ribosomal protein L16
 gi|81622635|sp|Q9JR26|RL16_NEIMA RecName: Full=50S ribosomal protein L16
 gi|81707283|sp|Q7DDT4|RL16_NEIMB RecName: Full=50S ribosomal protein L16
 gi|166199692|sp|A1KRI0|RL16_NEIMF RecName: Full=50S ribosomal protein L16
 gi|189041470|sp|A9M3V9|RL16_NEIM0 RecName: Full=50S ribosomal protein L16
 gi|7225367|gb|AAF40607.1| 50S ribosomal protein L16 [Neisseria meningitidis MC58]
 gi|59719048|gb|AAW90453.1| 50S ribosomal protein L16 [Neisseria gonorrhoeae FA 1090]
 gi|120865729|emb|CAM09458.1| 50S ribosomal protein L16 [Neisseria meningitidis FAM18]
 gi|121051169|emb|CAM07440.1| 50S ribosomal protein L16 [Neisseria meningitidis Z2491]
 gi|161596461|gb|ABX74121.1| 50S ribosomal protein L16 [Neisseria meningitidis 053442]
 gi|226513754|gb|EEH63099.1| 50S ribosomal protein L16 [Neisseria gonorrhoeae 1291]
 gi|254669349|emb|CBA08426.1| 50S ribosomal protein L16 [Neisseria meningitidis alpha14]
 gi|254670748|emb|CBA06993.1| 50S ribosomal protein L16 [Neisseria meningitidis alpha153]
 gi|254672678|emb|CBA06545.1| 50S ribosomal protein L16 [Neisseria meningitidis alpha275]
 gi|261391685|emb|CAX49134.1| 50S ribosomal protein L16 [Neisseria meningitidis 8013]
 gi|268547172|gb|EEZ42590.1| 50S ribosomal protein L16 [Neisseria gonorrhoeae 35/02]
 gi|268551566|gb|EEZ46585.1| 50S ribosomal protein L16 [Neisseria gonorrhoeae FA19]
 gi|268584154|gb|EEZ48830.1| 50S ribosomal protein L16 [Neisseria gonorrhoeae MS11]
 gi|268586492|gb|EEZ51168.1| 50S ribosomal protein L16 [Neisseria gonorrhoeae PID18]
 gi|268588755|gb|EEZ53431.1| 50S ribosomal protein L16 [Neisseria gonorrhoeae PID1]
 gi|268623366|gb|EEZ55766.1| 50S ribosomal protein L16 [Neisseria gonorrhoeae PID332]
 gi|268623536|gb|EEZ55936.1| 50S ribosomal protein L16 [Neisseria gonorrhoeae SK-92-679]
 gi|291013218|gb|EFE05184.1| 50S ribosomal protein L16 [Neisseria gonorrhoeae DGI2]
 gi|291611458|gb|EFF40528.1| 50S ribosomal protein L16 [Neisseria gonorrhoeae F62]
 gi|304337084|gb|EFM03271.1| 50S ribosomal protein L16 [Neisseria meningitidis ATCC 13091]
 gi|308388365|gb|ADO30685.1| 50S ribosomal protein L16 [Neisseria meningitidis alpha710]
 gi|319411367|emb|CBY91778.1| 50S ribosomal protein L16 [Neisseria meningitidis WUE 2594]
 gi|325129068|gb|EGC51917.1| ribosomal protein L16 [Neisseria meningitidis N1568]
 gi|325131091|gb|EGC53814.1| ribosomal protein L16 [Neisseria meningitidis OX99.30304]
 gi|325133061|gb|EGC55733.1| ribosomal protein L16 [Neisseria meningitidis M6190]
 gi|325135155|gb|EGC57781.1| ribosomal protein L16 [Neisseria meningitidis M13399]
 gi|325137207|gb|EGC59802.1| ribosomal protein L16 [Neisseria meningitidis M0579]
 gi|325139039|gb|EGC61585.1| ribosomal protein L16 [Neisseria meningitidis ES14902]
 gi|325141163|gb|EGC63663.1| ribosomal protein L16 [Neisseria meningitidis CU385]
 gi|325143239|gb|EGC65578.1| ribosomal protein L16 [Neisseria meningitidis 961-5945]
 gi|325145346|gb|EGC67623.1| ribosomal protein L16 [Neisseria meningitidis M01-240013]
 gi|325197436|gb|ADY92892.1| ribosomal protein L16 [Neisseria meningitidis G2136]
 gi|325199362|gb|ADY94817.1| ribosomal protein L16 [Neisseria meningitidis H44/76]
 gi|325203016|gb|ADY98470.1| ribosomal protein L16 [Neisseria meningitidis M01-240149]
 gi|325203269|gb|ADY98722.1| ribosomal protein L16 [Neisseria meningitidis M01-240355]
 gi|325205242|gb|ADZ00695.1| ribosomal protein L16 [Neisseria meningitidis M04-240196]
 gi|325207185|gb|ADZ02637.1| ribosomal protein L16 [Neisseria meningitidis NZ-05/33]
          Length = 138

 Score =  187 bits (477), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 74/136 (54%), Positives = 98/136 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QP   KY KQ KGR  G+A  G+++ FG F LKA    R+ + +IEAARRA++R +KR
Sbjct: 1   MLQPTRLKYRKQQKGRNTGIATRGNKVSFGEFGLKAVGRGRLTARQIEAARRAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI VFPD P+T KP +VRMG GKGNVE ++  +KPG++L+E+DGV EE+AR AF L
Sbjct: 61  GGRIWIRVFPDKPITEKPIQVRMGGGKGNVEYYIAEIKPGKVLYEMDGVPEELAREAFEL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + T F+ R V
Sbjct: 121 AAAKLPIPTTFVVRQV 136


>gi|323344643|ref|ZP_08084867.1| 50S ribosomal protein L16 [Prevotella oralis ATCC 33269]
 gi|323093913|gb|EFZ36490.1| 50S ribosomal protein L16 [Prevotella oralis ATCC 33269]
          Length = 142

 Score =  187 bits (477), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 73/135 (54%), Positives = 94/135 (69%), Gaps = 1/135 (0%)

Query: 2   LRQPKNTKYPKQFKGR-IKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMK 60
           + QPK  KY +   GR  KG A  G+++ FG+F +K  EA  I S +IEAAR A++R M+
Sbjct: 1   MLQPKRVKYRRPQDGRGNKGNASRGTQLAFGSFGIKTLEAKWIDSRQIEAARVAVNRYMQ 60

Query: 61  RAGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFR 120
           R G+VWI +FPD P+T KP +VRMGKGKG+   WV  V PGRILFE++GVS +VA+ A R
Sbjct: 61  REGQVWIRIFPDKPITRKPADVRMGKGKGDPAGWVAPVTPGRILFEVEGVSFDVAKEALR 120

Query: 121 LGAAKLSVVTKFIQR 135
           L A KL V TKF+ R
Sbjct: 121 LAAQKLPVKTKFVVR 135


>gi|11467724|ref|NP_050776.1| ribosomal protein L16 [Guillardia theta]
 gi|3914647|sp|O46901|RK16_GUITH RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|3603049|gb|AAC35710.1| ribosomal protein L16 [Guillardia theta]
          Length = 134

 Score =  187 bits (477), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 66/134 (49%), Positives = 92/134 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ K  +GR++G+A  G+ + FG++ L+A E   + S +IEA RR I+R +KR
Sbjct: 1   MLSPKRTKFRKPHRGRLRGIATRGNTLIFGDYGLQALEPIWLTSRQIEATRRTITRQVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI VFPD  ++AKP E RMG GKG  E WV  +KPG ILFEI+GVS+++   AF+ 
Sbjct: 61  VGRLWIRVFPDKSISAKPPETRMGAGKGAPEYWVAVIKPGHILFEINGVSQDLRYLAFKN 120

Query: 122 GAAKLSVVTKFIQR 135
            + KL + TKFI R
Sbjct: 121 ASYKLPIKTKFISR 134


>gi|260577174|ref|ZP_05845151.1| ribosomal protein L16 [Rhodobacter sp. SW2]
 gi|259020648|gb|EEW23967.1| ribosomal protein L16 [Rhodobacter sp. SW2]
          Length = 137

 Score =  187 bits (477), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 87/135 (64%), Positives = 104/135 (77%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQFKGRI G AKGG  + FG F LKA E  R+ + +IEAARRAI+R MKR
Sbjct: 1   MLQPKRTKFRKQFKGRIHGEAKGGFLLNFGTFGLKATEPERVTARQIEAARRAITRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPDVPV++KPTEVRMGKGKG+ + W  +VKPGRI+FEIDGV+E VAR A RL
Sbjct: 61  QGRVWIRIFPDVPVSSKPTEVRMGKGKGSTDYWAAKVKPGRIMFEIDGVAEAVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
           GA KL V T+ + R 
Sbjct: 121 GAMKLPVTTRVVIRE 135


>gi|217967376|ref|YP_002352882.1| 50S ribosomal protein L16 [Dictyoglomus turgidum DSM 6724]
 gi|217336475|gb|ACK42268.1| ribosomal protein L16 [Dictyoglomus turgidum DSM 6724]
          Length = 139

 Score =  187 bits (477), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 66/136 (48%), Positives = 91/136 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY KQ +GR+KG A  G+R+ FG++ ++A     I S +IEA RR ++R   +
Sbjct: 1   MLMPKRVKYRKQHRGRMKGKASRGNRVVFGDYGIQALAPAWITSEQIEAVRRTLTRHAGK 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPD  VTA+P E RMG GKG+V+ WV  VKPG ILFEI GVS+E+A  A R+
Sbjct: 61  NGRVWIRIFPDKSVTARPAESRMGGGKGDVKGWVAVVKPGTILFEIGGVSKEIAMEAIRI 120

Query: 122 GAAKLSVVTKFIQRVV 137
             +KL + T+ + R +
Sbjct: 121 AGSKLPIKTRLVTREI 136


>gi|284040614|ref|YP_003390544.1| ribosomal protein L16 [Spirosoma linguale DSM 74]
 gi|283819907|gb|ADB41745.1| ribosomal protein L16 [Spirosoma linguale DSM 74]
          Length = 143

 Score =  187 bits (477), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 74/134 (55%), Positives = 89/134 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQ KGRI G+A  G  I FG F +K+ E  RI + +IEAAR +++R MKR
Sbjct: 1   MLQPKRTKFRKQHKGRIPGIASRGHEIAFGTFGIKSLEPGRITARQIEAARISVTRAMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T KP EVRMGKGKG  E WV  VKPG I+FE  GV       A RL
Sbjct: 61  EGQVWIRIFPDKPITKKPAEVRMGKGKGAPEYWVAVVKPGTIMFETTGVDLATGMEALRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL V TKF+ R
Sbjct: 121 AAQKLPVRTKFVVR 134


>gi|108797993|ref|YP_638190.1| 50S ribosomal protein L16 [Mycobacterium sp. MCS]
 gi|119867089|ref|YP_937041.1| 50S ribosomal protein L16 [Mycobacterium sp. KMS]
 gi|126433655|ref|YP_001069346.1| 50S ribosomal protein L16 [Mycobacterium sp. JLS]
 gi|123070586|sp|Q1BDA0|RL16_MYCSS RecName: Full=50S ribosomal protein L16
 gi|166199687|sp|A3PVC8|RL16_MYCSJ RecName: Full=50S ribosomal protein L16
 gi|166199688|sp|A1UBP3|RL16_MYCSK RecName: Full=50S ribosomal protein L16
 gi|108768412|gb|ABG07134.1| LSU ribosomal protein L16P [Mycobacterium sp. MCS]
 gi|119693178|gb|ABL90251.1| LSU ribosomal protein L16P [Mycobacterium sp. KMS]
 gi|126233455|gb|ABN96855.1| LSU ribosomal protein L16P [Mycobacterium sp. JLS]
          Length = 138

 Score =  187 bits (477), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 59/135 (43%), Positives = 85/135 (62%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  K+ KQ   R +G+A GG+ + FG++ ++A E   I + +IE+AR AI+R +KR
Sbjct: 1   MLIPRKVKHRKQHHPRQRGIASGGTTVSFGDYGIQALEHAYITNRQIESARIAINRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T KP E RMG GKG+ E WV  VKPGR+LFE+    E+ AR A   
Sbjct: 61  GGKVWINIFPDRPLTKKPAETRMGSGKGSPEWWVANVKPGRVLFELSYPDEKTARDALTR 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  + + R 
Sbjct: 121 AIHKLPIKARIVTRE 135


>gi|114329785|ref|YP_740603.1| ribosomal protein L16 [Platanus occidentalis]
 gi|122166000|sp|Q09G08|RK16_PLAOC RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|114054423|gb|ABI49817.1| ribosomal protein L16 [Platanus occidentalis]
          Length = 135

 Score =  187 bits (477), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 67/132 (50%), Positives = 96/132 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+RI FG +AL+A E   I S +IEA RRA++R  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGISYRGNRISFGRYALRALEPAWITSRQIEAGRRAMTRYARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +PTE RMG GKG+ E WV  VKPGRIL+E+ G+SE VAR A  +
Sbjct: 61  GGKIWVRIFPDKPVTVRPTETRMGSGKGSPEYWVSVVKPGRILYEMGGISEIVAREAISI 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+F+
Sbjct: 121 AASKMPIRTQFV 132


>gi|295398295|ref|ZP_06808337.1| 50S ribosomal protein L16 [Aerococcus viridans ATCC 11563]
 gi|294973434|gb|EFG49219.1| 50S ribosomal protein L16 [Aerococcus viridans ATCC 11563]
          Length = 142

 Score =  187 bits (477), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 65/136 (47%), Positives = 92/136 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ ++F+G+++G AKGG  I +G F L+A ++  I + +IEA+R A++R MKR
Sbjct: 1   MLVPKRVKHRREFRGKMRGEAKGGKEIAYGEFGLQALDSAWITNRQIEASRIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP    TAK   VRMG GKG  E WV  VK G+ILFE+ GV EEVA+ A RL
Sbjct: 61  GGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVSPVKRGKILFEVAGVPEEVAKEALRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            + KL + TK ++R +
Sbjct: 121 ASHKLPIRTKIVKREI 136


>gi|168492169|ref|ZP_02716312.1| ribosomal protein L16 [Streptococcus pneumoniae CDC0288-04]
 gi|183573564|gb|EDT94092.1| ribosomal protein L16 [Streptococcus pneumoniae CDC0288-04]
          Length = 137

 Score =  187 bits (477), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 67/137 (48%), Positives = 93/137 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ ++F+G+++G AKGG  + FG + L+A  ++ I + +IEAAR A++R MKR
Sbjct: 1   MLVPKRVKHRREFRGKMRGEAKGGKEVAFGEYGLQATTSHWITNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP    TAK   VRMG GKG  E WV  VK G+++FEI GVSEE+AR A RL
Sbjct: 61  GGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVAPVKCGKVMFEIAGVSEEIAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            + KL V  KF++R  E
Sbjct: 121 ASHKLPVKCKFVKREAE 137


>gi|294786418|ref|ZP_06751672.1| ribosomal protein L16 [Parascardovia denticolens F0305]
 gi|315225980|ref|ZP_07867768.1| 50S ribosomal protein L16 [Parascardovia denticolens DSM 10105]
 gi|294485251|gb|EFG32885.1| ribosomal protein L16 [Parascardovia denticolens F0305]
 gi|315120112|gb|EFT83244.1| 50S ribosomal protein L16 [Parascardovia denticolens DSM 10105]
          Length = 139

 Score =  187 bits (477), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 63/135 (46%), Positives = 86/135 (63%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY KQ +   +G++KGG+ I FG+F ++A     + + +IEAAR A++R +KR
Sbjct: 1   MLIPKRVKYRKQQRPARRGMSKGGNEINFGDFGIQALAPAYVTNRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPD P+T  P   RMG GKG  E W+  V PGR++FEI GVSE+VAR A R 
Sbjct: 61  GGRVWITIFPDRPLTKHPLGSRMGSGKGAPEFWIANVHPGRVMFEISGVSEDVAREALRR 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  + I R 
Sbjct: 121 AIDKLPMKCRIIARE 135


>gi|291514950|emb|CBK64160.1| LSU ribosomal protein L16P [Alistipes shahii WAL 8301]
          Length = 142

 Score =  187 bits (477), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 76/134 (56%), Positives = 100/134 (74%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ +  KGR+KG+A+ G+++ +G+FA+KA E+  I   +IEAAR+AI+R MKR
Sbjct: 1   MLQPKKTKFRRMQKGRMKGIAQRGNQLAYGSFAIKALESTWITGRQIEAARQAITRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T KP EVRMGKGKGN E +V  V PGRILFE +GV   VA+ A RL
Sbjct: 61  EGQLWIRIFPDKPITKKPAEVRMGKGKGNPEGFVAPVTPGRILFEAEGVPLAVAQEALRL 120

Query: 122 GAAKLSVVTKFIQR 135
           GA KL + TKFI R
Sbjct: 121 GAQKLPITTKFIVR 134


>gi|53803418|ref|YP_114781.1| 50S ribosomal protein L16 [Methylococcus capsulatus str. Bath]
 gi|81681361|sp|Q605B9|RL16_METCA RecName: Full=50S ribosomal protein L16
 gi|53757179|gb|AAU91470.1| ribosomal protein L16 [Methylococcus capsulatus str. Bath]
          Length = 137

 Score =  187 bits (477), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 82/136 (60%), Positives = 99/136 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TKY KQ KGR  GVA  GS++ FG + LKA    RI + +IEAARR ISR +KR
Sbjct: 1   MLQPKRTKYRKQHKGRNTGVAIAGSKVSFGEYGLKATTRGRITARQIEAARRTISRHVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD PV+ KP EVRMG GKG+VE WV  +KPG +L+E++GVSEE+AR AFRL
Sbjct: 61  GGKIWIRVFPDKPVSKKPLEVRMGSGKGSVEFWVAEIKPGTMLYELEGVSEELAREAFRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL V T F  R V
Sbjct: 121 AAAKLPVQTTFSLRTV 136


>gi|269796248|ref|YP_003315703.1| 50S ribosomal protein L16P [Sanguibacter keddieii DSM 10542]
 gi|269098433|gb|ACZ22869.1| LSU ribosomal protein L16P [Sanguibacter keddieii DSM 10542]
          Length = 139

 Score =  187 bits (477), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 61/135 (45%), Positives = 86/135 (63%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  K+ KQ      G A GG+ I FG + ++A E   + + +IEAAR A++R +KR
Sbjct: 1   MLIPRRLKHRKQHHPGRSGAATGGTTIAFGEYGIQALEPAYVTNRQIEAARIAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI ++PD P+T KP E RMG GKG+ E W+  VKPGRI+FE+ GV EE+AR A R 
Sbjct: 61  GGKVWINIYPDRPLTKKPAETRMGSGKGSPEWWIANVKPGRIVFELAGVPEELAREAMRR 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  +F+ R 
Sbjct: 121 AIHKLPMKCRFVVRE 135


>gi|291457209|ref|ZP_06596599.1| ribosomal protein L16 [Bifidobacterium breve DSM 20213]
 gi|291381044|gb|EFE88562.1| ribosomal protein L16 [Bifidobacterium breve DSM 20213]
          Length = 139

 Score =  187 bits (477), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 64/135 (47%), Positives = 87/135 (64%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY KQ +    G++KGG+ I FG+F ++A     + + +IEAAR A++R +KR
Sbjct: 1   MLIPKRTKYRKQHRPVRSGMSKGGNEINFGDFGIQALAPAYVTNRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPD P+T  P   RMG GKG  E W+  V+PGR++FEI GVSE+VAR A R 
Sbjct: 61  GGRVWITIFPDRPLTKHPLGARMGSGKGAPEFWIANVRPGRVMFEIGGVSEDVAREALRR 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  + I R 
Sbjct: 121 AIDKLPMKCRIIARE 135


>gi|218885194|ref|YP_002434515.1| 50S ribosomal protein L16 [Desulfovibrio vulgaris str. 'Miyazaki
           F']
 gi|226710715|sp|B8DNA3|RL16_DESVM RecName: Full=50S ribosomal protein L16
 gi|218756148|gb|ACL07047.1| ribosomal protein L16 [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 137

 Score =  187 bits (477), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 64/135 (47%), Positives = 86/135 (63%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  K+ K  KGR++G+A  G+ + FG+  LKA E  ++ S +IEAAR A+ R +KR
Sbjct: 1   MLSPRKVKFRKWQKGRLRGMATRGATVSFGDIGLKAVEHGKLSSQQIEAARIAMMRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVTAKP E R G GKG    W   VKPGR+L+EI GVS E+A+ A   
Sbjct: 61  GGKVWIRIFPDHPVTAKPLETRQGSGKGAPVGWCAPVKPGRVLYEIKGVSLELAKEALTR 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL + T  + R 
Sbjct: 121 AAHKLPIKTTIVVRE 135


>gi|240167710|ref|ZP_04746369.1| 50S ribosomal protein L16 [Mycobacterium kansasii ATCC 12478]
          Length = 138

 Score =  187 bits (477), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 59/135 (43%), Positives = 86/135 (63%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  K+ KQ   R +G+A GG+ + FG++ ++A E   + + +IE+AR AI+R +KR
Sbjct: 1   MLIPRKVKHRKQHHPRQRGIASGGTTVNFGDYGIQALEHAYVTNRQIESARIAINRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T KP E RMG GKG+ E WV  VKPGR+LFE+   +E +AR A   
Sbjct: 61  GGKVWINIFPDRPLTKKPAETRMGSGKGSPEWWVANVKPGRVLFELSYPNEAIARAALTR 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  + I R 
Sbjct: 121 AIHKLPIKARIITRE 135


>gi|229818233|ref|ZP_04448515.1| hypothetical protein BIFANG_03531 [Bifidobacterium angulatum DSM
           20098]
 gi|229784484|gb|EEP20598.1| hypothetical protein BIFANG_03531 [Bifidobacterium angulatum DSM
           20098]
          Length = 139

 Score =  187 bits (477), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 63/135 (46%), Positives = 85/135 (62%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY KQ +    G++KGG+ I FG+F ++A     + + +IEAAR A++R +KR
Sbjct: 1   MLIPKRTKYRKQHRPVRTGMSKGGNEINFGDFGIQALAPAYVTNRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPD P+T      RMG GKG  E WV  + PGR++FEI GVSE+VAR A R 
Sbjct: 61  GGRVWITIFPDRPLTKHALGARMGSGKGAPEFWVANIHPGRVMFEIGGVSEDVAREALRR 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  + I R 
Sbjct: 121 AIDKLPMKCRVIARE 135


>gi|118475204|ref|YP_891251.1| 50S ribosomal protein L16 [Campylobacter fetus subsp. fetus 82-40]
 gi|166234563|sp|A0RM18|RL16_CAMFF RecName: Full=50S ribosomal protein L16
 gi|118414430|gb|ABK82850.1| ribosomal protein L16 [Campylobacter fetus subsp. fetus 82-40]
          Length = 141

 Score =  187 bits (477), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 73/137 (53%), Positives = 91/137 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY K  KGR +G A  G  +  G F LKA EA R+ S +IE+AR+A +R +KR
Sbjct: 1   MLLPKRTKYRKMMKGRNRGYATRGVDLALGEFGLKAVEAGRVNSRQIESARQAYTRHVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
             + WI VFPD P+T KP E RMGKGKG VE+WV  +KPGRI+FE+ GVSEE+AR A  L
Sbjct: 61  QAKTWIRVFPDKPITKKPLETRMGKGKGGVEEWVMNIKPGRIIFEMSGVSEELAREALTL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
              KL   TKF+ +  E
Sbjct: 121 AMHKLPFKTKFVTKESE 137


>gi|194334854|ref|YP_002016714.1| 50S ribosomal protein L16 [Prosthecochloris aestuarii DSM 271]
 gi|226712336|sp|B4S5C1|RL16_PROA2 RecName: Full=50S ribosomal protein L16
 gi|194312672|gb|ACF47067.1| ribosomal protein L16 [Prosthecochloris aestuarii DSM 271]
          Length = 139

 Score =  187 bits (477), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 76/134 (56%), Positives = 94/134 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ K  +G++KG A  G+ + FG +ALKA E   I S +IEAAR A++R MKR
Sbjct: 1   MLMPKRVKHRKVMRGKMKGNAGRGTTVTFGTYALKALEPAWITSRQIEAARVAMNRFMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVT KP E RMG GKGN E WV  VKPGRI+FE +GVS+EVA  AFRL
Sbjct: 61  DGKIWIRIFPDKPVTKKPAETRMGSGKGNPEFWVAVVKPGRIMFEAEGVSQEVATEAFRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + TKFI R
Sbjct: 121 AAKKLPIKTKFIVR 134


>gi|295136916|ref|YP_003587749.1| ribosomal protein L16 [Lathyrus sativus]
 gi|293338638|gb|ADE43610.1| ribosomal protein L16 [Lathyrus sativus]
          Length = 135

 Score =  187 bits (477), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 66/132 (50%), Positives = 97/132 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ K  +G++KG A  G++ICFG +AL+A E   I S ++EA RRA+SR ++R
Sbjct: 1   MLSPKRTRFRKHHRGKLKGNASRGNKICFGKYALQALEPAWITSRQLEAGRRAMSRNVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+C+FPD PVT +PTE RMG GKG+ E WV  VKPG+IL+E+ GV E +AR+A  +
Sbjct: 61  GGQIWVCIFPDKPVTVRPTETRMGSGKGSPEYWVAVVKPGKILYEMGGVPENIARKAISI 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+FI
Sbjct: 121 AASKMPIRTQFI 132


>gi|313884495|ref|ZP_07818256.1| ribosomal protein L16 [Eremococcus coleocola ACS-139-V-Col8]
 gi|312620279|gb|EFR31707.1| ribosomal protein L16 [Eremococcus coleocola ACS-139-V-Col8]
          Length = 144

 Score =  187 bits (476), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 71/135 (52%), Positives = 95/135 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ ++F+G++ G AKGG  + FG++ L+A E+  I + +IEAAR A++R MKR
Sbjct: 1   MLVPKRVKHRREFRGQMNGEAKGGKNVDFGSYGLRAVESKWITNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP    T+KP  VRMG GKG  E WV  VK G+I+FEIDGV EEVAR AFRL
Sbjct: 61  GGKVWIKIFPHKSYTSKPIGVRMGSGKGAPEGWVAPVKRGKIMFEIDGVPEEVAREAFRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL V TKF++R 
Sbjct: 121 ASHKLPVKTKFVKRE 135


>gi|242910188|ref|YP_002970682.1| ribosomal protein L16 [Alsophila spinulosa]
 gi|218454857|gb|ACK77194.1| ribosomal protein L16 [Alsophila spinulosa]
          Length = 137

 Score =  187 bits (476), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 63/133 (47%), Positives = 93/133 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ KQ +GR+KG++  G+ + FG FAL+A E   + + +IEA RRAI+R  +R
Sbjct: 1   MLSPKRTKFRKQHRGRLKGISNRGNTVSFGKFALQALEPAWVTARQIEAGRRAITRCARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T +P E RMG GKG+ E WV  V+PGRI++E+ GVSE+VAR A  +
Sbjct: 61  GGKLWIRIFPDKPITMRPAETRMGSGKGSPEYWVSVVRPGRIIYEVSGVSEDVARAAMGM 120

Query: 122 GAAKLSVVTKFIQ 134
            A K+ + T+ + 
Sbjct: 121 AAHKMPIRTRIVT 133


>gi|262277101|ref|ZP_06054894.1| ribosomal protein L16 [alpha proteobacterium HIMB114]
 gi|262224204|gb|EEY74663.1| ribosomal protein L16 [alpha proteobacterium HIMB114]
          Length = 138

 Score =  187 bits (476), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 74/134 (55%), Positives = 99/134 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QP  TK+ K  KGRIKG A  G+ + FG+  L+A E  R+ S +IEAAR A++R M+R
Sbjct: 1   MLQPSRTKFRKAHKGRIKGKATRGAALNFGSHGLQALEPERVTSRQIEAARVALTRHMQR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVW+ +FP++PV+ KP EVRMGKGKG+ E WV RVKPGR++FEIDGVS+ VA+ +F  
Sbjct: 61  KGRVWLRIFPNIPVSKKPIEVRMGKGKGSPEYWVYRVKPGRVIFEIDGVSDTVAKESFDR 120

Query: 122 GAAKLSVVTKFIQR 135
            A+KL + TK I+R
Sbjct: 121 AASKLPIKTKIIKR 134


>gi|224827024|ref|ZP_03700121.1| ribosomal protein L16 [Lutiella nitroferrum 2002]
 gi|224600690|gb|EEG06876.1| ribosomal protein L16 [Lutiella nitroferrum 2002]
          Length = 138

 Score =  187 bits (476), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 72/136 (52%), Positives = 101/136 (74%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QP   KY KQ KGR  G+A  G+++ FG+F LKA    R+ + +IEAARRA++R +KR
Sbjct: 1   MLQPTRLKYRKQQKGRNTGIATRGNKVSFGDFGLKAIGRGRLTARQIEAARRAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI +FPD P+++KP EVRMG GKG+ E +V  ++PG++L+E+DGV+EE+AR AFRL
Sbjct: 61  GGRIWIRIFPDKPISSKPAEVRMGNGKGSTEYYVAEIQPGKMLYEMDGVAEELAREAFRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + T F+ R V
Sbjct: 121 AAAKLPIPTVFVTRQV 136


>gi|157363449|ref|YP_001470216.1| 50S ribosomal protein L16 [Thermotoga lettingae TMO]
 gi|166983782|sp|A8F4R8|RL16_THELT RecName: Full=50S ribosomal protein L16
 gi|157314053|gb|ABV33152.1| ribosomal protein L16 [Thermotoga lettingae TMO]
          Length = 142

 Score =  187 bits (476), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 70/134 (52%), Positives = 89/134 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY KQ +GR++G AKGG+ + FG + LKA     I + +IEA R AI R MKR
Sbjct: 1   MLMPKRVKYRKQQRGRMRGEAKGGTTVDFGEWGLKALAPAWITAQQIEAGRIAIMRVMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           +G++WI VFPD P T KP E R GKGKGNVE WV  VKPG+I+FEI GV E  A+ A + 
Sbjct: 61  SGKLWIRVFPDKPYTKKPAESRQGKGKGNVEGWVSVVKPGKIIFEIAGVDENTAKEALKY 120

Query: 122 GAAKLSVVTKFIQR 135
            A+K  + TK + R
Sbjct: 121 AASKFPIPTKIVSR 134


>gi|53720814|ref|YP_109800.1| 50S ribosomal protein L16 [Burkholderia pseudomallei K96243]
 gi|53723847|ref|YP_104159.1| 50S ribosomal protein L16 [Burkholderia mallei ATCC 23344]
 gi|76811911|ref|YP_335133.1| 50S ribosomal protein L16 [Burkholderia pseudomallei 1710b]
 gi|83721593|ref|YP_443565.1| 50S ribosomal protein L16 [Burkholderia thailandensis E264]
 gi|121598367|ref|YP_994449.1| 50S ribosomal protein L16 [Burkholderia mallei SAVP1]
 gi|124386480|ref|YP_001027902.1| 50S ribosomal protein L16 [Burkholderia mallei NCTC 10229]
 gi|126441361|ref|YP_001060743.1| 50S ribosomal protein L16 [Burkholderia pseudomallei 668]
 gi|126450976|ref|YP_001082997.1| 50S ribosomal protein L16 [Burkholderia mallei NCTC 10247]
 gi|126451996|ref|YP_001068027.1| 50S ribosomal protein L16 [Burkholderia pseudomallei 1106a]
 gi|134283244|ref|ZP_01769945.1| 50S ribosomal protein L16 [Burkholderia pseudomallei 305]
 gi|167001692|ref|ZP_02267484.1| 50S ribosomal protein L16 [Burkholderia mallei PRL-20]
 gi|167564410|ref|ZP_02357326.1| 50S ribosomal protein L16 [Burkholderia oklahomensis EO147]
 gi|167571556|ref|ZP_02364430.1| 50S ribosomal protein L16 [Burkholderia oklahomensis C6786]
 gi|167582616|ref|ZP_02375490.1| 50S ribosomal protein L16 [Burkholderia thailandensis TXDOH]
 gi|167620730|ref|ZP_02389361.1| 50S ribosomal protein L16 [Burkholderia thailandensis Bt4]
 gi|167721570|ref|ZP_02404806.1| 50S ribosomal protein L16 [Burkholderia pseudomallei DM98]
 gi|167740544|ref|ZP_02413318.1| 50S ribosomal protein L16 [Burkholderia pseudomallei 14]
 gi|167817749|ref|ZP_02449429.1| 50S ribosomal protein L16 [Burkholderia pseudomallei 91]
 gi|167826146|ref|ZP_02457617.1| 50S ribosomal protein L16 [Burkholderia pseudomallei 9]
 gi|167847658|ref|ZP_02473166.1| 50S ribosomal protein L16 [Burkholderia pseudomallei B7210]
 gi|167896230|ref|ZP_02483632.1| 50S ribosomal protein L16 [Burkholderia pseudomallei 7894]
 gi|167904612|ref|ZP_02491817.1| 50S ribosomal protein L16 [Burkholderia pseudomallei NCTC 13177]
 gi|167912877|ref|ZP_02499968.1| 50S ribosomal protein L16 [Burkholderia pseudomallei 112]
 gi|167920837|ref|ZP_02507928.1| 50S ribosomal protein L16 [Burkholderia pseudomallei BCC215]
 gi|217424870|ref|ZP_03456367.1| 50S ribosomal protein L16 [Burkholderia pseudomallei 576]
 gi|226198285|ref|ZP_03793856.1| 50S ribosomal protein L16 [Burkholderia pseudomallei Pakistan 9]
 gi|237814138|ref|YP_002898589.1| ribosomal protein L16 [Burkholderia pseudomallei MSHR346]
 gi|242316790|ref|ZP_04815806.1| 50S ribosomal protein L16 [Burkholderia pseudomallei 1106b]
 gi|254175131|ref|ZP_04881792.1| 50S ribosomal protein L16 [Burkholderia mallei ATCC 10399]
 gi|254180346|ref|ZP_04886944.1| 50S ribosomal protein L16 [Burkholderia pseudomallei 1655]
 gi|254190309|ref|ZP_04896817.1| 50S ribosomal protein L16 [Burkholderia pseudomallei Pasteur 52237]
 gi|254198621|ref|ZP_04905042.1| 50S ribosomal protein L16 [Burkholderia pseudomallei S13]
 gi|254201232|ref|ZP_04907596.1| 50S ribosomal protein L16 [Burkholderia mallei FMH]
 gi|254206573|ref|ZP_04912924.1| 50S ribosomal protein L16 [Burkholderia mallei JHU]
 gi|254259768|ref|ZP_04950822.1| 50S ribosomal protein L16 [Burkholderia pseudomallei 1710a]
 gi|254300583|ref|ZP_04968028.1| 50S ribosomal protein L16 [Burkholderia pseudomallei 406e]
 gi|254357111|ref|ZP_04973385.1| 50S ribosomal protein L16 [Burkholderia mallei 2002721280]
 gi|257137650|ref|ZP_05585912.1| 50S ribosomal protein L16 [Burkholderia thailandensis E264]
 gi|81604184|sp|Q62GL2|RL16_BURMA RecName: Full=50S ribosomal protein L16
 gi|81607671|sp|Q63Q18|RL16_BURPS RecName: Full=50S ribosomal protein L16
 gi|115502736|sp|Q3JMS0|RL16_BURP1 RecName: Full=50S ribosomal protein L16
 gi|115502738|sp|Q2SU34|RL16_BURTA RecName: Full=50S ribosomal protein L16
 gi|166234554|sp|A3MRW1|RL16_BURM7 RecName: Full=50S ribosomal protein L16
 gi|166234555|sp|A2S7I3|RL16_BURM9 RecName: Full=50S ribosomal protein L16
 gi|166234556|sp|A1V896|RL16_BURMS RecName: Full=50S ribosomal protein L16
 gi|166234557|sp|A3P0A6|RL16_BURP0 RecName: Full=50S ribosomal protein L16
 gi|166234558|sp|A3NEH2|RL16_BURP6 RecName: Full=50S ribosomal protein L16
 gi|52211228|emb|CAH37217.1| 50S ribosomal protein L16 [Burkholderia pseudomallei K96243]
 gi|52427270|gb|AAU47863.1| ribosomal protein L16 [Burkholderia mallei ATCC 23344]
 gi|76581364|gb|ABA50839.1| ribosomal protein L16 [Burkholderia pseudomallei 1710b]
 gi|83655418|gb|ABC39481.1| ribosomal protein L16 [Burkholderia thailandensis E264]
 gi|121227177|gb|ABM49695.1| 50S ribosomal protein L16 [Burkholderia mallei SAVP1]
 gi|124294500|gb|ABN03769.1| 50S ribosomal protein L16 [Burkholderia mallei NCTC 10229]
 gi|126220854|gb|ABN84360.1| 50S ribosomal protein L16 [Burkholderia pseudomallei 668]
 gi|126225638|gb|ABN89178.1| 50S ribosomal protein L16 [Burkholderia pseudomallei 1106a]
 gi|126243846|gb|ABO06939.1| 50S ribosomal protein L16 [Burkholderia mallei NCTC 10247]
 gi|134245439|gb|EBA45532.1| 50S ribosomal protein L16 [Burkholderia pseudomallei 305]
 gi|147747126|gb|EDK54202.1| 50S ribosomal protein L16 [Burkholderia mallei FMH]
 gi|147752115|gb|EDK59181.1| 50S ribosomal protein L16 [Burkholderia mallei JHU]
 gi|148026175|gb|EDK84260.1| 50S ribosomal protein L16 [Burkholderia mallei 2002721280]
 gi|157810639|gb|EDO87809.1| 50S ribosomal protein L16 [Burkholderia pseudomallei 406e]
 gi|157937985|gb|EDO93655.1| 50S ribosomal protein L16 [Burkholderia pseudomallei Pasteur 52237]
 gi|160696176|gb|EDP86146.1| 50S ribosomal protein L16 [Burkholderia mallei ATCC 10399]
 gi|169655361|gb|EDS88054.1| 50S ribosomal protein L16 [Burkholderia pseudomallei S13]
 gi|184210885|gb|EDU07928.1| 50S ribosomal protein L16 [Burkholderia pseudomallei 1655]
 gi|217392326|gb|EEC32351.1| 50S ribosomal protein L16 [Burkholderia pseudomallei 576]
 gi|225929805|gb|EEH25821.1| 50S ribosomal protein L16 [Burkholderia pseudomallei Pakistan 9]
 gi|237504764|gb|ACQ97082.1| ribosomal protein L16 [Burkholderia pseudomallei MSHR346]
 gi|242140029|gb|EES26431.1| 50S ribosomal protein L16 [Burkholderia pseudomallei 1106b]
 gi|243062589|gb|EES44775.1| 50S ribosomal protein L16 [Burkholderia mallei PRL-20]
 gi|254218457|gb|EET07841.1| 50S ribosomal protein L16 [Burkholderia pseudomallei 1710a]
          Length = 138

 Score =  187 bits (476), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 74/135 (54%), Positives = 98/135 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK  KY K+ KGR  G+A  G+ + FG F LKA    R+ + +IEAARRA++R +KR
Sbjct: 1   MLQPKRRKYRKEQKGRNTGIATRGNAVSFGEFGLKAVGRGRLTARQIEAARRAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI +FPD P++ KP EVRMG GKGN E +V  ++PG++L+E+DGVSEE+AR AFRL
Sbjct: 61  GGRIWIRIFPDKPISQKPAEVRMGNGKGNPEYYVAEIQPGKMLYEMDGVSEELAREAFRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            AAKL + T FI R 
Sbjct: 121 AAAKLPLKTTFIVRQ 135


>gi|158520732|ref|YP_001528602.1| 50S ribosomal protein L16 [Desulfococcus oleovorans Hxd3]
 gi|226710714|sp|A8ZV64|RL16_DESOH RecName: Full=50S ribosomal protein L16
 gi|158509558|gb|ABW66525.1| ribosomal protein L16 [Desulfococcus oleovorans Hxd3]
          Length = 137

 Score =  187 bits (476), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 72/135 (53%), Positives = 92/135 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQ +GR  G    GS + FG F L+A E   I + +IEAAR A++R +KR
Sbjct: 1   MLSPKKVKFRKQQRGRRTGTRLAGSTLSFGEFGLQATECGMITARQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AG+ WI +FPD P T KP EVRMGKGKG  E W   ++PGRIL+E+DGV +E+AR AFRL
Sbjct: 61  AGKTWIRIFPDKPFTKKPAEVRMGKGKGAPEGWAAVIRPGRILYEMDGVPDELAREAFRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL V TKF++R 
Sbjct: 121 AAHKLPVKTKFVKRE 135


>gi|296936709|gb|ADH94381.1| ribosomal protein L16 [Syzygium cumini]
          Length = 135

 Score =  187 bits (476), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 67/131 (51%), Positives = 98/131 (74%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+RICFG +AL+A E   I S +IEA RRA++R ++R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGISYRGNRICFGKYALQALEPAWITSRQIEAGRRAMTRNVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +PTE RMG GKG+ E WV  VKPGRIL+E+ GV+E +AR+A  +
Sbjct: 61  GGKIWVRIFPDKPVTVRPTETRMGSGKGSPEYWVAVVKPGRILYEMGGVAENIARKAISI 120

Query: 122 GAAKLSVVTKF 132
            A+K+ + T+F
Sbjct: 121 AASKMPIRTQF 131


>gi|197131812|gb|ACH47424.1| ribosomal protein L16 [Erodium chrysanthum]
          Length = 137

 Score =  187 bits (476), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 66/137 (48%), Positives = 95/137 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ K+ +GR++GVA  GS I FG +AL+A E   I S +IEA RRA++R ++R
Sbjct: 1   MLSPKRTKFRKEQRGRMRGVASRGSCISFGRYALQALEPAWITSRQIEAGRRAMTRNVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +  E RMG GKG+ E WV  VKPGRIL+E+ GV+E +AR+A  +
Sbjct: 61  GGKIWVRIFPDKPVTVRSAETRMGSGKGSPEYWVAVVKPGRILYEMGGVAENIARKAIAI 120

Query: 122 GAAKLSVVTKFIQRVVE 138
             +K+ + T+FI    E
Sbjct: 121 AGSKMPIRTQFIISDSE 137


>gi|118616578|ref|YP_904910.1| 50S ribosomal protein L16 [Mycobacterium ulcerans Agy99]
 gi|183981060|ref|YP_001849351.1| 50S ribosomal protein L16, RplP [Mycobacterium marinum M]
 gi|166199690|sp|A0PM70|RL16_MYCUA RecName: Full=50S ribosomal protein L16
 gi|226712326|sp|B2HSN8|RL16_MYCMM RecName: Full=50S ribosomal protein L16
 gi|118568688|gb|ABL03439.1| 50S ribosomal protein L16, RplP [Mycobacterium ulcerans Agy99]
 gi|183174386|gb|ACC39496.1| 50S ribosomal protein L16, RplP [Mycobacterium marinum M]
          Length = 138

 Score =  187 bits (476), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 59/135 (43%), Positives = 86/135 (63%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  K+ KQ   R +G+A GG+ + FG++ ++A E   + + +IE+AR AI+R +KR
Sbjct: 1   MLIPRKVKHRKQHHPRQRGIASGGTSVNFGDYGIQALEHAYVTNRQIESARIAINRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T KP E RMG GKG+ E WV  VKPGR+LFE+   +E +AR A   
Sbjct: 61  GGKVWINIFPDRPLTKKPAETRMGSGKGSPEWWVANVKPGRVLFELSYPNEAIARAALTR 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  + I R 
Sbjct: 121 AIHKLPIKARIITRE 135


>gi|262400786|gb|ACY66275.1| ribosomal protein L16 [Brassica napus]
          Length = 137

 Score =  187 bits (476), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 66/134 (49%), Positives = 96/134 (71%), Gaps = 2/134 (1%)

Query: 2   LRQ--PKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGM 59
           +    PK TK+ KQ +GR+KG++  G+RICFG +AL+  E   I S +IEA RRA++R +
Sbjct: 1   MLSYNPKRTKFRKQHRGRLKGISSRGNRICFGRYALQTLEPAWITSRQIEAGRRAMTRNI 60

Query: 60  KRAGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAF 119
           +R G++W+ +FPD PVT +P E RMG GKG+ E WV  VKPG+IL+E+ GV E +AR+A 
Sbjct: 61  RRGGKIWVRIFPDKPVTVRPAETRMGSGKGSPEYWVAVVKPGKILYEMGGVPENIARKAI 120

Query: 120 RLGAAKLSVVTKFI 133
            + A+K+ + T+FI
Sbjct: 121 SIAASKMPIKTQFI 134


>gi|114329692|ref|YP_740513.1| ribosomal protein L16 [Citrus sinensis]
 gi|122166146|sp|Q09ME0|RK16_CITSI RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|113952658|gb|ABI49056.1| ribosomal protein L16 [Citrus sinensis]
          Length = 136

 Score =  187 bits (476), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 67/133 (50%), Positives = 98/133 (73%), Gaps = 1/133 (0%)

Query: 2   LRQ-PKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMK 60
           +   PK T++ KQ +GR+KG++  G+ ICFG +AL+A E   I S +IEA RRA++R ++
Sbjct: 1   MLSNPKRTRFRKQHRGRMKGISYRGNHICFGRYALQALEPAWITSRQIEAGRRAMTRNVR 60

Query: 61  RAGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFR 120
           R G++W+ +FPD PVT +PTE RMG GKG+ E WV  VKPGRIL+E+ GV+E +AR+A  
Sbjct: 61  RGGKIWVRIFPDKPVTLRPTETRMGSGKGSPEYWVAVVKPGRILYEMSGVAENIARKAIS 120

Query: 121 LGAAKLSVVTKFI 133
           + A+K+ + T+FI
Sbjct: 121 IAASKMPIRTQFI 133


>gi|91786174|ref|YP_547126.1| 50S ribosomal protein L16 [Polaromonas sp. JS666]
 gi|122968309|sp|Q12GW4|RL16_POLSJ RecName: Full=50S ribosomal protein L16
 gi|91695399|gb|ABE42228.1| LSU ribosomal protein L16P [Polaromonas sp. JS666]
          Length = 138

 Score =  187 bits (476), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 74/136 (54%), Positives = 98/136 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QP   KY K+ KGR  GVA  G+ + FG+F LK  +  R+ + +IEAARRAISR +KR
Sbjct: 1   MLQPARRKYRKEQKGRNTGVATRGNSVAFGDFGLKCTDRGRLTARQIEAARRAISRHVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI VFPD P++ KP EVRMG GKGN E +V  ++PG+I+FEI GV EE+AR AFRL
Sbjct: 61  GGRIWIRVFPDKPISQKPAEVRMGNGKGNPEYYVAEIQPGKIVFEIVGVPEELAREAFRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            +AKL + T F+ R++
Sbjct: 121 ASAKLPLRTTFVSRMI 136


>gi|103488288|ref|YP_617849.1| 50S ribosomal protein L16 [Sphingopyxis alaskensis RB2256]
 gi|115502794|sp|Q1GPA6|RL16_SPHAL RecName: Full=50S ribosomal protein L16
 gi|98978365|gb|ABF54516.1| LSU ribosomal protein L16P [Sphingopyxis alaskensis RB2256]
          Length = 143

 Score =  187 bits (476), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 83/137 (60%), Positives = 101/137 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K FKGRI G AKGG+ + FG++ LKA E  RI + +IEAARRAISR +KR
Sbjct: 1   MLQPKKTKFRKAFKGRIHGNAKGGTSLNFGSYGLKAMEPERITARQIEAARRAISRAIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI +FPDVPV++KP EVRMGKGKG+ E W  RVKPGRILFE+DGV   VA  AF  
Sbjct: 61  QGRLWIRIFPDVPVSSKPAEVRMGKGKGSPEYWAARVKPGRILFELDGVPGPVAALAFER 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            A KL + TK I R+ +
Sbjct: 121 AAMKLPIKTKVIARLGD 137


>gi|288925708|ref|ZP_06419640.1| ribosomal protein L16 [Prevotella buccae D17]
 gi|315606497|ref|ZP_07881512.1| 50S ribosomal protein L16 [Prevotella buccae ATCC 33574]
 gi|288337646|gb|EFC76000.1| ribosomal protein L16 [Prevotella buccae D17]
 gi|315251903|gb|EFU31877.1| 50S ribosomal protein L16 [Prevotella buccae ATCC 33574]
          Length = 142

 Score =  187 bits (476), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 72/135 (53%), Positives = 93/135 (68%), Gaps = 1/135 (0%)

Query: 2   LRQPKNTKYPKQFKGR-IKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMK 60
           + QPK  KY +   GR  KG A  G+++ FG+F +K  EA  I S +IEAAR A++R M 
Sbjct: 1   MLQPKRVKYRRPQDGRGNKGNAHRGTQLAFGSFGIKTLEAKWIDSRQIEAARVAVNRYMN 60

Query: 61  RAGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFR 120
           R G+VWI +FPD P+T KP +VRMGKGKG+   WV  V PGRILFE++GVS ++A+ A R
Sbjct: 61  REGQVWIRIFPDKPITRKPADVRMGKGKGDPAGWVAPVTPGRILFEVEGVSFDIAKEALR 120

Query: 121 LGAAKLSVVTKFIQR 135
           L A KL V TKF+ R
Sbjct: 121 LAAQKLPVKTKFVVR 135


>gi|116617145|ref|YP_817520.1| ribosomal protein L16 [Coffea arabica]
 gi|122153657|sp|A0A373|RK16_COFAR RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|116242201|gb|ABJ89716.1| ribosomal protein L16 [Coffea arabica]
          Length = 135

 Score =  187 bits (476), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 69/132 (52%), Positives = 99/132 (75%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+RICFG FAL+A E   I S +IEA RRA++R ++R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGISYRGNRICFGKFALQALEPAWITSRQIEAGRRAMTRNVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD P+TA+P E RMG GKG+ E WV  VKPGRIL+E+ GV+E +ARRA  +
Sbjct: 61  GGKIWVRIFPDKPITARPAETRMGSGKGSPEYWVAVVKPGRILYEMGGVTEHIARRAISI 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+FI
Sbjct: 121 AASKMPIRTQFI 132


>gi|325282647|ref|YP_004255188.1| 50S ribosomal protein L16 [Deinococcus proteolyticus MRP]
 gi|324314456|gb|ADY25571.1| 50S ribosomal protein L16 [Deinococcus proteolyticus MRP]
          Length = 141

 Score =  187 bits (476), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 72/136 (52%), Positives = 95/136 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY KQF+GR++G AKGG  + FG++ + A E   I S+ IEA R  +SR  +R
Sbjct: 1   MLLPKRTKYRKQFRGRMRGEAKGGDYVAFGDYGMVAMEPGWIRSNHIEACRIVMSRHFRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+++I +FPD PVT KP EVRMGKGKG VE WV  VKPGR++FE+ GV+E  A+ AFRL
Sbjct: 61  GGKIYIRIFPDKPVTKKPLEVRMGKGKGAVEFWVAVVKPGRVMFEVAGVTEVQAKEAFRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
              KL + TK ++R V
Sbjct: 121 AGHKLPIKTKMVKREV 136


>gi|90020614|ref|YP_526441.1| 50S ribosomal protein L16 [Saccharophagus degradans 2-40]
 gi|115502790|sp|Q21M50|RL16_SACD2 RecName: Full=50S ribosomal protein L16
 gi|89950214|gb|ABD80229.1| LSU ribosomal protein L16P [Saccharophagus degradans 2-40]
          Length = 137

 Score =  187 bits (476), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 81/136 (59%), Positives = 106/136 (77%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQ KGR +G+A  GS++ FG FALKA    RI + +IEAARRA++R +KR
Sbjct: 1   MLQPKRTKFRKQQKGRNRGLAHRGSKVSFGEFALKATGRGRITARQIEAARRAMTRHVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD P+T KP EVR GKGKGNVE WVC+++PG++L+E++GVSEE+AR AF L
Sbjct: 61  GGKIWIRVFPDKPITEKPLEVRQGKGKGNVEYWVCQIQPGKVLYEMEGVSEELAREAFTL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL V T F++R V
Sbjct: 121 AAAKLPVTTTFVKRSV 136


>gi|53715459|ref|YP_101451.1| 50S ribosomal protein L16 [Bacteroides fragilis YCH46]
 gi|60683431|ref|YP_213575.1| 50S ribosomal protein L16 [Bacteroides fragilis NCTC 9343]
 gi|253566677|ref|ZP_04844130.1| 50S ribosomal protein L16 [Bacteroides sp. 3_2_5]
 gi|255011653|ref|ZP_05283779.1| 50S ribosomal protein L16 [Bacteroides fragilis 3_1_12]
 gi|265767555|ref|ZP_06095221.1| ribosomal protein L16 [Bacteroides sp. 2_1_16]
 gi|81313521|sp|Q5L8B6|RL16_BACFN RecName: Full=50S ribosomal protein L16
 gi|81608234|sp|Q64NL5|RL16_BACFR RecName: Full=50S ribosomal protein L16
 gi|52218324|dbj|BAD50917.1| 50S ribosomal protein L16 [Bacteroides fragilis YCH46]
 gi|60494865|emb|CAH09672.1| putative 50S ribosomal protein L16 [Bacteroides fragilis NCTC 9343]
 gi|251944849|gb|EES85324.1| 50S ribosomal protein L16 [Bacteroides sp. 3_2_5]
 gi|263252860|gb|EEZ24372.1| ribosomal protein L16 [Bacteroides sp. 2_1_16]
 gi|301164916|emb|CBW24477.1| putative 50S ribosomal protein L16 [Bacteroides fragilis 638R]
          Length = 144

 Score =  187 bits (476), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 70/134 (52%), Positives = 96/134 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ +Q KGR KG A+ G+++ FG+F +KA E   I   +IEAAR A++R M+R
Sbjct: 1   MLQPKKTKFRRQQKGRAKGNAQRGNQLAFGSFGIKALETKWITGRQIEAARIAVTRYMQR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T KP +VRMGKGKG+ E +V  V PGRI+ E +GVS E+A+ A RL
Sbjct: 61  QGQIWIRIFPDKPITRKPADVRMGKGKGSPEGFVAPVTPGRIIIEAEGVSYEIAKEALRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + TKF+ R
Sbjct: 121 AAQKLPITTKFVVR 134


>gi|307543832|ref|YP_003896311.1| 50S ribosomal protein L16 [Halomonas elongata DSM 2581]
 gi|307215856|emb|CBV41126.1| 50S ribosomal protein L16 [Halomonas elongata DSM 2581]
          Length = 137

 Score =  187 bits (476), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 73/136 (53%), Positives = 100/136 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK  K+ K  KGR +G+A  G+++ FG + LKA    R+ + +IEA RRAI+R +KR
Sbjct: 1   MLQPKRLKFRKVQKGRNRGLAHRGNKVSFGEYGLKATGRGRVTARQIEAGRRAITRHVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD P++ KP EVRMGKGKG+VE WV +++PGR+L+EI+GVSEE+AR AF L
Sbjct: 61  GGKIWIRVFPDKPISKKPLEVRMGKGKGSVEYWVAQIQPGRVLYEIEGVSEELAREAFSL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            A K  V T F++R V
Sbjct: 121 AAQKFPVSTTFVKRTV 136


>gi|224283716|ref|ZP_03647038.1| 50S ribosomal protein L16 [Bifidobacterium bifidum NCIMB 41171]
 gi|310288017|ref|YP_003939276.1| 50S ribosomal protein L16 [Bifidobacterium bifidum S17]
 gi|311064890|ref|YP_003971616.1| 50S ribosomal protein RplP [Bifidobacterium bifidum PRL2010]
 gi|313140872|ref|ZP_07803065.1| 50S ribosomal protein L16 [Bifidobacterium bifidum NCIMB 41171]
 gi|309251954|gb|ADO53702.1| 50S ribosomal protein L16 [Bifidobacterium bifidum S17]
 gi|310867210|gb|ADP36579.1| RplP 50S ribosomal protein [Bifidobacterium bifidum PRL2010]
 gi|313133382|gb|EFR50999.1| 50S ribosomal protein L16 [Bifidobacterium bifidum NCIMB 41171]
          Length = 139

 Score =  187 bits (476), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 63/135 (46%), Positives = 86/135 (63%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY KQ +    G++KGG+ I FG++ ++A     + + +IEAAR A++R +KR
Sbjct: 1   MLIPKRTKYRKQHRPGRSGMSKGGTEIAFGDYGIQALAPAYVTNRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPD P+T  P   RMG GKG  E W+  + PGR++FEI GVSEEVAR A R 
Sbjct: 61  GGRVWINIFPDRPLTKHPLGARMGSGKGTPEFWIANIHPGRVMFEIGGVSEEVAREALRR 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  + I R 
Sbjct: 121 AIDKLPMKCRIIARE 135


>gi|269955442|ref|YP_003325231.1| 50S ribosomal protein L16 [Xylanimonas cellulosilytica DSM 15894]
 gi|269304123|gb|ACZ29673.1| ribosomal protein L16 [Xylanimonas cellulosilytica DSM 15894]
          Length = 139

 Score =  187 bits (476), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 63/135 (46%), Positives = 86/135 (63%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  K+ KQ      G +KGG+ I FG F ++A E   + + +IEAAR A++R +KR
Sbjct: 1   MLIPRRLKHRKQHHPGRSGASKGGNTISFGEFGIQALEPAYVTNRQIEAARIAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI ++PD P+T KP E RMG GKG+ E WV  VKPGRILFE+ GV E +AR A R 
Sbjct: 61  GGKVWINIYPDRPLTKKPAETRMGSGKGSPEWWVANVKPGRILFELAGVPEPLAREAMRR 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  +F+ R 
Sbjct: 121 AIHKLPMKCRFVVRE 135


>gi|58336637|ref|YP_193222.1| 50S ribosomal protein L16 [Lactobacillus acidophilus NCFM]
 gi|227903194|ref|ZP_04020999.1| 50S ribosomal protein L16 [Lactobacillus acidophilus ATCC 4796]
 gi|75433038|sp|Q5FM83|RL16_LACAC RecName: Full=50S ribosomal protein L16
 gi|58253954|gb|AAV42191.1| 50S ribosomal protein L16 [Lactobacillus acidophilus NCFM]
 gi|227868999|gb|EEJ76420.1| 50S ribosomal protein L16 [Lactobacillus acidophilus ATCC 4796]
          Length = 146

 Score =  187 bits (476), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 71/138 (51%), Positives = 92/138 (66%)

Query: 1   MLRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMK 60
           M   PK  K+ ++F+G+++G AKGG  I FG + L+A E++ I + +IEAAR A++R MK
Sbjct: 1   MPLVPKRVKHRREFRGKMRGAAKGGKYIAFGEYGLEALESHWITNRQIEAARVAMTRYMK 60

Query: 61  RAGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFR 120
           R G+VWI +FP    TAK   VRMG GKG    WV  VK  +ILFEI GVSEEVAR A R
Sbjct: 61  RGGKVWIRIFPQKSYTAKGVGVRMGSGKGAPAGWVAVVKREKILFEIGGVSEEVAREALR 120

Query: 121 LGAAKLSVVTKFIQRVVE 138
           L + KL + TKF+ R  E
Sbjct: 121 LASTKLPIKTKFVTRSSE 138


>gi|253581385|ref|ZP_04858611.1| LSU ribosomal protein L16P [Fusobacterium varium ATCC 27725]
 gi|257470833|ref|ZP_05634923.1| 50S ribosomal protein L16 [Fusobacterium ulcerans ATCC 49185]
 gi|317065037|ref|ZP_07929522.1| LSU ribosomal protein L16P [Fusobacterium ulcerans ATCC 49185]
 gi|251836749|gb|EES65283.1| LSU ribosomal protein L16P [Fusobacterium varium ATCC 27725]
 gi|313690713|gb|EFS27548.1| LSU ribosomal protein L16P [Fusobacterium ulcerans ATCC 49185]
          Length = 140

 Score =  187 bits (476), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 67/135 (49%), Positives = 94/135 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ K F+GR+KG A+ G+ + FG++ L+A E + I + +IE+ R AI+R  KR
Sbjct: 1   MLMPKRTKHRKMFRGRMKGTAQRGNTVAFGDYGLQALEPHWITNRQIESCRVAINRTFKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+ +I +FPD P+TA+P  VRMGKGKGNVE WV  VKPGRI+FE+ GV+EE A  A R 
Sbjct: 61  EGKTFIRIFPDKPITARPAGVRMGKGKGNVEGWVAVVKPGRIMFEVSGVTEERALVALRK 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL +  K +++ 
Sbjct: 121 AAMKLPISCKIVKKE 135


>gi|169794110|ref|YP_001718474.1| ribosomal protein L16 [Manihot esculenta]
 gi|326909429|ref|YP_004327699.1| ribosomal protein L16 [Hevea brasiliensis]
 gi|215275575|sp|B1NWI7|RK16_MANES RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|157695922|gb|ABV66191.1| ribosomal protein L16 [Manihot esculenta]
 gi|308523543|gb|ADO33593.1| ribosomal protein L16 [Hevea brasiliensis]
          Length = 135

 Score =  187 bits (476), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 69/132 (52%), Positives = 98/132 (74%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG+A  G+RICFG +AL+A E   I S +IEA RRA++R  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGIAFRGNRICFGRYALQALEPAWITSRQIEAGRRAMTRNARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +PTE RMG GKG+ E WV  VKPGRIL+E+ GV+E +AR+A  +
Sbjct: 61  GGKIWVRIFPDKPVTLRPTETRMGSGKGSPEYWVAVVKPGRILYEMGGVAENIARKAISI 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+FI
Sbjct: 121 AASKMPIRTQFI 132


>gi|302336375|ref|YP_003801582.1| LSU ribosomal protein L16P [Olsenella uli DSM 7084]
 gi|301320215|gb|ADK68702.1| LSU ribosomal protein L16P [Olsenella uli DSM 7084]
          Length = 141

 Score =  187 bits (476), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 70/134 (52%), Positives = 94/134 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK   + K  +G +KG AKG + + FG++ L+A EA+ I + +IEAAR A++R MKR
Sbjct: 1   MLAPKRVLHRKVQRGSMKGHAKGNTELHFGSYGLQALEAHWITNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PV+ KP E RMGKGKGN E+WV  VKPGRI+FEIDGV + +AR A RL
Sbjct: 61  GGKVWITIFPDKPVSKKPAETRMGKGKGNPEEWVAVVKPGRIMFEIDGVEDAIAREALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              K+ + TK + R
Sbjct: 121 AQHKMPIRTKVVTR 134


>gi|239918192|ref|YP_002957750.1| LSU ribosomal protein L16P [Micrococcus luteus NCTC 2665]
 gi|281415617|ref|ZP_06247359.1| 50S ribosomal protein L16 [Micrococcus luteus NCTC 2665]
 gi|289706540|ref|ZP_06502890.1| ribosomal protein L16 [Micrococcus luteus SK58]
 gi|259646055|sp|C5CC55|RL16_MICLC RecName: Full=50S ribosomal protein L16
 gi|239839399|gb|ACS31196.1| LSU ribosomal protein L16P [Micrococcus luteus NCTC 2665]
 gi|289556675|gb|EFD50016.1| ribosomal protein L16 [Micrococcus luteus SK58]
          Length = 138

 Score =  187 bits (476), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 62/135 (45%), Positives = 89/135 (65%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  K+ KQ   +  G AKGG+ + FG + ++A     + + +IEAAR A++R +KR
Sbjct: 1   MLIPRRVKHRKQHHPKRSGAAKGGTTVTFGEWGIQALTPAYVTNRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI ++PD P+T KP E RMG GKG+ E WV  VKPGR+LFE+ GV+E+VAR A RL
Sbjct: 61  GGKVWINIYPDRPITKKPAETRMGSGKGSPEWWVANVKPGRVLFELSGVTEDVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  + I+R 
Sbjct: 121 AIHKLPLKARIIRRE 135


>gi|282878766|ref|ZP_06287534.1| ribosomal protein L16 [Prevotella buccalis ATCC 35310]
 gi|281299157|gb|EFA91558.1| ribosomal protein L16 [Prevotella buccalis ATCC 35310]
          Length = 142

 Score =  187 bits (476), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 72/135 (53%), Positives = 93/135 (68%), Gaps = 1/135 (0%)

Query: 2   LRQPKNTKYPKQFKGR-IKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMK 60
           + QPK  KY +   GR  KG A  G+++ FG+F +K  E   I S +IEAAR A++R M+
Sbjct: 1   MLQPKRVKYRRPQDGRGNKGNAHRGTQLVFGSFGIKTLEPKWIDSRQIEAARVAVNRYMQ 60

Query: 61  RAGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFR 120
           R G+VWI +FPD P+T KP +VRMGKGKG+   WV  V PGRILFE++GVS +VA+ A R
Sbjct: 61  REGQVWIRIFPDKPITRKPADVRMGKGKGDPMGWVAPVTPGRILFEVEGVSFDVAKEALR 120

Query: 121 LGAAKLSVVTKFIQR 135
           L A KL V TKF+ R
Sbjct: 121 LAAQKLPVKTKFVVR 135


>gi|296168564|ref|ZP_06850368.1| 50S ribosomal protein L16 [Mycobacterium parascrofulaceum ATCC
           BAA-614]
 gi|295896627|gb|EFG76266.1| 50S ribosomal protein L16 [Mycobacterium parascrofulaceum ATCC
           BAA-614]
          Length = 138

 Score =  187 bits (476), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 60/135 (44%), Positives = 87/135 (64%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  K+ KQ   R +G+A GG+ + FG++ ++A E   + + +IE+AR AI+R +KR
Sbjct: 1   MLIPRRVKHRKQHHPRQRGIASGGTAVNFGDYGIQALEHAYVTNRQIESARIAINRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI VFPD P+T KP E RMG GKG+ E WV  VKPGR+LFE+   +E+VAR A   
Sbjct: 61  GGKVWINVFPDRPLTKKPAETRMGSGKGSPEWWVVNVKPGRVLFELSYPNEQVARAALTR 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  + + R 
Sbjct: 121 AIHKLPIKARIVTRE 135


>gi|148270429|ref|YP_001244889.1| 50S ribosomal protein L16 [Thermotoga petrophila RKU-1]
 gi|170289176|ref|YP_001739414.1| ribosomal protein L16 [Thermotoga sp. RQ2]
 gi|281412736|ref|YP_003346815.1| ribosomal protein L16 [Thermotoga naphthophila RKU-10]
 gi|166216122|sp|A5IM90|RL16_THEP1 RecName: Full=50S ribosomal protein L16
 gi|226712369|sp|B1LBN3|RL16_THESQ RecName: Full=50S ribosomal protein L16
 gi|147735973|gb|ABQ47313.1| LSU ribosomal protein L16P [Thermotoga petrophila RKU-1]
 gi|170176679|gb|ACB09731.1| ribosomal protein L16 [Thermotoga sp. RQ2]
 gi|281373839|gb|ADA67401.1| ribosomal protein L16 [Thermotoga naphthophila RKU-10]
          Length = 142

 Score =  187 bits (476), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 73/134 (54%), Positives = 92/134 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  KY KQ +GR+KG AKGG+ + FG + LKA E   I + +IEA R A+ R MKR
Sbjct: 1   MLMPRRVKYRKQQRGRMKGKAKGGTFVQFGEWGLKALEPAWITAQQIEACRIAMLRAMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           +G++WI +FPD P T KP E RMGKGKGNVE WV  VKPG+ILFE+ GV EE A  A R 
Sbjct: 61  SGKIWIRIFPDKPYTKKPPESRMGKGKGNVEGWVAVVKPGKILFEVAGVDEETAHEALRY 120

Query: 122 GAAKLSVVTKFIQR 135
            A+KL + TK + R
Sbjct: 121 AASKLPIATKVVPR 134


>gi|254449322|ref|ZP_05062767.1| ribosomal protein L16 [gamma proteobacterium HTCC5015]
 gi|198261081|gb|EDY85381.1| ribosomal protein L16 [gamma proteobacterium HTCC5015]
          Length = 137

 Score =  187 bits (476), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 79/136 (58%), Positives = 104/136 (76%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGR +G+A  GS + FG +ALKA    RI + +IEAARRA++R +KR
Sbjct: 1   MLQPKRTKFRKVQKGRNRGLAHRGSSVSFGEYALKATGRGRITARQIEAARRAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T KP EVRMGKGKGNVE WV +++PGR+L+E++GVSEE+AR AFRL
Sbjct: 61  GGKIWIRIFPDKPITKKPVEVRMGKGKGNVEFWVAQIQPGRVLYEMEGVSEELAREAFRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            A KL V T F++R V
Sbjct: 121 AARKLPVSTTFVKRTV 136


>gi|167764365|ref|ZP_02436490.1| hypothetical protein BACSTE_02749 [Bacteroides stercoris ATCC
           43183]
 gi|329956710|ref|ZP_08297283.1| ribosomal protein L16 [Bacteroides clarus YIT 12056]
 gi|167697770|gb|EDS14349.1| hypothetical protein BACSTE_02749 [Bacteroides stercoris ATCC
           43183]
 gi|328524082|gb|EGF51158.1| ribosomal protein L16 [Bacteroides clarus YIT 12056]
          Length = 144

 Score =  187 bits (476), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 70/134 (52%), Positives = 96/134 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ +Q KGR KG A+ G+++ FG+F +KA E   I   +IEAAR A++R M+R
Sbjct: 1   MLQPKKTKFRRQQKGRQKGNAQRGNQLAFGSFGIKALETKWITGRQIEAARIAVTRYMQR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T KP +VRMGKGKG+ E +V  V PGRI+ E +GVS E+A+ A RL
Sbjct: 61  QGQIWIRIFPDKPITRKPADVRMGKGKGSPEGFVAPVTPGRIIIEAEGVSYEIAKEALRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + TKF+ R
Sbjct: 121 AAQKLPITTKFVVR 134


>gi|163840899|ref|YP_001625304.1| 50S ribosomal protein L16 [Renibacterium salmoninarum ATCC 33209]
 gi|189041476|sp|A9WSV2|RL16_RENSM RecName: Full=50S ribosomal protein L16
 gi|162954375|gb|ABY23890.1| LSU ribosomal protein L16P [Renibacterium salmoninarum ATCC 33209]
          Length = 138

 Score =  187 bits (475), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 59/135 (43%), Positives = 88/135 (65%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  K+ KQ      G A GG+++ FG + ++A     + + +IE+AR A++R +KR
Sbjct: 1   MLIPRRVKHRKQHHPGRSGQATGGTKVSFGEYGIQALTPAYVTNRQIESARIAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI ++PD P+T KP E RMG GKG+ E W+  VKPGR+LFE+ GV+EEVAR A RL
Sbjct: 61  GGKVWINIYPDRPLTKKPAETRMGSGKGSPEWWIANVKPGRVLFELSGVNEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  + ++R 
Sbjct: 121 AIHKLPLKARIVRRE 135


>gi|81429370|ref|YP_396371.1| 50S ribosomal protein L16 [Lactobacillus sakei subsp. sakei 23K]
 gi|85701220|sp|Q38UR9|RL16_LACSS RecName: Full=50S ribosomal protein L16
 gi|78611013|emb|CAI56065.1| 50S ribosomal protein L16 [Lactobacillus sakei subsp. sakei 23K]
          Length = 144

 Score =  187 bits (475), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 68/135 (50%), Positives = 91/135 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ ++F+G+++G AKGG  + FG F L+A E++ I + +IEAAR A++R MKR
Sbjct: 1   MLVPKRVKHRREFRGKMRGAAKGGKEVTFGEFGLQALESSWITNRQIEAARVAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP    TAK   VRMG GKG    WV  VK  +I+FEI GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPHKSYTAKGVGVRMGSGKGAPAGWVAVVKREKIMFEIGGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL V TK ++R 
Sbjct: 121 ASHKLPVKTKIVKRE 135


>gi|15607848|ref|NP_215222.1| 50S ribosomal protein L16 [Mycobacterium tuberculosis H37Rv]
 gi|15840115|ref|NP_335152.1| 50S ribosomal protein L16 [Mycobacterium tuberculosis CDC1551]
 gi|31791893|ref|NP_854386.1| 50S ribosomal protein L16 [Mycobacterium bovis AF2122/97]
 gi|121636630|ref|YP_976853.1| 50S ribosomal protein L16 [Mycobacterium bovis BCG str. Pasteur
           1173P2]
 gi|148660483|ref|YP_001282006.1| 50S ribosomal protein L16 [Mycobacterium tuberculosis H37Ra]
 gi|148821913|ref|YP_001286667.1| 50S ribosomal protein L16 [Mycobacterium tuberculosis F11]
 gi|167967951|ref|ZP_02550228.1| 50S ribosomal protein L16 [Mycobacterium tuberculosis H37Ra]
 gi|215402492|ref|ZP_03414673.1| 50S ribosomal protein L16 [Mycobacterium tuberculosis 02_1987]
 gi|215410265|ref|ZP_03419073.1| 50S ribosomal protein L16 [Mycobacterium tuberculosis 94_M4241A]
 gi|215425950|ref|ZP_03423869.1| 50S ribosomal protein L16 [Mycobacterium tuberculosis T92]
 gi|215429549|ref|ZP_03427468.1| 50S ribosomal protein L16 [Mycobacterium tuberculosis EAS054]
 gi|215444832|ref|ZP_03431584.1| 50S ribosomal protein L16 [Mycobacterium tuberculosis T85]
 gi|218752358|ref|ZP_03531154.1| 50S ribosomal protein L16 [Mycobacterium tuberculosis GM 1503]
 gi|219556557|ref|ZP_03535633.1| 50S ribosomal protein L16 [Mycobacterium tuberculosis T17]
 gi|224989102|ref|YP_002643789.1| 50S ribosomal protein L16 [Mycobacterium bovis BCG str. Tokyo 172]
 gi|253797651|ref|YP_003030652.1| 50S ribosomal protein L16 rplP [Mycobacterium tuberculosis KZN
           1435]
 gi|254231028|ref|ZP_04924355.1| 50S ribosomal protein L16 rplP [Mycobacterium tuberculosis C]
 gi|254363654|ref|ZP_04979700.1| 50S ribosomal protein L16 rplP [Mycobacterium tuberculosis str.
           Haarlem]
 gi|254549669|ref|ZP_05140116.1| 50S ribosomal protein L16 [Mycobacterium tuberculosis '98-R604
           INH-RIF-EM']
 gi|260185590|ref|ZP_05763064.1| 50S ribosomal protein L16 [Mycobacterium tuberculosis CPHL_A]
 gi|260199718|ref|ZP_05767209.1| 50S ribosomal protein L16 [Mycobacterium tuberculosis T46]
 gi|260203879|ref|ZP_05771370.1| 50S ribosomal protein L16 [Mycobacterium tuberculosis K85]
 gi|289442109|ref|ZP_06431853.1| LSU ribosomal protein L16 [Mycobacterium tuberculosis T46]
 gi|289446268|ref|ZP_06436012.1| 50S ribosomal protein L16 rplP [Mycobacterium tuberculosis CPHL_A]
 gi|289568652|ref|ZP_06448879.1| 50S ribosomal protein L16 rplP [Mycobacterium tuberculosis T17]
 gi|289573316|ref|ZP_06453543.1| 50S ribosomal protein L16 rplP [Mycobacterium tuberculosis K85]
 gi|289744432|ref|ZP_06503810.1| 50S ribosomal protein L16 rplP [Mycobacterium tuberculosis 02_1987]
 gi|289749215|ref|ZP_06508593.1| 50S ribosomal protein L16 rplP [Mycobacterium tuberculosis T92]
 gi|289752755|ref|ZP_06512133.1| 50S ribosomal protein L16 [Mycobacterium tuberculosis EAS054]
 gi|289756796|ref|ZP_06516174.1| 50S ribosomal protein L16 [Mycobacterium tuberculosis T85]
 gi|289760835|ref|ZP_06520213.1| 50S ribosomal protein L16 rplP [Mycobacterium tuberculosis GM 1503]
 gi|294996203|ref|ZP_06801894.1| 50S ribosomal protein L16 [Mycobacterium tuberculosis 210]
 gi|297633207|ref|ZP_06950987.1| 50S ribosomal protein L16 [Mycobacterium tuberculosis KZN 4207]
 gi|297730187|ref|ZP_06959305.1| 50S ribosomal protein L16 [Mycobacterium tuberculosis KZN R506]
 gi|298524199|ref|ZP_07011608.1| 50S ribosomal protein L16 [Mycobacterium tuberculosis 94_M4241A]
 gi|306774819|ref|ZP_07413156.1| 50S ribosomal protein L16 rplP [Mycobacterium tuberculosis SUMu001]
 gi|306781448|ref|ZP_07419785.1| 50S ribosomal protein L16 rplP [Mycobacterium tuberculosis SUMu002]
 gi|306783360|ref|ZP_07421682.1| 50S ribosomal protein L16 rplP [Mycobacterium tuberculosis SUMu003]
 gi|306787730|ref|ZP_07426052.1| 50S ribosomal protein L16 rplP [Mycobacterium tuberculosis SUMu004]
 gi|306794498|ref|ZP_07432800.1| 50S ribosomal protein L16 rplP [Mycobacterium tuberculosis SUMu005]
 gi|306796463|ref|ZP_07434765.1| 50S ribosomal protein L16 rplP [Mycobacterium tuberculosis SUMu006]
 gi|306802323|ref|ZP_07438991.1| 50S ribosomal protein L16 rplP [Mycobacterium tuberculosis SUMu008]
 gi|306806532|ref|ZP_07443200.1| 50S ribosomal protein L16 rplP [Mycobacterium tuberculosis SUMu007]
 gi|306966730|ref|ZP_07479391.1| 50S ribosomal protein L16 rplP [Mycobacterium tuberculosis SUMu009]
 gi|306970921|ref|ZP_07483582.1| 50S ribosomal protein L16 rplP [Mycobacterium tuberculosis SUMu010]
 gi|307078651|ref|ZP_07487821.1| 50S ribosomal protein L16 rplP [Mycobacterium tuberculosis SUMu011]
 gi|307083215|ref|ZP_07492328.1| 50S ribosomal protein L16 rplP [Mycobacterium tuberculosis SUMu012]
 gi|313657514|ref|ZP_07814394.1| 50S ribosomal protein L16 [Mycobacterium tuberculosis KZN V2475]
 gi|6225963|sp|P95056|RL16_MYCTU RecName: Full=50S ribosomal protein L16
 gi|38605700|sp|O06049|RL16_MYCBO RecName: Full=50S ribosomal protein L16
 gi|166199685|sp|A1KGI9|RL16_MYCBP RecName: Full=50S ribosomal protein L16
 gi|166199689|sp|A5U094|RL16_MYCTA RecName: Full=50S ribosomal protein L16
 gi|254799212|sp|C1AL42|RL16_MYCBT RecName: Full=50S ribosomal protein L16
 gi|1806176|emb|CAB06432.1| PROBABLE 50S RIBOSOMAL PROTEIN L16 RPLP [Mycobacterium tuberculosis
           H37Rv]
 gi|13880265|gb|AAK44966.1| ribosomal protein L16 [Mycobacterium tuberculosis CDC1551]
 gi|31617480|emb|CAD93590.1| PROBABLE 50S RIBOSOMAL PROTEIN L16 RPLP [Mycobacterium bovis
           AF2122/97]
 gi|121492277|emb|CAL70744.1| Probable 50S ribosomal protein L16 rplP [Mycobacterium bovis BCG
           str. Pasteur 1173P2]
 gi|124600087|gb|EAY59097.1| 50S ribosomal protein L16 rplP [Mycobacterium tuberculosis C]
 gi|134149168|gb|EBA41213.1| 50S ribosomal protein L16 rplP [Mycobacterium tuberculosis str.
           Haarlem]
 gi|148504635|gb|ABQ72444.1| 50S ribosomal protein L16 [Mycobacterium tuberculosis H37Ra]
 gi|148720440|gb|ABR05065.1| 50S ribosomal protein L16 rplP [Mycobacterium tuberculosis F11]
 gi|224772215|dbj|BAH25021.1| 50S ribosomal protein L16 [Mycobacterium bovis BCG str. Tokyo 172]
 gi|253319154|gb|ACT23757.1| 50S ribosomal protein L16 rplP [Mycobacterium tuberculosis KZN
           1435]
 gi|289415028|gb|EFD12268.1| LSU ribosomal protein L16 [Mycobacterium tuberculosis T46]
 gi|289419226|gb|EFD16427.1| 50S ribosomal protein L16 rplP [Mycobacterium tuberculosis CPHL_A]
 gi|289537747|gb|EFD42325.1| 50S ribosomal protein L16 rplP [Mycobacterium tuberculosis K85]
 gi|289542406|gb|EFD46054.1| 50S ribosomal protein L16 rplP [Mycobacterium tuberculosis T17]
 gi|289684960|gb|EFD52448.1| 50S ribosomal protein L16 rplP [Mycobacterium tuberculosis 02_1987]
 gi|289689802|gb|EFD57231.1| 50S ribosomal protein L16 rplP [Mycobacterium tuberculosis T92]
 gi|289693342|gb|EFD60771.1| 50S ribosomal protein L16 [Mycobacterium tuberculosis EAS054]
 gi|289708341|gb|EFD72357.1| 50S ribosomal protein L16 rplP [Mycobacterium tuberculosis GM 1503]
 gi|289712360|gb|EFD76372.1| 50S ribosomal protein L16 [Mycobacterium tuberculosis T85]
 gi|298493993|gb|EFI29287.1| 50S ribosomal protein L16 [Mycobacterium tuberculosis 94_M4241A]
 gi|308216709|gb|EFO76108.1| 50S ribosomal protein L16 rplP [Mycobacterium tuberculosis SUMu001]
 gi|308325749|gb|EFP14600.1| 50S ribosomal protein L16 rplP [Mycobacterium tuberculosis SUMu002]
 gi|308331854|gb|EFP20705.1| 50S ribosomal protein L16 rplP [Mycobacterium tuberculosis SUMu003]
 gi|308335641|gb|EFP24492.1| 50S ribosomal protein L16 rplP [Mycobacterium tuberculosis SUMu004]
 gi|308337098|gb|EFP25949.1| 50S ribosomal protein L16 rplP [Mycobacterium tuberculosis SUMu005]
 gi|308343122|gb|EFP31973.1| 50S ribosomal protein L16 rplP [Mycobacterium tuberculosis SUMu006]
 gi|308347009|gb|EFP35860.1| 50S ribosomal protein L16 rplP [Mycobacterium tuberculosis SUMu007]
 gi|308350894|gb|EFP39745.1| 50S ribosomal protein L16 rplP [Mycobacterium tuberculosis SUMu008]
 gi|308355584|gb|EFP44435.1| 50S ribosomal protein L16 rplP [Mycobacterium tuberculosis SUMu009]
 gi|308359542|gb|EFP48393.1| 50S ribosomal protein L16 rplP [Mycobacterium tuberculosis SUMu010]
 gi|308363447|gb|EFP52298.1| 50S ribosomal protein L16 rplP [Mycobacterium tuberculosis SUMu011]
 gi|308367085|gb|EFP55936.1| 50S ribosomal protein L16 rplP [Mycobacterium tuberculosis SUMu012]
 gi|323720835|gb|EGB29902.1| 50S ribosomal protein L16 rplP [Mycobacterium tuberculosis
           CDC1551A]
 gi|326905070|gb|EGE52003.1| 50S ribosomal protein L16 rplP [Mycobacterium tuberculosis W-148]
 gi|328457432|gb|AEB02855.1| 50S ribosomal protein L16 rplP [Mycobacterium tuberculosis KZN
           4207]
          Length = 138

 Score =  187 bits (475), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 60/135 (44%), Positives = 86/135 (63%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  K+ KQ   R +G+A GG+ + FG++ ++A E   + + +IE+AR AI+R +KR
Sbjct: 1   MLIPRKVKHRKQHHPRQRGIASGGTTVNFGDYGIQALEHAYVTNRQIESARIAINRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T KP E RMG GKG+ E WV  VKPGR+LFE+   +E VAR A   
Sbjct: 61  GGKVWINIFPDRPLTKKPAETRMGSGKGSPEWWVANVKPGRVLFELSYPNEGVARAALTR 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  + I R 
Sbjct: 121 AIHKLPIKARIITRE 135


>gi|237736177|ref|ZP_04566658.1| LSU ribosomal protein L16P [Fusobacterium mortiferum ATCC 9817]
 gi|229421730|gb|EEO36777.1| LSU ribosomal protein L16P [Fusobacterium mortiferum ATCC 9817]
          Length = 140

 Score =  187 bits (475), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 66/135 (48%), Positives = 93/135 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ K F+GR+KG A+ G+ + FG++ L+A E + I + +IE+ R AI+R  KR
Sbjct: 1   MLMPKRTKHRKMFRGRMKGTAQRGNTVAFGDYGLQALEPHWITNRQIESCRVAINRTFKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+ +I +FPD P+TA+P  VRMGKGKG+VE WV  V PGRI+FE+ GV+EE A  A R 
Sbjct: 61  EGKTFIRIFPDKPITARPAGVRMGKGKGSVEGWVAVVLPGRIMFEVSGVTEEKALAALRK 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL V  K ++R 
Sbjct: 121 ASMKLPVRCKIVKRE 135


>gi|296313372|ref|ZP_06863313.1| ribosomal protein L16 [Neisseria polysaccharea ATCC 43768]
 gi|296840083|gb|EFH24021.1| ribosomal protein L16 [Neisseria polysaccharea ATCC 43768]
          Length = 138

 Score =  187 bits (475), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 73/136 (53%), Positives = 97/136 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QP   KY KQ KGR  G+A  G+++ FG F LKA    R+ + +IEAARR ++R +KR
Sbjct: 1   MLQPTRLKYRKQQKGRNTGIATRGNKVSFGEFGLKAVGRGRLTARQIEAARRTMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI VFPD P+T KP +VRMG GKGNVE ++  +KPG++L+E+DGV EE+AR AF L
Sbjct: 61  GGRIWIRVFPDKPITEKPIQVRMGGGKGNVEYYIAEIKPGKVLYEMDGVPEELAREAFEL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + T F+ R V
Sbjct: 121 AAAKLPIPTTFVVRQV 136


>gi|159106901|ref|YP_001531319.1| ribosomal protein L16 [Lolium perenne]
 gi|218176278|ref|YP_002364535.1| ribosomal protein L16 [Festuca arundinacea]
 gi|215275574|sp|A8Y9C4|RK16_LOLPR RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|158934435|emb|CAO86013.1| ribosomal protein L16 [Lolium perenne]
 gi|215882362|gb|ACJ70792.1| ribosomal protein L16 [Festuca arundinacea]
          Length = 136

 Score =  187 bits (475), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 68/136 (50%), Positives = 98/136 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG +  G+RICFG +AL+A E   I + +IEA RRAI+R  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGKSCRGNRICFGRYALQALEPAWITARQIEAGRRAITRYARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +PTE RMG GKG+ E WV  VKPGRIL+E+ GVSE +AR A  +
Sbjct: 61  GGKIWVRIFPDKPVTLRPTETRMGSGKGSPEYWVAIVKPGRILYEMGGVSETIARAAMEI 120

Query: 122 GAAKLSVVTKFIQRVV 137
            A+K+ + ++FI+  +
Sbjct: 121 AASKMPIRSQFIRLEI 136


>gi|261854957|ref|YP_003262240.1| ribosomal protein L16 [Halothiobacillus neapolitanus c2]
 gi|261835426|gb|ACX95193.1| ribosomal protein L16 [Halothiobacillus neapolitanus c2]
          Length = 137

 Score =  187 bits (475), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 74/135 (54%), Positives = 105/135 (77%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ KQF+G+ +G+A  G+++ FG F LK+ E   I S +IE+ARRAISR +KR
Sbjct: 1   MLLPKRTKFRKQFRGKNRGIATTGNKVSFGEFGLKSLERGEITSRQIESARRAISRHVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T KP EVRMGKGKG+VE WV +++PG++L+EI+GV+E++AR+AF L
Sbjct: 61  GGKIWIRIFPDTPITKKPLEVRMGKGKGSVEYWVAKIQPGKMLYEIEGVTEDIARQAFSL 120

Query: 122 GAAKLSVVTKFIQRV 136
            +AKL V T F+ RV
Sbjct: 121 ASAKLPVKTTFVTRV 135


>gi|71842321|ref|YP_277409.1| ribosomal protein L16 [Emiliania huxleyi]
 gi|85541764|sp|Q4G358|RK16_EMIHU RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|60101564|gb|AAX13908.1| ribosomal protein L16 [Emiliania huxleyi]
          Length = 138

 Score =  187 bits (475), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 62/136 (45%), Positives = 88/136 (64%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ K  +GR+KGVA   + + FG F ++A E   + S +IEA RR+I+R ++R
Sbjct: 1   MLLPKRTKFRKMHRGRLKGVATRANTVVFGEFGIQALEPVWLTSRQIEATRRSITRYVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD  VT +  E RMG GKG V  WV  VKPG +LFEI+G+SEE++ +  + 
Sbjct: 61  TGKIWIRVFPDRSVTERAAESRMGAGKGAVSYWVAVVKPGTVLFEINGLSEEMSHQVLKS 120

Query: 122 GAAKLSVVTKFIQRVV 137
            + KL + TK I R  
Sbjct: 121 ASYKLPIKTKIISRES 136


>gi|85701218|sp|Q2VEE3|RK16_SOLTU RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|82754689|gb|ABB90103.1| ribosomal protein L16 [Solanum tuberosum]
          Length = 134

 Score =  187 bits (475), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 67/132 (50%), Positives = 94/132 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+ I FG +AL+A E   I S +IEA RRA++R  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGISSRGNHISFGKYALQALEPAWITSRQIEAGRRAMTRNARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +P E RMG GKG+ E WV  VKPGRIL+E+ GV+E +ARRA  L
Sbjct: 61  GGKIWVRIFPDKPVTLRPAETRMGSGKGSPEYWVAVVKPGRILYEMGGVTENIARRAISL 120

Query: 122 GAAKLSVVTKFI 133
            A+K+   T+FI
Sbjct: 121 AASKMPKRTQFI 132


>gi|300742050|ref|ZP_07072071.1| ribosomal protein L16 [Rothia dentocariosa M567]
 gi|311111966|ref|YP_003983188.1| 50S ribosomal protein L16 [Rothia dentocariosa ATCC 17931]
 gi|300381235|gb|EFJ77797.1| ribosomal protein L16 [Rothia dentocariosa M567]
 gi|310943460|gb|ADP39754.1| 50S ribosomal protein L16 [Rothia dentocariosa ATCC 17931]
          Length = 138

 Score =  187 bits (475), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 63/135 (46%), Positives = 90/135 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  K+ KQ   +  G+AKGG+ + FG + ++A     + + +IEAAR A++R +KR
Sbjct: 1   MLIPRRVKFRKQHHPKRHGLAKGGTEVSFGEWGIQALSPAYVTNRQIEAARIAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI ++PD P+T KP E RMG GKG+ E WV  VKPGR++FEI GVSEEVAR A RL
Sbjct: 61  GGKVWINIYPDRPLTKKPAETRMGSGKGSPEWWVANVKPGRVMFEIAGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  + ++R 
Sbjct: 121 AIHKLPMKARVVRRE 135


>gi|256847770|ref|ZP_05553215.1| ribosomal protein L16 [Lactobacillus coleohominis 101-4-CHN]
 gi|256715459|gb|EEU30435.1| ribosomal protein L16 [Lactobacillus coleohominis 101-4-CHN]
          Length = 144

 Score =  187 bits (475), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 66/135 (48%), Positives = 89/135 (65%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ K  +G ++G AKGG  + FG + L+A +++ I + +IEA R AI+R MKR
Sbjct: 1   MLVPKRVKHRKVQRGHLRGEAKGGKTVAFGEYGLQALDSHWISNRQIEAGRIAITRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP +  T+K   VRMG GKG  E WV  VK G++LFE+ GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPHLSYTSKGVGVRMGNGKGAPEGWVAPVKRGKVLFEVAGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              K+ V TK I+R 
Sbjct: 121 AGTKMPVRTKIIKRE 135


>gi|161523436|ref|YP_001578448.1| 50S ribosomal protein L16 [Burkholderia multivorans ATCC 17616]
 gi|189351791|ref|YP_001947419.1| 50S ribosomal protein L16 [Burkholderia multivorans ATCC 17616]
 gi|221201572|ref|ZP_03574610.1| 50S ribosomal protein L16 [Burkholderia multivorans CGD2M]
 gi|221207353|ref|ZP_03580363.1| 50S ribosomal protein L16 [Burkholderia multivorans CGD2]
 gi|221213491|ref|ZP_03586466.1| 50S ribosomal protein L16 [Burkholderia multivorans CGD1]
 gi|226710691|sp|A9ADK0|RL16_BURM1 RecName: Full=50S ribosomal protein L16
 gi|160340865|gb|ABX13951.1| ribosomal protein L16 [Burkholderia multivorans ATCC 17616]
 gi|189335813|dbj|BAG44883.1| large subunit ribosomal protein L16 [Burkholderia multivorans ATCC
           17616]
 gi|221166943|gb|EED99414.1| 50S ribosomal protein L16 [Burkholderia multivorans CGD1]
 gi|221172941|gb|EEE05378.1| 50S ribosomal protein L16 [Burkholderia multivorans CGD2]
 gi|221178388|gb|EEE10797.1| 50S ribosomal protein L16 [Burkholderia multivorans CGD2M]
 gi|325529685|gb|EGD06548.1| 50S ribosomal protein L16 [Burkholderia sp. TJI49]
          Length = 138

 Score =  187 bits (475), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 74/135 (54%), Positives = 97/135 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK  KY K+ KGR  G A  G+ + FG F LKA    R+ + +IEAARRA++R +KR
Sbjct: 1   MLQPKRRKYRKEQKGRNTGKATRGNAVSFGEFGLKAIGRGRLTARQIEAARRAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI +FPD P++ KP EVRMG GKGN E +V  ++PG++L+E+DGVSEE+AR AFRL
Sbjct: 61  GGRIWIRIFPDKPISQKPAEVRMGNGKGNPEYYVAEIQPGKMLYEMDGVSEELAREAFRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            AAKL + T FI R 
Sbjct: 121 AAAKLPIQTTFIVRQ 135


>gi|108773105|ref|YP_636014.1| ribosomal protein L16 [Scenedesmus obliquus]
 gi|115502629|sp|Q1KVR0|RK16_SCEOB RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|88696671|gb|ABD48297.1| ribosomal protein L16 [Scenedesmus obliquus]
          Length = 138

 Score =  187 bits (475), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 60/133 (45%), Positives = 89/133 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ +  +G +KG A  G++I FG + L+A E   I S +IE+ RR ++R ++R
Sbjct: 1   MLSPKRTKFRRPHRGNLKGKACRGTKIAFGEYGLQALEPCWITSRQIESGRRVLTRYVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T +P   RMG GKG  E WV  V PG+IL+EI GVSE VA++A + 
Sbjct: 61  TGKLWIRIFPDKPITMRPAGTRMGSGKGFPEYWVAVVHPGKILYEIQGVSEPVAKQALKT 120

Query: 122 GAAKLSVVTKFIQ 134
            A K+ + TKF++
Sbjct: 121 AAYKMPIKTKFVK 133


>gi|45644700|gb|AAS73088.1| predicted ribosomal protein L16/L10E [uncultured marine gamma
           proteobacterium EBAC20E09]
          Length = 136

 Score =  187 bits (475), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 76/134 (56%), Positives = 100/134 (74%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGR +G+A+ G+ I FG F L A +  RI + +IEAARRA++R +KR
Sbjct: 1   MLQPKQTKFRKMHKGRNRGLAQNGNTIAFGRFGLVASDRGRITARQIEAARRAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G +WI +FPD P+T KP EVRMGKGKGNVE WV  V+PG+I+FE+ GV EE+AR AFRL
Sbjct: 61  GGNIWIRIFPDKPITKKPLEVRMGKGKGNVEYWVALVQPGKIMFEMAGVEEELAREAFRL 120

Query: 122 GAAKLSVVTKFIQR 135
            +AKL + T FI++
Sbjct: 121 ASAKLPIKTHFIKK 134


>gi|89891143|ref|ZP_01202651.1| 50S ribosomal protein L16 RplP [Flavobacteria bacterium BBFL7]
 gi|89516787|gb|EAS19446.1| 50S ribosomal protein L16 RplP [Flavobacteria bacterium BBFL7]
          Length = 140

 Score =  187 bits (475), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 74/133 (55%), Positives = 93/133 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QP+ TK+ KQ KGR+KG +  G+++ +G F +K+ ++  I S +IEAAR A +R MKR
Sbjct: 1   MLQPRKTKFRKQQKGRMKGNSGRGNQLAYGTFGIKSLDSEFINSRQIEAARIAATRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G +WI +FPD P+T KP EVRMGKGKG VE W   VKPGRILFEI GV  E A+ A RL
Sbjct: 61  EGSLWIKIFPDKPITKKPLEVRMGKGKGAVEYWAAVVKPGRILFEISGVPLETAKEALRL 120

Query: 122 GAAKLSVVTKFIQ 134
            A KL V TKFI 
Sbjct: 121 AAQKLPVKTKFIV 133


>gi|117924162|ref|YP_864779.1| 50S ribosomal protein L16 [Magnetococcus sp. MC-1]
 gi|166199681|sp|A0L5Y0|RL16_MAGSM RecName: Full=50S ribosomal protein L16
 gi|117607918|gb|ABK43373.1| LSU ribosomal protein L16P [Magnetococcus sp. MC-1]
          Length = 137

 Score =  187 bits (475), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 79/135 (58%), Positives = 99/135 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGR+ G+A  GS + FG F LKA    RI + +IEAARRA++R +KR
Sbjct: 1   MLQPKKTKFRKAHKGRVHGLAYRGSSLSFGQFGLKAMATARITARQIEAARRAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPDVPV+ KP EVR GKGKG+ E W+ RVKPGRIL+E++GV E++AR A + 
Sbjct: 61  GGRVWIRIFPDVPVSQKPAEVRQGKGKGSPEFWIARVKPGRILYEMEGVDEQLAREAMQR 120

Query: 122 GAAKLSVVTKFIQRV 136
            AAKL V TKFI R 
Sbjct: 121 AAAKLPVKTKFIVRE 135


>gi|295425645|ref|ZP_06818332.1| 50S ribosomal protein L16 [Lactobacillus amylolyticus DSM 11664]
 gi|295064661|gb|EFG55582.1| 50S ribosomal protein L16 [Lactobacillus amylolyticus DSM 11664]
          Length = 146

 Score =  187 bits (475), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 70/138 (50%), Positives = 91/138 (65%)

Query: 1   MLRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMK 60
           M   PK  K+ ++F+G+++G AKGG  I FG + L A E++ I + +IEAAR A++R MK
Sbjct: 1   MPLVPKRVKHRREFRGKMRGAAKGGKYIAFGEYGLVALESHWITNRQIEAARVAMTRYMK 60

Query: 61  RAGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFR 120
           R G+VWI +FP    TAK   VRMG GKG    WV  VK  +ILFEI GVSEEVAR A R
Sbjct: 61  RGGKVWIRIFPQKSYTAKGVGVRMGSGKGAPAGWVAVVKREKILFEIGGVSEEVAREALR 120

Query: 121 LGAAKLSVVTKFIQRVVE 138
           L + KL + TKF+ +  E
Sbjct: 121 LASTKLPIKTKFVTKSSE 138


>gi|226305348|ref|YP_002765306.1| 50S ribosomal protein L16 [Rhodococcus erythropolis PR4]
 gi|229489542|ref|ZP_04383405.1| ribosomal protein L16 [Rhodococcus erythropolis SK121]
 gi|259646058|sp|C0ZW32|RL16_RHOE4 RecName: Full=50S ribosomal protein L16
 gi|226184463|dbj|BAH32567.1| 50S ribosomal protein L16 [Rhodococcus erythropolis PR4]
 gi|229323639|gb|EEN89397.1| ribosomal protein L16 [Rhodococcus erythropolis SK121]
          Length = 138

 Score =  187 bits (475), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 58/135 (42%), Positives = 86/135 (63%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  K+ KQ      G AKGG+++ FG++ ++A E   I + +IE+AR A++R +KR
Sbjct: 1   MLIPRRVKHRKQHHPSRSGAAKGGTQVTFGDYGIQALEPAYITNRQIESARIAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T KP E RMG GKG+ E W+  VKPGR+LFE+   +EE+AR A R 
Sbjct: 61  GGKIWINIFPDRPLTKKPAETRMGSGKGSPEWWIANVKPGRVLFEMTYPNEEIAREALRR 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL    + + R 
Sbjct: 121 AMHKLPCKCRIVTRE 135


>gi|163786183|ref|ZP_02180631.1| 50S ribosomal protein L16 [Flavobacteriales bacterium ALC-1]
 gi|159878043|gb|EDP72099.1| 50S ribosomal protein L16 [Flavobacteriales bacterium ALC-1]
          Length = 139

 Score =  187 bits (475), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 75/132 (56%), Positives = 91/132 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQ KGR+KG A  G  +  G F +K+ E+  I + +IEAAR A +R MKR
Sbjct: 1   MLQPKRTKFRKQQKGRMKGNAGRGHLLSNGTFGIKSLESTFITARQIEAARIAATRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G +WI +FPD P+T KP EVRMGKGKG VE W   VKPGR+LFEI GV  +VA+ A RL
Sbjct: 61  EGSLWIKIFPDKPITKKPLEVRMGKGKGGVEYWAAVVKPGRMLFEISGVPLDVAQEALRL 120

Query: 122 GAAKLSVVTKFI 133
            A KL V TKFI
Sbjct: 121 AAQKLPVKTKFI 132


>gi|326315231|ref|YP_004232903.1| 50S ribosomal protein L16 [Acidovorax avenae subsp. avenae ATCC
           19860]
 gi|323372067|gb|ADX44336.1| ribosomal protein L16 [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 138

 Score =  187 bits (475), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 75/136 (55%), Positives = 97/136 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QP   KY K+ KGR  GVA  G+ + FG+F LK  +  R+ + +IEAARRAISR +KR
Sbjct: 1   MLQPARRKYRKEQKGRNTGVATRGNSVAFGDFGLKCTDRGRLTARQIEAARRAISRHVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI VFPD P++ KP EVRMG GKGN E +V  ++PG+I+FEI GV EE+AR AFRL
Sbjct: 61  GGRIWIRVFPDKPISTKPAEVRMGNGKGNPEYYVAEIQPGKIVFEIVGVPEELAREAFRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + T F+ R +
Sbjct: 121 AAAKLPLRTTFVARQI 136


>gi|254820464|ref|ZP_05225465.1| 50S ribosomal protein L16 [Mycobacterium intracellulare ATCC 13950]
          Length = 138

 Score =  187 bits (475), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 59/135 (43%), Positives = 87/135 (64%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  K+ KQ   R +G+A GG+ + FG++ ++A E   + + +IE+AR AI+R +KR
Sbjct: 1   MLIPRRVKHRKQHHPRQRGIASGGTAVNFGDYGIQALEHAYVTNRQIESARIAINRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI VFPD P+T KP E RMG GKG+ E WV  VKPGR+LFE+   +E++AR A   
Sbjct: 61  GGKVWINVFPDRPLTKKPAETRMGSGKGSPEWWVVNVKPGRVLFELSYPNEQIARAALTR 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  + + R 
Sbjct: 121 AIHKLPIKARIVTRE 135


>gi|22536250|ref|NP_687101.1| 50S ribosomal protein L16 [Streptococcus agalactiae 2603V/R]
 gi|25010140|ref|NP_734535.1| 50S ribosomal protein L16 [Streptococcus agalactiae NEM316]
 gi|76787110|ref|YP_328791.1| 50S ribosomal protein L16 [Streptococcus agalactiae A909]
 gi|76798229|ref|ZP_00780479.1| ribosomal protein L16 [Streptococcus agalactiae 18RS21]
 gi|77406094|ref|ZP_00783168.1| ribosomal protein L16 [Streptococcus agalactiae H36B]
 gi|77412281|ref|ZP_00788597.1| ribosomal protein L16 [Streptococcus agalactiae CJB111]
 gi|77414574|ref|ZP_00790717.1| ribosomal protein L16 [Streptococcus agalactiae 515]
 gi|228478105|ref|ZP_04062716.1| ribosomal protein L16 [Streptococcus salivarius SK126]
 gi|312862396|ref|ZP_07722639.1| ribosomal protein L16 [Streptococcus vestibularis F0396]
 gi|322515874|ref|ZP_08068816.1| 50S ribosomal protein L16 [Streptococcus vestibularis ATCC 49124]
 gi|81588666|sp|Q8E2C6|RL16_STRA5 RecName: Full=50S ribosomal protein L16
 gi|81588917|sp|Q8E7T3|RL16_STRA3 RecName: Full=50S ribosomal protein L16
 gi|85541824|sp|Q3K3W2|RL16_STRA1 RecName: Full=50S ribosomal protein L16
 gi|22533070|gb|AAM98973.1|AE014194_18 ribosomal protein L16 [Streptococcus agalactiae 2603V/R]
 gi|23094491|emb|CAD45710.1| ribosomal protein L16 [Streptococcus agalactiae NEM316]
 gi|76562167|gb|ABA44751.1| ribosomal protein L16 [Streptococcus agalactiae A909]
 gi|76586438|gb|EAO62946.1| ribosomal protein L16 [Streptococcus agalactiae 18RS21]
 gi|77159372|gb|EAO70540.1| ribosomal protein L16 [Streptococcus agalactiae 515]
 gi|77161671|gb|EAO72666.1| ribosomal protein L16 [Streptococcus agalactiae CJB111]
 gi|77175275|gb|EAO78070.1| ribosomal protein L16 [Streptococcus agalactiae H36B]
 gi|228250285|gb|EEK09538.1| ribosomal protein L16 [Streptococcus salivarius SK126]
 gi|311102039|gb|EFQ60239.1| ribosomal protein L16 [Streptococcus vestibularis F0396]
 gi|319743988|gb|EFV96368.1| 50S ribosomal protein L16 [Streptococcus agalactiae ATCC 13813]
 gi|322125661|gb|EFX96988.1| 50S ribosomal protein L16 [Streptococcus vestibularis ATCC 49124]
          Length = 137

 Score =  187 bits (475), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 68/137 (49%), Positives = 93/137 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ ++F+G+++G AKGG  + FG + L+A  ++ I + +IEAAR A++R MKR
Sbjct: 1   MLVPKRVKHRREFRGKMRGEAKGGKEVSFGEYGLQATTSHWITNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP    TAK   VRMG GKG  E WV  VK G+++FEI GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVAPVKRGKVMFEIAGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            + KL V  KF++R  E
Sbjct: 121 ASHKLPVKCKFVKREAE 137


>gi|195977215|ref|YP_002122459.1| 50S ribosomal protein L16 [Streptococcus equi subsp. zooepidemicus
           MGCS10565]
 gi|225867672|ref|YP_002743620.1| 50S ribosomal protein L16 [Streptococcus equi subsp. zooepidemicus]
 gi|225869543|ref|YP_002745490.1| 50S ribosomal protein L16 [Streptococcus equi subsp. equi 4047]
 gi|226712357|sp|B4U507|RL16_STREM RecName: Full=50S ribosomal protein L16
 gi|254799222|sp|C0M8M3|RL16_STRE4 RecName: Full=50S ribosomal protein L16
 gi|259646061|sp|C0MCB7|RL16_STRS7 RecName: Full=50S ribosomal protein L16
 gi|195973920|gb|ACG61446.1| 50S ribosomal protein L16 [Streptococcus equi subsp. zooepidemicus
           MGCS10565]
 gi|225698947|emb|CAW91980.1| 50S ribosomal protein L16 [Streptococcus equi subsp. equi 4047]
 gi|225700948|emb|CAW97657.1| 50S ribosomal protein L16 [Streptococcus equi subsp. zooepidemicus]
          Length = 137

 Score =  187 bits (475), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 66/137 (48%), Positives = 93/137 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ ++F+G+++G AKGG  + FG + L+A  ++ I + +IEAAR A++R MKR
Sbjct: 1   MLVPKRVKHRREFRGKMRGEAKGGKEVSFGEYGLQATTSSWITNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP    TAK   VRMG GKG  E WV  VK G+++FE+ GVSEE+AR A RL
Sbjct: 61  GGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVAPVKRGKVMFEVAGVSEEIAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            + KL V  KF++R  E
Sbjct: 121 ASHKLPVKCKFVKREAE 137


>gi|34764031|ref|ZP_00144917.1| LSU ribosomal protein L16P [Fusobacterium nucleatum subsp.
           vincentii ATCC 49256]
 gi|237742665|ref|ZP_04573146.1| LSU ribosomal protein L16P [Fusobacterium sp. 4_1_13]
 gi|256846060|ref|ZP_05551518.1| ribosomal protein L16 [Fusobacterium sp. 3_1_36A2]
 gi|294784809|ref|ZP_06750097.1| ribosomal protein L16 [Fusobacterium sp. 3_1_27]
 gi|27886195|gb|EAA23485.1| LSU ribosomal protein L16P [Fusobacterium nucleatum subsp.
           vincentii ATCC 49256]
 gi|229430313|gb|EEO40525.1| LSU ribosomal protein L16P [Fusobacterium sp. 4_1_13]
 gi|256719619|gb|EEU33174.1| ribosomal protein L16 [Fusobacterium sp. 3_1_36A2]
 gi|294486523|gb|EFG33885.1| ribosomal protein L16 [Fusobacterium sp. 3_1_27]
          Length = 141

 Score =  187 bits (475), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 68/135 (50%), Positives = 93/135 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ K F+GR+KG A  G+ + FG++ L+A E + I + +IE+ R AI+R  KR
Sbjct: 1   MLMPKRTKHRKMFRGRMKGAAHKGNFVAFGDYGLQALEPSWITNRQIESCRVAINRTFKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+ +I +FPD P+TA+P  VRMGKGKGNVE WV  V+PGRILFE+ GV+EE A  A R 
Sbjct: 61  EGKTYIRIFPDKPITARPAGVRMGKGKGNVEGWVSVVRPGRILFEVSGVTEEKAAEALRK 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL +  K ++R 
Sbjct: 121 AAMKLPIRCKVVKRE 135


>gi|319948716|ref|ZP_08022837.1| 50S ribosomal protein L16 [Dietzia cinnamea P4]
 gi|319437618|gb|EFV92617.1| 50S ribosomal protein L16 [Dietzia cinnamea P4]
          Length = 138

 Score =  187 bits (475), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 64/135 (47%), Positives = 88/135 (65%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQ      G AKGG+++ FG++ ++A E   + + +IE+AR AI+R +KR
Sbjct: 1   MLIPKRVKHRKQHHPGRSGAAKGGTKVTFGDYGIQALEPAYVTNRQIESARIAINRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI ++PD P+T KP EVRMG GKG+VE WV  VKPGRILFE+   +EE AR A R 
Sbjct: 61  GGKVWINIYPDRPLTKKPAEVRMGSGKGSVEWWVANVKPGRILFEMSYPNEETAREALRR 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL   T+ + R 
Sbjct: 121 AQHKLPCKTRIVTRE 135


>gi|319938500|ref|ZP_08012894.1| 50S ribosomal protein L16 [Coprobacillus sp. 29_1]
 gi|319806416|gb|EFW03083.1| 50S ribosomal protein L16 [Coprobacillus sp. 29_1]
          Length = 136

 Score =  187 bits (475), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 69/134 (51%), Positives = 90/134 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY +  + + +G AKGG+ + FG + L+AQE   I S +IEAAR A++R MKR
Sbjct: 1   MLMPKRTKYRRPHRIKYEGKAKGGTEVSFGEYGLQAQEGAWITSRQIEAARIAMNRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP +  T KP EVRMG GKG  E+WV  VK GR++FE+ GV EEVAR A RL
Sbjct: 61  GGQVWIRIFPHLAKTKKPLEVRMGSGKGAPEEWVAVVKTGRVMFEVAGVEEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQR 135
            + KL +  K I R
Sbjct: 121 ASHKLPIKCKIIGR 134


>gi|46579721|ref|YP_010529.1| 50S ribosomal protein L16 [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120602802|ref|YP_967202.1| 50S ribosomal protein L16 [Desulfovibrio vulgaris DP4]
 gi|81566852|sp|Q72CH3|RL16_DESVH RecName: Full=50S ribosomal protein L16
 gi|166234576|sp|A1VEA9|RL16_DESVV RecName: Full=50S ribosomal protein L16
 gi|46449136|gb|AAS95788.1| ribosomal protein L16 [Desulfovibrio vulgaris str. Hildenborough]
 gi|120563031|gb|ABM28775.1| LSU ribosomal protein L16P [Desulfovibrio vulgaris DP4]
 gi|311233512|gb|ADP86366.1| ribosomal protein L16 [Desulfovibrio vulgaris RCH1]
          Length = 137

 Score =  187 bits (475), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 67/135 (49%), Positives = 86/135 (63%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  K+ K  KGR KGVA  G+ + FG+  LKA E  ++ S +IEAAR A+ R +KR
Sbjct: 1   MLSPRKVKFRKWQKGRNKGVATRGATVAFGDIGLKAIEHGKLTSQQIEAARIAMMRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVTAKP E R G GKG+   W   VKPGR+L+EI GVS E+A+ A   
Sbjct: 61  GGKVWIRIFPDRPVTAKPLETRQGSGKGSPVGWCAPVKPGRVLYEIKGVSLELAKEALTR 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL V T  + R 
Sbjct: 121 AAHKLPVKTVIVVRE 135


>gi|83648845|ref|YP_437280.1| 50S ribosomal protein L16 [Hahella chejuensis KCTC 2396]
 gi|115502753|sp|Q2S919|RL16_HAHCH RecName: Full=50S ribosomal protein L16
 gi|83636888|gb|ABC32855.1| ribosomal protein L16 [Hahella chejuensis KCTC 2396]
          Length = 137

 Score =  187 bits (475), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 76/136 (55%), Positives = 100/136 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGR  G+A+ G+++ FG F LKA    RI + +IEAARR ++R +KR
Sbjct: 1   MLQPKRTKFRKVHKGRNTGLAQRGNKVSFGEFGLKATGRGRITARQIEAARRTMTRRIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T KP EVRMGKGKG VE WV  ++PGR+L+E++GVSEE+AR AF L
Sbjct: 61  GGKIWIRIFPDKPITKKPLEVRMGKGKGPVEYWVAEIEPGRMLYEMEGVSEELAREAFTL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL V T F+ R V
Sbjct: 121 AAAKLPVATTFVTRTV 136


>gi|77409632|ref|ZP_00786305.1| ribosomal protein L16 [Streptococcus agalactiae COH1]
 gi|77171755|gb|EAO74951.1| ribosomal protein L16 [Streptococcus agalactiae COH1]
          Length = 137

 Score =  187 bits (475), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 68/137 (49%), Positives = 93/137 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ ++F+G+++G AKGG  + FG + L+A  ++ I + +IEAAR A++R MKR
Sbjct: 1   MLVPKRVKHRREFRGKMRGEAKGGKEVSFGEYGLQATTSHWITNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP    TAK   VRMG GKG  E WV  VK G+++FEI GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPHKSYTAKAIGVRMGSGKGTPEGWVAPVKRGKVMFEIAGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            + KL V  KF++R  E
Sbjct: 121 ASHKLPVKCKFVKREAE 137


>gi|319940053|ref|ZP_08014407.1| 50S ribosomal protein L16 [Streptococcus anginosus 1_2_62CV]
 gi|319810767|gb|EFW07094.1| 50S ribosomal protein L16 [Streptococcus anginosus 1_2_62CV]
          Length = 137

 Score =  187 bits (475), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 68/137 (49%), Positives = 93/137 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ ++F+G+++G AKGG  + FG + L+A  ++ I + +IEAAR A++R MKR
Sbjct: 1   MLVPKRVKHRREFRGKMRGEAKGGKEVAFGEYGLQATTSHWITNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP    TAK   VRMG GKG  E WV  VK G+++FEI GV EEVAR A RL
Sbjct: 61  GGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVAPVKRGKVMFEIGGVPEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            + KL V TKF++R  E
Sbjct: 121 ASHKLPVKTKFVKREAE 137


>gi|149184318|ref|ZP_01862636.1| 50S ribosomal protein L16 [Erythrobacter sp. SD-21]
 gi|148831638|gb|EDL50071.1| 50S ribosomal protein L16 [Erythrobacter sp. SD-21]
          Length = 144

 Score =  187 bits (475), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 82/137 (59%), Positives = 101/137 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TKY K FKG+I G AKGG+ + FG++ LKA E  RI + +IEAARRAI+R +KR
Sbjct: 1   MLQPKKTKYRKAFKGKIHGKAKGGTTLNFGSYGLKALEPERITARQIEAARRAITRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI VFPDVPV+ KP EVR GKGKG+VE W  RVKPGRILFE+DGV+  +A  AF  
Sbjct: 61  QGRLWIRVFPDVPVSKKPAEVRQGKGKGSVEYWAARVKPGRILFELDGVAGPLAAEAFSR 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            A KL V TK + R+ +
Sbjct: 121 AAMKLPVKTKVVARLGD 137


>gi|317485815|ref|ZP_07944679.1| ribosomal protein L16p/L10e [Bilophila wadsworthia 3_1_6]
 gi|316922921|gb|EFV44143.1| ribosomal protein L16p/L10e [Bilophila wadsworthia 3_1_6]
          Length = 137

 Score =  187 bits (475), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 67/135 (49%), Positives = 84/135 (62%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ K  KGR++G A  G+ I FG+  LK  E  ++ + +IEAAR A+ R +KR
Sbjct: 1   MLAPKRVKFRKWQKGRLRGPALRGATIAFGDIGLKTVEHGKLTNQQIEAARIAMMRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI VFPD PVTAKP E R G GKG    W   VKPGRIL+EI GVS E+A+ A   
Sbjct: 61  GGKVWIRVFPDHPVTAKPLETRQGSGKGAPVGWCAPVKPGRILYEIKGVSLELAKEALTR 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL V T  + R 
Sbjct: 121 AAHKLPVKTVIVVRE 135


>gi|296141108|ref|YP_003648351.1| ribosomal protein L16 [Tsukamurella paurometabola DSM 20162]
 gi|296029242|gb|ADG80012.1| ribosomal protein L16 [Tsukamurella paurometabola DSM 20162]
          Length = 138

 Score =  187 bits (475), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 60/135 (44%), Positives = 87/135 (64%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  K+ KQ   +  G AKGG+ + FG++ ++A E   I + +IE+AR AI+R +KR
Sbjct: 1   MLIPRRVKHRKQHHPKRSGAAKGGTTVAFGDYGIQALEPAYITNRQIESARIAINRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T KP E RMG GKG+ E WV  VKPGR++FE+   +E++AR A R 
Sbjct: 61  GGKVWINIFPDRPLTKKPAETRMGSGKGSPEWWVANVKPGRVMFEMTYPNEQIAREALRR 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL   T+ + R 
Sbjct: 121 AQHKLPCKTRIVTRE 135


>gi|323357365|ref|YP_004223761.1| ribosomal protein L16/L10E [Microbacterium testaceum StLB037]
 gi|323273736|dbj|BAJ73881.1| ribosomal protein L16/L10E [Microbacterium testaceum StLB037]
          Length = 139

 Score =  187 bits (475), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 60/135 (44%), Positives = 85/135 (62%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  KY KQ      G A GG+ + FG F ++A     + + +IE+AR A++R +KR
Sbjct: 1   MLIPRKVKYRKQHHPGRSGQATGGTTVSFGEFGIQALTPAYVTNRQIESARIAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI ++PD P+T KP E RMG GKG+ E WV  VKPGR+LFE+ GV+EE+AR A   
Sbjct: 61  GGKVWINIYPDRPLTKKPAETRMGSGKGSPEWWVANVKPGRVLFEVAGVNEELAREALTR 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  + I+R 
Sbjct: 121 AIHKLPLKARIIKRE 135


>gi|269122574|ref|YP_003310751.1| ribosomal protein L16 [Sebaldella termitidis ATCC 33386]
 gi|268616452|gb|ACZ10820.1| ribosomal protein L16 [Sebaldella termitidis ATCC 33386]
          Length = 141

 Score =  187 bits (475), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 65/135 (48%), Positives = 87/135 (64%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY KQF+G+I GVA  G+ + FG + L A+E   I S +IEA R  I+R  KR
Sbjct: 1   MLIPKRTKYRKQFRGKIGGVATKGNNVDFGEYGLAAKEFGWITSRQIEACRVTINRTFKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P T +P   RMGKGKGN E WV  VK  +I+FE+ GV EE A+ A R 
Sbjct: 61  EGKIWIRIFPDKPYTKRPEGTRMGKGKGNTEGWVAVVKRDKIMFEVGGVPEERAKEALRK 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL +  +F+++ 
Sbjct: 121 AAHKLPIKCRFVKKE 135


>gi|153869562|ref|ZP_01999136.1| Ribosomal protein L16 [Beggiatoa sp. PS]
 gi|152073948|gb|EDN70860.1| Ribosomal protein L16 [Beggiatoa sp. PS]
          Length = 137

 Score =  187 bits (475), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 84/136 (61%), Positives = 104/136 (76%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TKY KQ KGR +G+A+ G ++ FG F LKA    +I + +IEAARRAI+R +KR
Sbjct: 1   MLQPKRTKYRKQQKGRNRGLAQSGHKVSFGEFGLKACGHGKITARQIEAARRAITRYVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD P+T KP EVRMGKGKGNVE WV  V+PGR+L+EI+GV E VAR+AFRL
Sbjct: 61  GGKLWIRVFPDKPITKKPLEVRMGKGKGNVEYWVALVQPGRMLYEIEGVPEIVARQAFRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKLSV T F+ R V
Sbjct: 121 AAAKLSVPTTFVMRTV 136


>gi|146216961|ref|YP_001122786.2| 50S ribosomal protein L16 [Phaseolus vulgaris]
 gi|215275622|sp|A4GG85|RK16_PHAVU RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|145203174|gb|ABH88066.2| 50S ribosomal protein L16 [Phaseolus vulgaris]
 gi|158187169|gb|ABW22802.1| ribosomal protein L16 [Phaseolus vulgaris]
          Length = 135

 Score =  187 bits (475), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 66/132 (50%), Positives = 97/132 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+ T++ KQ +GR+KG++  G+RICFG +AL+A E   I S +IEA RRA+SR ++R
Sbjct: 1   MLSPQRTRFRKQHRGRMKGISSRGNRICFGRYALQALEPAWITSRQIEAGRRAMSRNVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +PTE RMG GKG  E WV  VKPG+IL+E+ GV E +AR+A  +
Sbjct: 61  GGQIWVRIFPDKPVTVRPTETRMGSGKGFPEYWVAVVKPGKILYEMGGVPENIARKAISI 120

Query: 122 GAAKLSVVTKFI 133
            ++K+ + T+FI
Sbjct: 121 ASSKMPIRTQFI 132


>gi|78484647|ref|YP_390572.1| 50S ribosomal protein L16 [Thiomicrospira crunogena XCL-2]
 gi|115504862|sp|Q31IX5|RL16_THICR RecName: Full=50S ribosomal protein L16
 gi|78362933|gb|ABB40898.1| LSU ribosomal protein L16P [Thiomicrospira crunogena XCL-2]
          Length = 137

 Score =  187 bits (475), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 76/136 (55%), Positives = 98/136 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ K  KGR +G+A  G++I FG F LKA E  R+ S +IEAARR ++R +KR
Sbjct: 1   MLMPKRTKFRKMHKGRNRGLANVGNKISFGEFGLKAMERGRMTSRQIEAARRVMTRKVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
             ++WI VFPD P+T KP EVRMGKGKG+VE WV +V+PGR+L+E+ GV E VAR AF L
Sbjct: 61  GAKIWIRVFPDKPITNKPLEVRMGKGKGSVEYWVAQVQPGRVLYEMQGVDEVVAREAFEL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL   T+F+ R V
Sbjct: 121 AAAKLPFKTQFVTRTV 136


>gi|15674294|ref|NP_268467.1| 50S ribosomal protein L16 [Streptococcus pyogenes M1 GAS]
 gi|19745248|ref|NP_606384.1| 50S ribosomal protein L16 [Streptococcus pyogenes MGAS8232]
 gi|21909583|ref|NP_663851.1| 50S ribosomal protein L16 [Streptococcus pyogenes MGAS315]
 gi|28894961|ref|NP_801311.1| 50S ribosomal protein L16 [Streptococcus pyogenes SSI-1]
 gi|50913446|ref|YP_059418.1| 50S ribosomal protein L16 [Streptococcus pyogenes MGAS10394]
 gi|71902716|ref|YP_279519.1| 50S ribosomal protein L16 [Streptococcus pyogenes MGAS6180]
 gi|71909865|ref|YP_281415.1| 50S ribosomal protein L16 [Streptococcus pyogenes MGAS5005]
 gi|94987682|ref|YP_595783.1| 50S ribosomal protein L16 [Streptococcus pyogenes MGAS9429]
 gi|94989562|ref|YP_597662.1| 50S ribosomal protein L16 [Streptococcus pyogenes MGAS10270]
 gi|94991552|ref|YP_599651.1| 50S ribosomal protein L16 [Streptococcus pyogenes MGAS2096]
 gi|94993450|ref|YP_601548.1| 50S ribosomal protein L16 [Streptococcus pyogenes MGAS10750]
 gi|139472934|ref|YP_001127649.1| 50S ribosomal protein L16 [Streptococcus pyogenes str. Manfredo]
 gi|209558634|ref|YP_002285106.1| 50S ribosomal protein L16 [Streptococcus pyogenes NZ131]
 gi|306828253|ref|ZP_07461513.1| 50S ribosomal protein L16 [Streptococcus pyogenes ATCC 10782]
 gi|81602278|sp|Q5XEC8|RL16_STRP6 RecName: Full=50S ribosomal protein L16
 gi|81620871|sp|Q9A1W7|RL16_STRP1 RecName: Full=50S ribosomal protein L16
 gi|81653246|sp|Q7CNP9|RL16_STRP8 RecName: Full=50S ribosomal protein L16
 gi|81706788|sp|Q7CFL2|RL16_STRP3 RecName: Full=50S ribosomal protein L16
 gi|85541825|sp|Q48VU2|RL16_STRPM RecName: Full=50S ribosomal protein L16
 gi|115502798|sp|Q1JE51|RL16_STRPB RecName: Full=50S ribosomal protein L16
 gi|115502799|sp|Q1JP10|RL16_STRPC RecName: Full=50S ribosomal protein L16
 gi|115502800|sp|Q1JJ55|RL16_STRPD RecName: Full=50S ribosomal protein L16
 gi|115502801|sp|Q1J907|RL16_STRPF RecName: Full=50S ribosomal protein L16
 gi|166216113|sp|A2RC21|RL16_STRPG RecName: Full=50S ribosomal protein L16
 gi|226712364|sp|B5XJ43|RL16_STRPZ RecName: Full=50S ribosomal protein L16
 gi|13621375|gb|AAK33189.1| 50S ribosomal protein L16 [Streptococcus pyogenes M1 GAS]
 gi|19747342|gb|AAL96883.1| 50S ribosomal protein L16 [Streptococcus pyogenes MGAS8232]
 gi|21903764|gb|AAM78654.1| 50S ribosomal protein L16 [Streptococcus pyogenes MGAS315]
 gi|28810206|dbj|BAC63144.1| 50S ribosomal protein L16 [Streptococcus pyogenes SSI-1]
 gi|50902520|gb|AAT86235.1| LSU ribosomal protein L16P [Streptococcus pyogenes MGAS10394]
 gi|71801811|gb|AAX71164.1| LSU ribosomal protein L16P [Streptococcus pyogenes MGAS6180]
 gi|71852647|gb|AAZ50670.1| LSU ribosomal protein L16P [Streptococcus pyogenes MGAS5005]
 gi|94541190|gb|ABF31239.1| LSU ribosomal protein L16P [Streptococcus pyogenes MGAS9429]
 gi|94543070|gb|ABF33118.1| LSU ribosomal protein L16P [Streptococcus pyogenes MGAS10270]
 gi|94545060|gb|ABF35107.1| LSU ribosomal protein L16P [Streptococcus pyogenes MGAS2096]
 gi|94546958|gb|ABF37004.1| LSU ribosomal protein L16P [Streptococcus pyogenes MGAS10750]
 gi|134271180|emb|CAM29393.1| 50S ribosomal protein L16 [Streptococcus pyogenes str. Manfredo]
 gi|209539835|gb|ACI60411.1| LSU ribosomal protein L16p (L10e) [Streptococcus pyogenes NZ131]
 gi|304429564|gb|EFM32613.1| 50S ribosomal protein L16 [Streptococcus pyogenes ATCC 10782]
          Length = 137

 Score =  186 bits (474), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 67/137 (48%), Positives = 93/137 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ ++F+G+++G AKGG  + FG + L+A  ++ I + +IEAAR A++R MKR
Sbjct: 1   MLVPKRVKHRREFRGKMRGEAKGGKEVSFGEYGLQATTSHWITNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP    TAK   VRMG GKG  E WV  VK G+++FEI GVSEE+AR A RL
Sbjct: 61  GGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVAPVKRGKVMFEIAGVSEEIAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            + KL V  KF++R  E
Sbjct: 121 ASHKLPVKCKFVKREAE 137


>gi|289209322|ref|YP_003461388.1| ribosomal protein L16 [Thioalkalivibrio sp. K90mix]
 gi|288944953|gb|ADC72652.1| ribosomal protein L16 [Thioalkalivibrio sp. K90mix]
          Length = 137

 Score =  186 bits (474), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 82/136 (60%), Positives = 105/136 (77%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQFKGR +G+A  G+++ FG + L+A E  RI + +IEAARRA+ R +KR
Sbjct: 1   MLQPKRTKFRKQFKGRNRGMASTGAKVSFGEYGLQAVERGRITARQIEAARRAMVRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPDVPVT KP EVRMGKGKG VE WVC+V+PGR+L+E++GV E+VAR A RL
Sbjct: 61  GGKIWIRVFPDVPVTKKPLEVRMGKGKGGVEYWVCKVQPGRMLYEMEGVHEDVAREAMRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL V T F +R V
Sbjct: 121 AAAKLPVKTVFTRRQV 136


>gi|121603127|ref|YP_980456.1| 50S ribosomal protein L16 [Polaromonas naphthalenivorans CJ2]
 gi|166199700|sp|A1VIQ7|RL16_POLNA RecName: Full=50S ribosomal protein L16
 gi|120592096|gb|ABM35535.1| LSU ribosomal protein L16P [Polaromonas naphthalenivorans CJ2]
          Length = 138

 Score =  186 bits (474), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 73/136 (53%), Positives = 99/136 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QP   KY K+ KGR  GVA  G+ + FG+F LK  +  R+ + ++EAARRAISR +KR
Sbjct: 1   MLQPARRKYRKEQKGRNTGVATRGNSVAFGDFGLKCTDRGRLTARQLEAARRAISRHVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI VFPD P++ KP EVRMG GKGN E +V  ++PG+I+FEI GV+EE+AR AFRL
Sbjct: 61  GGRIWIRVFPDKPISQKPAEVRMGNGKGNPEYYVAEIQPGKIVFEIVGVTEELAREAFRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            +AKL + T F+ R++
Sbjct: 121 ASAKLPLRTTFVSRMI 136


>gi|298207734|ref|YP_003715913.1| 50S ribosomal protein L16 [Croceibacter atlanticus HTCC2559]
 gi|83850371|gb|EAP88239.1| 50S ribosomal protein L16 [Croceibacter atlanticus HTCC2559]
          Length = 141

 Score =  186 bits (474), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 76/133 (57%), Positives = 95/133 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TKY KQ KGR+KG+A+ G R+  G F LK+ +++ I + +IEAAR A +R MKR
Sbjct: 1   MLQPKRTKYRKQQKGRMKGLAQRGHRLSSGTFGLKSLDSSFITARQIEAARIAATRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G +WI +FPD P+T KP EVRMGKGKG VE W   VKPGRI+FE+ GV+ E A+ A RL
Sbjct: 61  EGSIWIMIFPDKPITKKPLEVRMGKGKGAVEYWAAVVKPGRIMFELGGVNMETAKEALRL 120

Query: 122 GAAKLSVVTKFIQ 134
            A KL V TKFI 
Sbjct: 121 AAQKLPVRTKFIV 133


>gi|28377839|ref|NP_784731.1| 50S ribosomal protein L16 [Lactobacillus plantarum WCFS1]
 gi|254556024|ref|YP_003062441.1| 50S ribosomal protein L16 [Lactobacillus plantarum JDM1]
 gi|300767828|ref|ZP_07077738.1| 50S ribosomal protein L16 [Lactobacillus plantarum subsp. plantarum
           ATCC 14917]
 gi|308180018|ref|YP_003924146.1| 50S ribosomal protein L16 [Lactobacillus plantarum subsp. plantarum
           ST-III]
 gi|81631772|sp|Q88XX9|RL16_LACPL RecName: Full=50S ribosomal protein L16
 gi|28270672|emb|CAD63578.1| ribosomal protein L16 [Lactobacillus plantarum WCFS1]
 gi|254044951|gb|ACT61744.1| 50S ribosomal protein L16 [Lactobacillus plantarum JDM1]
 gi|300494813|gb|EFK29971.1| 50S ribosomal protein L16 [Lactobacillus plantarum subsp. plantarum
           ATCC 14917]
 gi|308045509|gb|ADN98052.1| 50S ribosomal protein L16 [Lactobacillus plantarum subsp. plantarum
           ST-III]
          Length = 144

 Score =  186 bits (474), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 63/135 (46%), Positives = 86/135 (63%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +  +G+++G AKGG  + FG++ L+  E++ I + +IEAAR A++R MKR
Sbjct: 1   MLVPKRVKYRRVHRGKMRGEAKGGKTVAFGDYGLQTLESHWISNRQIEAARVAMNRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP    T K   VRMG GKG    WV  VK  +I+FE+ GV EEVAR A RL
Sbjct: 61  GGKVWIKIFPHKSYTEKGVGVRMGNGKGTPAGWVAPVKRNKIMFEVAGVPEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL V TK ++R 
Sbjct: 121 AGTKLPVKTKIVKRE 135


>gi|167838205|ref|ZP_02465064.1| 50S ribosomal protein L16 [Burkholderia thailandensis MSMB43]
          Length = 138

 Score =  186 bits (474), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 73/135 (54%), Positives = 98/135 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK  KY K+ KGR  G+A  G+ + FG F LKA    R+ + +IEAARRA++R +KR
Sbjct: 1   MLQPKRRKYRKEQKGRNTGIATRGNAVSFGEFGLKAVGRGRLTARQIEAARRAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI +FPD P++ KP EVRMG GKGN E +V  ++PG++L+E+DGV+EE+AR AFRL
Sbjct: 61  GGRIWIRIFPDKPISQKPAEVRMGNGKGNPEYYVAEIQPGKMLYEMDGVTEELAREAFRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            AAKL + T FI R 
Sbjct: 121 AAAKLPLKTTFIVRQ 135


>gi|156597969|gb|ABU85251.1| ribosomal protein L16 [Cycas micronesica]
          Length = 138

 Score =  186 bits (474), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 68/134 (50%), Positives = 94/134 (70%), Gaps = 1/134 (0%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKG-GSRICFGNFALKAQEANRIGSSEIEAARRAISRGMK 60
           +  PK TK+ KQ +GR+KGV+   G+RICFG FAL+A E   I S +IEA RRAI+R  +
Sbjct: 1   MLSPKRTKFRKQHRGRMKGVSYRRGNRICFGRFALQALEPAWITSGQIEAGRRAITRYAR 60

Query: 61  RAGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFR 120
           R G++W+ +FPD P+T +P E RMG GKG+ E WV  ++P RIL+E+ GVSE VAR A  
Sbjct: 61  RGGKIWVRIFPDKPITMRPAETRMGSGKGSPEYWVSVIRPYRILYEMGGVSETVARAATE 120

Query: 121 LGAAKLSVVTKFIQ 134
           + A K+ + T+F+ 
Sbjct: 121 IAAYKMPIRTRFVT 134


>gi|225873071|ref|YP_002754530.1| ribosomal protein L16 [Acidobacterium capsulatum ATCC 51196]
 gi|254799170|sp|C1F635|RL16_ACIC5 RecName: Full=50S ribosomal protein L16
 gi|225793567|gb|ACO33657.1| ribosomal protein L16 [Acidobacterium capsulatum ATCC 51196]
          Length = 144

 Score =  186 bits (474), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 65/134 (48%), Positives = 93/134 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY KQ +GR++G A  GS + FG++ LK  E   I   +IEA+R A++R +KR
Sbjct: 1   MLMPKKVKYRKQQRGRMRGKAWRGSELSFGDYGLKVMECGYITDRQIEASRIAMTRFIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD P+T KP E RMGKGKG  + WV  V+PG++LFE++GVS E+A+ A RL
Sbjct: 61  GGKIWLRLFPDKPITKKPAETRMGKGKGAPDHWVAVVRPGKVLFEMEGVSPEMAQEAMRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + T+F+ R
Sbjct: 121 AANKLPLKTRFVMR 134


>gi|260592758|ref|ZP_05858216.1| ribosomal protein L16 [Prevotella veroralis F0319]
 gi|288803940|ref|ZP_06409363.1| ribosomal protein L16 [Prevotella melaninogenica D18]
 gi|302345081|ref|YP_003813434.1| ribosomal protein L16 [Prevotella melaninogenica ATCC 25845]
 gi|260535289|gb|EEX17906.1| ribosomal protein L16 [Prevotella veroralis F0319]
 gi|288333573|gb|EFC72025.1| ribosomal protein L16 [Prevotella melaninogenica D18]
 gi|302149093|gb|ADK95355.1| ribosomal protein L16 [Prevotella melaninogenica ATCC 25845]
          Length = 142

 Score =  186 bits (474), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 72/135 (53%), Positives = 93/135 (68%), Gaps = 1/135 (0%)

Query: 2   LRQPKNTKYPKQFKGR-IKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMK 60
           + QPK  KY +   GR  KG A  G+++ FG+F +K  EA  I S +IEAAR A++R M 
Sbjct: 1   MLQPKRVKYRRPQDGRGNKGNAHRGTQLAFGSFGIKTLEAKWIDSRQIEAARIAVNRYMN 60

Query: 61  RAGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFR 120
           R G+VWI +FPD P+T KP +VRMGKGKG+   WV  V PGR+LFE++GVS ++A+ A R
Sbjct: 61  RQGQVWIRIFPDKPITRKPADVRMGKGKGDPAGWVAPVTPGRVLFEVEGVSFDIAKEALR 120

Query: 121 LGAAKLSVVTKFIQR 135
           L A KL V TKFI R
Sbjct: 121 LAAQKLPVKTKFIVR 135


>gi|317046210|ref|YP_004072499.1| ribosomal protein L16 [Corynocarpus laevigata]
 gi|309252927|gb|ADO60347.1| ribosomal protein L16 [Corynocarpus laevigata]
          Length = 135

 Score =  186 bits (474), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 66/132 (50%), Positives = 96/132 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ K  +GR+KG++  G+RICFG +AL+  E   I S +IEA RRA++R  +R
Sbjct: 1   MLSPKRTRFRKHHRGRMKGISYRGNRICFGRYALQTLEPAWITSRQIEAGRRAMTRNARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +PTE RMG GKG+ E WV  VKPGRIL+E+ GV+E +AR+A  +
Sbjct: 61  GGKIWVRIFPDKPVTVRPTETRMGSGKGSPEYWVAVVKPGRILYEMGGVAENIARKAISI 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+FI
Sbjct: 121 AASKMPIRTQFI 132


>gi|149390577|ref|YP_001294222.1| ribosomal protein L16 [Buxus microphylla]
 gi|215275549|sp|A6MM74|RK16_BUXMI RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|146762322|gb|ABQ45286.1| ribosomal protein L16 [Buxus microphylla]
          Length = 136

 Score =  186 bits (474), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 70/133 (52%), Positives = 97/133 (72%), Gaps = 1/133 (0%)

Query: 2   LRQ-PKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMK 60
           +   PK T++ KQ +GR+KG++  G+RICFG +AL+A E   I S +IEA RRA++R  +
Sbjct: 1   MLSNPKRTRFRKQHRGRMKGISYRGNRICFGRYALQALEPTWITSRQIEAGRRAMTRYAR 60

Query: 61  RAGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFR 120
           R G++W+ +FPD PVT +PTE RMG GKG+ E WV  VKPGRIL+E+ GVSE VAR A  
Sbjct: 61  RGGKIWVRIFPDKPVTVRPTETRMGSGKGSPEYWVSVVKPGRILYEMGGVSEIVAREAIS 120

Query: 121 LGAAKLSVVTKFI 133
           + A+K+ + T+FI
Sbjct: 121 IAASKMPIRTQFI 133


>gi|29348129|ref|NP_811632.1| 50S ribosomal protein L16 [Bacteroides thetaiotaomicron VPI-5482]
 gi|253569598|ref|ZP_04847008.1| 50S ribosomal protein L16 [Bacteroides sp. 1_1_6]
 gi|298386187|ref|ZP_06995744.1| ribosomal protein L16 [Bacteroides sp. 1_1_14]
 gi|81586839|sp|Q8A483|RL16_BACTN RecName: Full=50S ribosomal protein L16
 gi|29340032|gb|AAO77826.1| 50S ribosomal protein L16 [Bacteroides thetaiotaomicron VPI-5482]
 gi|251841617|gb|EES69698.1| 50S ribosomal protein L16 [Bacteroides sp. 1_1_6]
 gi|298261415|gb|EFI04282.1| ribosomal protein L16 [Bacteroides sp. 1_1_14]
          Length = 144

 Score =  186 bits (474), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 70/134 (52%), Positives = 95/134 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ +Q KGR KG A+ G+++ FG+F +KA E   I   +IEAAR A++R M+R
Sbjct: 1   MLQPKKTKFRRQQKGRAKGNAQRGNQLAFGSFGIKALETKWITGRQIEAARIAVTRYMQR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T KP +VRMGKGKG  E +V  V PGRI+ E +GVS E+A+ A RL
Sbjct: 61  QGQIWIRIFPDKPITRKPADVRMGKGKGAPEGFVAPVTPGRIIIEAEGVSYEIAKEALRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + TKF+ R
Sbjct: 121 AAQKLPITTKFVVR 134


>gi|213693081|ref|YP_002323667.1| ribosomal protein L16 [Bifidobacterium longum subsp. infantis ATCC
           15697]
 gi|296454863|ref|YP_003662007.1| 50S ribosomal protein L16 [Bifidobacterium longum subsp. longum
           JDM301]
 gi|254799181|sp|B7GND3|RL16_BIFLI RecName: Full=50S ribosomal protein L16
 gi|213524542|gb|ACJ53289.1| ribosomal protein L16 [Bifidobacterium longum subsp. infantis ATCC
           15697]
 gi|296184295|gb|ADH01177.1| ribosomal protein L16 [Bifidobacterium longum subsp. longum JDM301]
 gi|320459259|dbj|BAJ69880.1| 50S ribosomal protein L16 [Bifidobacterium longum subsp. infantis
           ATCC 15697]
          Length = 139

 Score =  186 bits (474), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 62/135 (45%), Positives = 87/135 (64%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY KQ +    G++KGG+ I FG+F +++     + + +IEAAR A++R +KR
Sbjct: 1   MLIPKRTKYRKQHRPVRSGMSKGGNEINFGDFGIQSLAPAYVTNRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPD P+T  P   RMG GKG  E W+  V+PGR++FEI GVSE+VA+ A R 
Sbjct: 61  GGRVWITIFPDRPLTKHPLGARMGSGKGAPEFWIANVRPGRVMFEIGGVSEDVAKEALRR 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  + I R 
Sbjct: 121 AIDKLPMKCRIIARE 135


>gi|302669968|ref|YP_003829928.1| ribosomal protein L16 RplP [Butyrivibrio proteoclasticus B316]
 gi|302394441|gb|ADL33346.1| ribosomal protein L16 RplP [Butyrivibrio proteoclasticus B316]
          Length = 145

 Score =  186 bits (474), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 61/134 (45%), Positives = 85/134 (63%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQF+G +      G++I +G + + A E   I S++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKHRKQFRGSMAHKITRGNKITYGEYGIVALEPCWINSNQIEAARVAMTRFIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T KP   RMG GKG  ++WV  VKPGR++FEI GV+E  AR A RL
Sbjct: 61  GGQVWIKIFPDKPITLKPLGTRMGSGKGATDRWVAVVKPGRVMFEIGGVAEADAREALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL    K + +
Sbjct: 121 ATHKLPCRCKIVSK 134


>gi|307297387|ref|ZP_07577193.1| ribosomal protein L16 [Thermotogales bacterium mesG1.Ag.4.2]
 gi|306916647|gb|EFN47029.1| ribosomal protein L16 [Thermotogales bacterium mesG1.Ag.4.2]
          Length = 141

 Score =  186 bits (474), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 64/134 (47%), Positives = 93/134 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY KQ +G++ G AKGG+ + FG + +KA E + I + +IE+ R AI+R +KR
Sbjct: 1   MLMPKRVKYRKQQRGKMNGKAKGGTIVHFGEWGIKALEPHWITAQQIESCRIAITRTLKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G +WI +FPD P+T+K   VRMGKGKG+VE WV  VKPG+++FEI GV +++A+ A   
Sbjct: 61  NGNLWIRIFPDKPITSKGIGVRMGKGKGDVEGWVAVVKPGKVMFEIGGVPDQLAKEALEK 120

Query: 122 GAAKLSVVTKFIQR 135
            A+KL + TK + R
Sbjct: 121 AASKLPIRTKIVPR 134


>gi|258513647|ref|YP_003189869.1| 50S ribosomal protein L16 [Desulfotomaculum acetoxidans DSM 771]
 gi|257777352|gb|ACV61246.1| ribosomal protein L16 [Desulfotomaculum acetoxidans DSM 771]
          Length = 143

 Score =  186 bits (474), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 74/134 (55%), Positives = 96/134 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY +  +G IKG  KGG  + FG F L+A EA+ I + +IEAAR A++R +KR
Sbjct: 1   MLIPKRVKYRRPHRGGIKGKTKGGKEVNFGEFGLQALEASWITNRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+TAKP E RMG GKG+ E WV  VKPGRI+FE+ GVSEE+AR A RL
Sbjct: 61  GGQVWIRIFPDKPITAKPAETRMGSGKGSPEHWVAVVKPGRIMFELAGVSEEIAREAMRL 120

Query: 122 GAAKLSVVTKFIQR 135
            + KL + TKF++R
Sbjct: 121 ASHKLPIKTKFVKR 134


>gi|209521378|ref|ZP_03270091.1| ribosomal protein L16 [Burkholderia sp. H160]
 gi|295677925|ref|YP_003606449.1| ribosomal protein L16 [Burkholderia sp. CCGE1002]
 gi|209498198|gb|EDZ98340.1| ribosomal protein L16 [Burkholderia sp. H160]
 gi|295437768|gb|ADG16938.1| ribosomal protein L16 [Burkholderia sp. CCGE1002]
          Length = 138

 Score =  186 bits (474), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 74/135 (54%), Positives = 98/135 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK  KY K+ KGR  GVA  G+ + FG F LKA    R+ + +IEAARRA++R +KR
Sbjct: 1   MLQPKRRKYRKEQKGRNTGVATRGNAVSFGEFGLKAVGRGRLTARQIEAARRAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI +FPD P++ KP EVRMG GKGN E +V  ++PG++L+E+DGV+EE+AR AFRL
Sbjct: 61  GGRIWIRIFPDKPISTKPAEVRMGNGKGNPEYYVAEIQPGKMLYEMDGVTEELAREAFRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            AAKL + T FI R 
Sbjct: 121 AAAKLPLKTTFIVRQ 135


>gi|282858367|ref|ZP_06267547.1| ribosomal protein L16 [Prevotella bivia JCVIHMP010]
 gi|325269528|ref|ZP_08136144.1| 50S ribosomal protein L16 [Prevotella multiformis DSM 16608]
 gi|325856029|ref|ZP_08171918.1| ribosomal protein L16 [Prevotella denticola CRIS 18C-A]
 gi|327313197|ref|YP_004328634.1| 50S ribosomal protein L16 [Prevotella denticola F0289]
 gi|282588815|gb|EFB93940.1| ribosomal protein L16 [Prevotella bivia JCVIHMP010]
 gi|324988147|gb|EGC20114.1| 50S ribosomal protein L16 [Prevotella multiformis DSM 16608]
 gi|325483701|gb|EGC86665.1| ribosomal protein L16 [Prevotella denticola CRIS 18C-A]
 gi|326946354|gb|AEA22239.1| ribosomal protein L16 [Prevotella denticola F0289]
          Length = 142

 Score =  186 bits (474), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 72/135 (53%), Positives = 93/135 (68%), Gaps = 1/135 (0%)

Query: 2   LRQPKNTKYPKQFKGR-IKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMK 60
           + QPK  KY +   GR  KG A  G+++ FG+F +K  EA  I S +IEAAR A++R M 
Sbjct: 1   MLQPKRVKYRRPQDGRGNKGNAHRGTQLAFGSFGIKTLEAKWIDSRQIEAARVAVNRYMN 60

Query: 61  RAGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFR 120
           R G+VWI +FPD P+T KP +VRMGKGKG+   WV  V PGR+LFE++GVS ++A+ A R
Sbjct: 61  RQGQVWIRIFPDKPITRKPADVRMGKGKGDPAGWVAPVTPGRVLFEVEGVSFDIAKEALR 120

Query: 121 LGAAKLSVVTKFIQR 135
           L A KL V TKFI R
Sbjct: 121 LAAQKLPVKTKFIVR 135


>gi|113170447|ref|YP_717239.1| Rpl16 [Ostreococcus tauri]
 gi|115502626|sp|Q0P3L6|RK16_OSTTA RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|112806854|emb|CAL36361.1| Rpl16 [Ostreococcus tauri]
          Length = 141

 Score =  186 bits (474), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 69/134 (51%), Positives = 91/134 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY K  +G  KG A  G++I FG+FAL+A E   I S +IEA RRA+SR  KR
Sbjct: 1   MLSPKRTKYRKPHRGNRKGQALRGNKISFGDFALQALEPGWITSRQIEAGRRAMSRYAKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD  +TA+  E RMG GKG  + WVC VKPG+IL+E+ GV E +AR + R+
Sbjct: 61  GGKLWIRMFPDRSITARAAETRMGAGKGAPDYWVCIVKPGKILYELAGVPETIARASMRI 120

Query: 122 GAAKLSVVTKFIQR 135
            A K+ V TKF+ R
Sbjct: 121 AAYKMPVKTKFLVR 134


>gi|304384282|ref|ZP_07366693.1| 50S ribosomal protein L16 [Prevotella marshii DSM 16973]
 gi|304334598|gb|EFM00880.1| 50S ribosomal protein L16 [Prevotella marshii DSM 16973]
          Length = 142

 Score =  186 bits (474), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 75/135 (55%), Positives = 95/135 (70%), Gaps = 1/135 (0%)

Query: 2   LRQPKNTKYPKQFKGR-IKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMK 60
           + QPK  KY +   GR  KG A  G+++ FG+F +K  EA  I S +IEAAR A++R M+
Sbjct: 1   MLQPKRVKYRRPQDGRGNKGNASRGTQLAFGSFGIKTLEAKWIDSRQIEAARVAVNRYMQ 60

Query: 61  RAGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFR 120
           R G+VWI +FPD P+T KP +VRMGKGKG+V  WV  V PGRILFE++GVS +VA+ A R
Sbjct: 61  REGQVWIRIFPDKPITRKPADVRMGKGKGDVAGWVAPVTPGRILFEVEGVSFDVAKEALR 120

Query: 121 LGAAKLSVVTKFIQR 135
           L A KL V TKFI R
Sbjct: 121 LAAQKLPVKTKFIVR 135


>gi|294142926|ref|YP_003558904.1| 50S ribosomal protein L16 [Shewanella violacea DSS12]
 gi|293329395|dbj|BAJ04126.1| ribosomal protein L16 [Shewanella violacea DSS12]
          Length = 136

 Score =  186 bits (474), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 77/136 (56%), Positives = 106/136 (77%), Gaps = 1/136 (0%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K FKGR +G+A  G+ + FG+F LKA    R+ + +IEAARRA++R +KR
Sbjct: 1   MLQPKRTKFRKMFKGRNRGLA-NGTEVSFGDFGLKAVGRGRLTARQIEAARRAMTRHIKR 59

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD P+T+KP EVRMGKGKGNVE WVC+++PG++L+E+DGVSEE+AR AF L
Sbjct: 60  QGQIWIRVFPDKPITSKPLEVRMGKGKGNVEYWVCQIQPGKVLYEMDGVSEELAREAFAL 119

Query: 122 GAAKLSVVTKFIQRVV 137
            A+KL + T F+ + V
Sbjct: 120 AASKLPLKTTFVTKSV 135


>gi|302388081|ref|YP_003823903.1| ribosomal protein L16 [Clostridium saccharolyticum WM1]
 gi|302198709|gb|ADL06280.1| ribosomal protein L16 [Clostridium saccharolyticum WM1]
          Length = 141

 Score =  186 bits (474), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 71/134 (52%), Positives = 85/134 (63%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K  KQF+G + G A  G+ I  G F L A E   I S++IEAAR A++R +KR
Sbjct: 1   MLMPKRVKRRKQFRGSMAGKALRGNVISNGEFGLVATEPCWIKSNQIEAARVAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVTAKP E RMG GKG +E WV  VKPGR+LFEI GV EE AR A RL
Sbjct: 61  GGKVWIKIFPDKPVTAKPAETRMGSGKGALEYWVAVVKPGRVLFEIAGVPEETAREALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL    K   +
Sbjct: 121 AMHKLPCKCKIAAK 134


>gi|225076402|ref|ZP_03719601.1| hypothetical protein NEIFLAOT_01447 [Neisseria flavescens
           NRL30031/H210]
 gi|241759625|ref|ZP_04757726.1| ribosomal protein L16 [Neisseria flavescens SK114]
 gi|261380566|ref|ZP_05985139.1| ribosomal protein L16 [Neisseria subflava NJ9703]
 gi|224952250|gb|EEG33459.1| hypothetical protein NEIFLAOT_01447 [Neisseria flavescens
           NRL30031/H210]
 gi|241319997|gb|EER56378.1| ribosomal protein L16 [Neisseria flavescens SK114]
 gi|284796534|gb|EFC51881.1| ribosomal protein L16 [Neisseria subflava NJ9703]
          Length = 138

 Score =  186 bits (474), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 73/136 (53%), Positives = 96/136 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QP   KY KQ KGR  G+A  G+++ FG F LKA    R+ + +IEAARR ++R +KR
Sbjct: 1   MLQPTRLKYRKQQKGRNTGIATRGNKVSFGEFGLKAVGRGRLTARQIEAARRTMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI VFPD P+T KP +VRMG GKGNVE ++  VKPG++L+E+DGV E +AR AF L
Sbjct: 61  GGRIWIRVFPDKPITEKPIQVRMGGGKGNVEYYIAEVKPGKVLYEMDGVPESLAREAFEL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + T F+ R V
Sbjct: 121 AAAKLPIPTTFVVRQV 136


>gi|320108389|ref|YP_004183979.1| 50S ribosomal protein L16 [Terriglobus saanensis SP1PR4]
 gi|319926910|gb|ADV83985.1| ribosomal protein L16 [Terriglobus saanensis SP1PR4]
          Length = 143

 Score =  186 bits (474), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 66/134 (49%), Positives = 94/134 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY KQ KG+++G A  GS + FG++ LK  E   I   +IEA+R A++R +KR
Sbjct: 1   MLMPKKVKYRKQQKGKMRGKAWRGSELAFGDYGLKVLECGYITDRQIEASRIAMTRFIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VW+ +FPD P+T KP EVRMG GKG ++ WV  V+PG++LFE++GV+ E+AR A RL
Sbjct: 61  GGKVWLRIFPDKPITKKPAEVRMGSGKGALDHWVAVVRPGKLLFEMEGVTPEIAREAMRL 120

Query: 122 GAAKLSVVTKFIQR 135
            + KL + T F+QR
Sbjct: 121 ASNKLPLRTIFVQR 134


>gi|111023103|ref|YP_706075.1| 50S ribosomal protein L16 [Rhodococcus jostii RHA1]
 gi|226365602|ref|YP_002783385.1| 50S ribosomal protein L16 [Rhodococcus opacus B4]
 gi|115502786|sp|Q0S3G9|RL16_RHOSR RecName: Full=50S ribosomal protein L16
 gi|254799217|sp|C1B019|RL16_RHOOB RecName: Full=50S ribosomal protein L16
 gi|110822633|gb|ABG97917.1| 50S ribosomal protein L16 [Rhodococcus jostii RHA1]
 gi|226244092|dbj|BAH54440.1| 50S ribosomal protein L16 [Rhodococcus opacus B4]
          Length = 138

 Score =  186 bits (474), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 57/135 (42%), Positives = 86/135 (63%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  K+ KQ      G AKGG+++ FG++ ++A E   I + +IE+AR A++R +KR
Sbjct: 1   MLIPRRVKHRKQHHPSRSGAAKGGTQVTFGDYGIQALEPAYITNRQIESARIAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T KP E RMG GKG+ E W+  VKPGR++FE+   +EE+AR A R 
Sbjct: 61  GGKIWINIFPDRPLTKKPAETRMGSGKGSPEWWIANVKPGRVMFEMSYPNEEIAREALRR 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL    + + R 
Sbjct: 121 AMHKLPCKCRIVTRE 135


>gi|308272972|emb|CBX29576.1| 50S ribosomal protein L16 [uncultured Desulfobacterium sp.]
          Length = 137

 Score =  186 bits (474), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 73/134 (54%), Positives = 96/134 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQ KGR+KG+A  GS + FG + L+A E   I S EIEAAR AI+R ++R
Sbjct: 1   MLSPKKVKFRKQQKGRMKGIADRGSSLNFGEYGLQALECGAINSKEIEAARIAITRHVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P T KP EVRMGKGKG  E WV  V+PGRIL+E++G+S ++A+ A RL
Sbjct: 61  GGKMWIRIFPDKPFTKKPAEVRMGKGKGAPEGWVAIVRPGRILYEMEGISRDLAKEALRL 120

Query: 122 GAAKLSVVTKFIQR 135
            + KLSV T+FI R
Sbjct: 121 ASHKLSVKTRFIDR 134


>gi|312795781|ref|YP_004028703.1| LSU ribosomal protein L16P [Burkholderia rhizoxinica HKI 454]
 gi|312167556|emb|CBW74559.1| LSU ribosomal protein L16P [Burkholderia rhizoxinica HKI 454]
          Length = 138

 Score =  186 bits (474), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 72/136 (52%), Positives = 99/136 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK  KY K+ KGR  GVA  G+ + FG F LKA    R+ + +IE+ARRA++R +KR
Sbjct: 1   MLQPKRRKYRKEQKGRNTGVATRGNAVSFGEFGLKAVGRGRLTARQIESARRAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI +FPD P++ KP EVRMG GKGN E +V  ++PG++L+E+DGV+EE+AR AFRL
Sbjct: 61  GGRIWIRIFPDKPISQKPAEVRMGNGKGNPEYYVAEIQPGKMLYEMDGVNEELAREAFRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + T F+ R +
Sbjct: 121 AAAKLPLKTMFVARQI 136


>gi|290487890|gb|ADD30329.1| ribosomal protein L16 [Ximenia americana]
          Length = 135

 Score =  186 bits (474), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 66/132 (50%), Positives = 96/132 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+RICFG +AL+A E N I S +IEA RRA++R  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGISYRGNRICFGKYALQALEPNWITSRQIEAGRRAMTRNARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD  VT KPTE RMG GKG+ E WV  VKP +IL+E+ GV+E +AR+A  +
Sbjct: 61  GGKIWVRIFPDKSVTVKPTETRMGSGKGSPEYWVAVVKPRQILYEMGGVTENIARKAISI 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+ I
Sbjct: 121 AASKMPIRTQLI 132


>gi|221069443|ref|ZP_03545548.1| ribosomal protein L16 [Comamonas testosteroni KF-1]
 gi|264676449|ref|YP_003276355.1| ribosomal protein L16 [Comamonas testosteroni CNB-2]
 gi|299531229|ref|ZP_07044640.1| 50S ribosomal protein L16 [Comamonas testosteroni S44]
 gi|220714466|gb|EED69834.1| ribosomal protein L16 [Comamonas testosteroni KF-1]
 gi|262206961|gb|ACY31059.1| ribosomal protein L16 [Comamonas testosteroni CNB-2]
 gi|298720812|gb|EFI61758.1| 50S ribosomal protein L16 [Comamonas testosteroni S44]
          Length = 138

 Score =  186 bits (474), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 71/136 (52%), Positives = 98/136 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QP   K+ K+ KGR  G+A  G+ + FG+F LK+ +  R+ + +IEAARRAISR +KR
Sbjct: 1   MLQPARRKFRKEQKGRNTGIATRGNSVAFGDFGLKSTDRGRLTARQIEAARRAISRHVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI VFPD P++ KP EVRMG GKGN E +V  ++PG++++EI GV EE+AR AFRL
Sbjct: 61  GGRIWIRVFPDKPISTKPAEVRMGNGKGNPEYYVAEIQPGKVIYEIVGVPEELAREAFRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + T F+ R +
Sbjct: 121 AAAKLPLRTTFVSRHI 136


>gi|297625789|ref|YP_003687552.1| 50S ribosomal protein L16 [Propionibacterium freudenreichii subsp.
           shermanii CIRM-BIA1]
 gi|296921554|emb|CBL56108.1| 50S ribosomal protein L16 [Propionibacterium freudenreichii subsp.
           shermanii CIRM-BIA1]
          Length = 139

 Score =  186 bits (474), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 63/134 (47%), Positives = 86/134 (64%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  KY KQ     +G+AKGG+ + FG F ++A E   + + +IEAAR A++R +KR
Sbjct: 1   MLIPRRVKYRKQHHPNRRGMAKGGTELAFGEFGVQALEPAYMTNRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI V+PD P+T  P E RMG GKG+ E WV  VKPGR+LFE+ GV+ +VA  A RL
Sbjct: 61  GGKVWINVYPDRPLTKHPAESRMGSGKGSPEFWVVNVKPGRVLFELAGVTPDVANEALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL    + I R
Sbjct: 121 AIHKLPFKARIITR 134


>gi|312140911|ref|YP_004008247.1| 50S ribosomal protein l16 rplp [Rhodococcus equi 103S]
 gi|325675451|ref|ZP_08155135.1| 50S ribosomal protein L16 [Rhodococcus equi ATCC 33707]
 gi|311890250|emb|CBH49568.1| 50S ribosomal protein L16 RplP [Rhodococcus equi 103S]
 gi|325553422|gb|EGD23100.1| 50S ribosomal protein L16 [Rhodococcus equi ATCC 33707]
          Length = 138

 Score =  186 bits (474), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 57/135 (42%), Positives = 85/135 (62%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  K+ KQ      G AKGG+++ FG + ++A E   I + +IE+AR A++R +KR
Sbjct: 1   MLIPRRVKHRKQHHPSRSGAAKGGTQVAFGEYGIQALEPAYITNRQIESARIAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T KP E RMG GKG+ E WV  +KPGR++FE+   +EE+AR A R 
Sbjct: 61  GGKIWINIFPDRPLTKKPAETRMGSGKGSPEWWVANIKPGRVMFEMSYPNEEIAREALRR 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL    + + R 
Sbjct: 121 AMHKLPCKCRIVTRE 135


>gi|116671514|ref|YP_832447.1| 50S ribosomal protein L16 [Arthrobacter sp. FB24]
 gi|166234545|sp|A0JZ77|RL16_ARTS2 RecName: Full=50S ribosomal protein L16
 gi|116611623|gb|ABK04347.1| LSU ribosomal protein L16P [Arthrobacter sp. FB24]
          Length = 138

 Score =  186 bits (474), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 61/135 (45%), Positives = 88/135 (65%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  K+ KQ      G A GG+++ FG + ++A     + + +IE+AR A++R +KR
Sbjct: 1   MLIPRRVKHRKQHHPGRSGAATGGTKVSFGEWGIQALSPAYVTNRQIESARIAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI ++PD P+T KP E RMG GKG+ E WV  VKPGR+LFE+ GVSEEVAR A RL
Sbjct: 61  GGKVWINIYPDRPLTKKPAETRMGSGKGSPEWWVSNVKPGRVLFELSGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  + ++R 
Sbjct: 121 AIHKLPLKARIVRRE 135


>gi|153805964|ref|ZP_01958632.1| hypothetical protein BACCAC_00209 [Bacteroides caccae ATCC 43185]
 gi|160883057|ref|ZP_02064060.1| hypothetical protein BACOVA_01020 [Bacteroides ovatus ATCC 8483]
 gi|160888391|ref|ZP_02069394.1| hypothetical protein BACUNI_00804 [Bacteroides uniformis ATCC 8492]
 gi|218131320|ref|ZP_03460124.1| hypothetical protein BACEGG_02931 [Bacteroides eggerthii DSM 20697]
 gi|237717406|ref|ZP_04547887.1| 50S ribosomal protein L16 [Bacteroides sp. D1]
 gi|237718736|ref|ZP_04549217.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
 gi|255690010|ref|ZP_05413685.1| ribosomal protein L16 [Bacteroides finegoldii DSM 17565]
 gi|260175423|ref|ZP_05761835.1| 50S ribosomal protein L16 [Bacteroides sp. D2]
 gi|262406171|ref|ZP_06082721.1| ribosomal protein L16 [Bacteroides sp. 2_1_22]
 gi|270294745|ref|ZP_06200946.1| 50S ribosomal protein L16 [Bacteroides sp. D20]
 gi|293372111|ref|ZP_06618502.1| ribosomal protein L16 [Bacteroides ovatus SD CMC 3f]
 gi|294644066|ref|ZP_06721843.1| ribosomal protein L16 [Bacteroides ovatus SD CC 2a]
 gi|294807322|ref|ZP_06766135.1| ribosomal protein L16 [Bacteroides xylanisolvens SD CC 1b]
 gi|298483071|ref|ZP_07001252.1| ribosomal protein L16 [Bacteroides sp. D22]
 gi|299144617|ref|ZP_07037685.1| ribosomal protein L16 [Bacteroides sp. 3_1_23]
 gi|315923653|ref|ZP_07919893.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|317476349|ref|ZP_07935598.1| ribosomal protein L16 [Bacteroides eggerthii 1_2_48FAA]
 gi|319900931|ref|YP_004160659.1| LSU ribosomal protein L16P [Bacteroides helcogenes P 36-108]
 gi|329962274|ref|ZP_08300280.1| ribosomal protein L16 [Bacteroides fluxus YIT 12057]
 gi|149130641|gb|EDM21847.1| hypothetical protein BACCAC_00209 [Bacteroides caccae ATCC 43185]
 gi|156111529|gb|EDO13274.1| hypothetical protein BACOVA_01020 [Bacteroides ovatus ATCC 8483]
 gi|156862068|gb|EDO55499.1| hypothetical protein BACUNI_00804 [Bacteroides uniformis ATCC 8492]
 gi|217986252|gb|EEC52589.1| hypothetical protein BACEGG_02931 [Bacteroides eggerthii DSM 20697]
 gi|229443389|gb|EEO49180.1| 50S ribosomal protein L16 [Bacteroides sp. D1]
 gi|229451868|gb|EEO57659.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
 gi|260624618|gb|EEX47489.1| ribosomal protein L16 [Bacteroides finegoldii DSM 17565]
 gi|262357046|gb|EEZ06136.1| ribosomal protein L16 [Bacteroides sp. 2_1_22]
 gi|270273992|gb|EFA19853.1| 50S ribosomal protein L16 [Bacteroides sp. D20]
 gi|292632903|gb|EFF51490.1| ribosomal protein L16 [Bacteroides ovatus SD CMC 3f]
 gi|292640590|gb|EFF58831.1| ribosomal protein L16 [Bacteroides ovatus SD CC 2a]
 gi|294445487|gb|EFG14141.1| ribosomal protein L16 [Bacteroides xylanisolvens SD CC 1b]
 gi|295085421|emb|CBK66944.1| LSU ribosomal protein L16P [Bacteroides xylanisolvens XB1A]
 gi|298270815|gb|EFI12395.1| ribosomal protein L16 [Bacteroides sp. D22]
 gi|298515108|gb|EFI38989.1| ribosomal protein L16 [Bacteroides sp. 3_1_23]
 gi|313697528|gb|EFS34363.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|316907375|gb|EFV29080.1| ribosomal protein L16 [Bacteroides eggerthii 1_2_48FAA]
 gi|319415962|gb|ADV43073.1| LSU ribosomal protein L16P [Bacteroides helcogenes P 36-108]
 gi|328530382|gb|EGF57259.1| ribosomal protein L16 [Bacteroides fluxus YIT 12057]
          Length = 144

 Score =  186 bits (473), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 70/134 (52%), Positives = 95/134 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ +Q KGR KG A+ G+++ FG+F +KA E   I   +IEAAR A++R M+R
Sbjct: 1   MLQPKKTKFRRQQKGRQKGNAQRGNQLAFGSFGIKALETKWITGRQIEAARIAVTRYMQR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T KP +VRMGKGKG  E +V  V PGRI+ E +GVS E+A+ A RL
Sbjct: 61  QGQIWIRIFPDKPITRKPADVRMGKGKGAPEGFVAPVTPGRIIIEAEGVSYEIAKEALRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + TKF+ R
Sbjct: 121 AAQKLPITTKFVVR 134


>gi|296447537|ref|ZP_06889459.1| ribosomal protein L16 [Methylosinus trichosporium OB3b]
 gi|296254925|gb|EFH02030.1| ribosomal protein L16 [Methylosinus trichosporium OB3b]
          Length = 137

 Score =  186 bits (473), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 84/137 (61%), Positives = 103/137 (75%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK T++ K FKGRI G AKGG  + FG F LKA E  R+ + +IEAARRA++R MKR
Sbjct: 1   MLQPKRTRFRKAFKGRIHGNAKGGFSLNFGQFGLKAMEPERVTARQIEAARRAMTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AGRVWI +FPDVPV+ KPTEVRMGKGKG  E W  RV PGRI+FE+DGV  ++AR A  L
Sbjct: 61  AGRVWIRIFPDVPVSKKPTEVRMGKGKGAPELWAVRVAPGRIMFEVDGVPMQLAREALTL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            AAKL + T+FI+R+ E
Sbjct: 121 AAAKLPIKTRFIERIAE 137


>gi|256371222|ref|YP_003109046.1| ribosomal protein L16 [Acidimicrobium ferrooxidans DSM 10331]
 gi|256007806|gb|ACU53373.1| ribosomal protein L16 [Acidimicrobium ferrooxidans DSM 10331]
          Length = 145

 Score =  186 bits (473), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 66/135 (48%), Positives = 90/135 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  K+ K  +GR+ G AKGG+ I FG + ++A E   + + +IEAAR A++R ++R
Sbjct: 1   MLMPRKVKHRKVQRGRLGGEAKGGTEITFGRYGIQALEPAWVTARQIEAARIAMTRHVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T KP E RMG GKGN E WV  VKPGRILFE+DGV EE+AR A   
Sbjct: 61  GGKVWIRIFPDKPITKKPAETRMGSGKGNPEFWVAVVKPGRILFELDGVGEELARAAMER 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  +F+ R 
Sbjct: 121 AIQKLPMKARFVVRE 135


>gi|331005005|ref|ZP_08328412.1| LSU ribosomal protein L16p (L10e) [gamma proteobacterium IMCC1989]
 gi|330421171|gb|EGG95430.1| LSU ribosomal protein L16p (L10e) [gamma proteobacterium IMCC1989]
          Length = 137

 Score =  186 bits (473), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 77/136 (56%), Positives = 104/136 (76%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGR +G+A  GS++ FG F LKA    RI + +IEAARRA++R +KR
Sbjct: 1   MLQPKRTKFRKMMKGRNRGLALRGSKVSFGEFGLKAVGRGRITARQIEAARRAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD P+T+KP EVR GKGKGNVE WV +++PG++L+E+DGVSEE+AR AF L
Sbjct: 61  GGKIWIRVFPDKPITSKPLEVRQGKGKGNVEYWVAQIQPGKVLYEMDGVSEELAREAFAL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            +AKL + T F++R V
Sbjct: 121 ASAKLPIKTNFVKRSV 136


>gi|323700813|ref|ZP_08112725.1| ribosomal protein L16 [Desulfovibrio sp. ND132]
 gi|323460745|gb|EGB16610.1| ribosomal protein L16 [Desulfovibrio desulfuricans ND132]
          Length = 137

 Score =  186 bits (473), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 62/135 (45%), Positives = 89/135 (65%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ K  KGR++G A+ G+ + FG+  LKA E  +I + +IE+AR AI R +KR
Sbjct: 1   MLAPKRVKFRKWQKGRLRGKAQRGNVVSFGDIGLKALEHGKITNQQIESARVAIMRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P T+KP EVR GKGKG  + WV  VKPGRI++E+ GV  E+A+ A + 
Sbjct: 61  GGKVWIRIFPDHPTTSKPAEVRQGKGKGAPDGWVAPVKPGRIMYEVKGVDIELAKEALKR 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL + T  + + 
Sbjct: 121 ASYKLPIKTTIVVKE 135


>gi|288801105|ref|ZP_06406561.1| ribosomal protein L16 [Prevotella sp. oral taxon 299 str. F0039]
 gi|288332039|gb|EFC70521.1| ribosomal protein L16 [Prevotella sp. oral taxon 299 str. F0039]
          Length = 142

 Score =  186 bits (473), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 73/135 (54%), Positives = 94/135 (69%), Gaps = 1/135 (0%)

Query: 2   LRQPKNTKYPKQFKGR-IKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMK 60
           + QPK  KY +   GR  KG A  G+++ FG+F +K  EA  I S +IEAAR A++R M+
Sbjct: 1   MLQPKRVKYRRPQDGRGNKGNAHRGTQLAFGSFGIKTLEAKWIDSRQIEAARVAVNRYMQ 60

Query: 61  RAGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFR 120
           R G+VWI +FPD P+T KP +VRMGKGKG+   WV  V PGRILFE++GVS ++A+ A R
Sbjct: 61  REGQVWIRIFPDKPITRKPADVRMGKGKGDPAGWVAPVTPGRILFEVEGVSFDIAKEALR 120

Query: 121 LGAAKLSVVTKFIQR 135
           L A KL V TKFI R
Sbjct: 121 LAAQKLPVKTKFIVR 135


>gi|124302944|ref|YP_001023739.1| ribosomal protein L16 [Angiopteris evecta]
 gi|215275545|sp|A2T371|RK16_ANGEV RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|110628342|gb|ABG79638.1| ribosomal protein L16 [Angiopteris evecta]
          Length = 146

 Score =  186 bits (473), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 69/133 (51%), Positives = 96/133 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+ T++ KQ +GR++G++  G+RICFG FAL+A E   I + +IEA RRAI+R  +R
Sbjct: 1   MLNPRRTRFRKQHRGRMRGISTRGNRICFGKFALQALEPTWITARQIEAGRRAITRYARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T +P E RMG GKG+ E WV  VKPGRIL+EI GVSE VAR A ++
Sbjct: 61  GGKLWIRIFPDKPITMRPAETRMGSGKGSPEYWVSVVKPGRILYEISGVSENVARAAMKI 120

Query: 122 GAAKLSVVTKFIQ 134
            A K+ + T+FI 
Sbjct: 121 AAYKMPIRTQFIT 133


>gi|241765224|ref|ZP_04763207.1| ribosomal protein L16 [Acidovorax delafieldii 2AN]
 gi|241365104|gb|EER59983.1| ribosomal protein L16 [Acidovorax delafieldii 2AN]
          Length = 138

 Score =  186 bits (473), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 75/136 (55%), Positives = 98/136 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QP   KY K+ KGR  GVA  G+ + FG+F LK  +  R+ + +IEAARRAISR +KR
Sbjct: 1   MLQPARRKYRKEQKGRNTGVATRGASVAFGDFGLKCTDRGRLTARQIEAARRAISRHVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI VFPD P++ KP EVRMG GKGN E +V  ++PG+I+FEI GV EE+AR AFRL
Sbjct: 61  GGRIWIRVFPDKPISTKPAEVRMGNGKGNPEYYVAEIQPGKIVFEIVGVPEELAREAFRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + T F+ R++
Sbjct: 121 AAAKLPLRTTFVSRLI 136


>gi|149390391|ref|YP_001294390.1| ribosomal protein L16 [Dioscorea elephantipes]
 gi|215275562|sp|A6MMP5|RK16_DIOEL RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|148668083|gb|ABR01467.1| ribosomal protein L16 [Dioscorea elephantipes]
          Length = 136

 Score =  186 bits (473), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 65/133 (48%), Positives = 95/133 (71%), Gaps = 1/133 (0%)

Query: 2   LRQ-PKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMK 60
           +   PK T++ KQ +GR++G++  G+ I FG +AL+A E   I + +IEA RRA++R  +
Sbjct: 1   MLSNPKRTRFRKQHRGRMRGISCRGNHISFGRYALQALEPAWITARQIEAGRRAMTRYAR 60

Query: 61  RAGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFR 120
           R G++W+ +FPD PVT +PTE RMG GKG+ E WV  VKPGRIL+E+ GVSE VAR A  
Sbjct: 61  RGGKIWVRIFPDKPVTVRPTETRMGSGKGSPEYWVSVVKPGRILYEMSGVSETVARTAIL 120

Query: 121 LGAAKLSVVTKFI 133
           + A+K+ + T+F+
Sbjct: 121 IAASKMPIPTQFV 133


>gi|322388394|ref|ZP_08061997.1| 50S ribosomal protein L16 [Streptococcus infantis ATCC 700779]
 gi|321140707|gb|EFX36209.1| 50S ribosomal protein L16 [Streptococcus infantis ATCC 700779]
          Length = 137

 Score =  186 bits (473), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 67/137 (48%), Positives = 93/137 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ ++F+G+++G AKGG  + FG + L+A  ++ I + +IEAAR A++R MKR
Sbjct: 1   MLVPKRVKHRREFRGKMRGEAKGGKEVAFGEYGLQATTSHWITNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP    TAK   VRMG GKG  E WV  VK G+++FE+ GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVAPVKRGKVMFEVAGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            + KL V  KF++R  E
Sbjct: 121 ASHKLPVKCKFVKREAE 137


>gi|307731248|ref|YP_003908472.1| 50S ribosomal protein L16 [Burkholderia sp. CCGE1003]
 gi|323527595|ref|YP_004229748.1| 50S ribosomal protein L16 [Burkholderia sp. CCGE1001]
 gi|307585783|gb|ADN59181.1| ribosomal protein L16 [Burkholderia sp. CCGE1003]
 gi|323384597|gb|ADX56688.1| ribosomal protein L16 [Burkholderia sp. CCGE1001]
          Length = 138

 Score =  186 bits (473), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 74/135 (54%), Positives = 98/135 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK  KY K+ KGR  GVA  G+ + FG F LKA    R+ + +IEAARRA++R +KR
Sbjct: 1   MLQPKRRKYRKEQKGRNTGVATRGNAVSFGEFGLKAIGRGRLTARQIEAARRAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI +FPD P++ KP EVRMG GKGN E +V  ++PG++L+E+DGV+EE+AR AFRL
Sbjct: 61  GGRIWIRIFPDKPISHKPAEVRMGNGKGNPEYYVAEIQPGKMLYEMDGVTEELAREAFRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            AAKL + T FI R 
Sbjct: 121 AAAKLPLKTTFIVRQ 135


>gi|269925838|ref|YP_003322461.1| ribosomal protein L16 [Thermobaculum terrenum ATCC BAA-798]
 gi|269789498|gb|ACZ41639.1| ribosomal protein L16 [Thermobaculum terrenum ATCC BAA-798]
          Length = 144

 Score =  186 bits (473), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 67/136 (49%), Positives = 88/136 (64%), Gaps = 1/136 (0%)

Query: 2   LRQPKNTKYPKQFKG-RIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMK 60
           +  PK  KY K  +G   +  A  G+ + FG F L+A EA  I + +IEAARRAI+  +K
Sbjct: 1   MLMPKRVKYRKPHRGETNEQTASRGTTVAFGEFGLQALEAAWIDNRQIEAARRAITHHVK 60

Query: 61  RAGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFR 120
           R G+VWI +FPD  +TAKP E RMG GKG+ ++WV  V+PGR+LFEI GV  EVA  A R
Sbjct: 61  RGGKVWIRIFPDKAITAKPAETRMGSGKGSPDRWVAVVRPGRVLFEIAGVRREVAEEALR 120

Query: 121 LGAAKLSVVTKFIQRV 136
           L   KL V T+ ++R 
Sbjct: 121 LAGHKLPVKTRIVERE 136


>gi|261885696|ref|ZP_06009735.1| 50S ribosomal protein L16 [Campylobacter fetus subsp. venerealis
           str. Azul-94]
          Length = 141

 Score =  186 bits (473), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 73/137 (53%), Positives = 91/137 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY K  KGR +G A  G  +  G F LKA EA R+ S +IE+AR+A +R +KR
Sbjct: 1   MLLPKRTKYRKMMKGRNRGYATRGVDLALGEFGLKAVEAGRVNSRQIESARQAYTRHVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
             + WI VFPD P+T KP E RMGKGKG VE+WV  +KPGRI+FE+ GVSEE+AR A  L
Sbjct: 61  QAKTWIRVFPDKPITKKPLETRMGKGKGGVEEWVMNIKPGRIIFEMSGVSEELAREALTL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
              KL   TKF+ +  E
Sbjct: 121 AMHKLPFKTKFVPKESE 137


>gi|313184030|ref|YP_004021187.1| ribosomal protein L16 [Castanea mollissima]
 gi|290487912|gb|ADD30340.1| ribosomal protein L16 [Quercus nigra]
 gi|309321557|gb|ADO65097.1| ribosomal protein L16 [Castanea mollissima]
          Length = 135

 Score =  186 bits (473), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 67/132 (50%), Positives = 97/132 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  ++ KQ +GR+KG++  G+RICFG +AL+A E   I S +IEA RRA++R ++R
Sbjct: 1   MLSPKRARFRKQHRGRMKGISYRGNRICFGRYALQALEPAWITSRQIEAGRRAMTRNVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +P E RMG GKG+ E WV  VKPGRIL+E+ GV+E VAR+A  +
Sbjct: 61  GGKIWVRIFPDKPVTVRPAETRMGSGKGSPEYWVAIVKPGRILYEMGGVAENVARKAISI 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+FI
Sbjct: 121 AASKMPIRTQFI 132


>gi|153012176|ref|YP_001381692.1| ribosomal protein L16 [Medicago truncatula]
          Length = 139

 Score =  186 bits (473), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 67/136 (49%), Positives = 95/136 (69%), Gaps = 4/136 (2%)

Query: 2   LRQ----PKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISR 57
           +      PK T++ KQ +GR+KG A  G+ I FG +AL+A E   I S +IEA RRA+SR
Sbjct: 1   MLSINYNPKRTRFRKQHRGRMKGKAYRGNTISFGKYALQALEPAWITSRQIEAGRRAMSR 60

Query: 58  GMKRAGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARR 117
            ++R G++W+ +FPD PVT +PTE RMG GKG+ E WV  VKPG+IL+E+ GV E +AR+
Sbjct: 61  NVRRGGKIWVRIFPDKPVTVRPTETRMGSGKGSPEYWVAVVKPGKILYEMGGVPENIARK 120

Query: 118 AFRLGAAKLSVVTKFI 133
           A  + A+K+ + T+FI
Sbjct: 121 AISIAASKMPIRTQFI 136


>gi|222099974|ref|YP_002534542.1| 50S ribosomal protein L16 [Thermotoga neapolitana DSM 4359]
 gi|254799229|sp|B9K893|RL16_THENN RecName: Full=50S ribosomal protein L16
 gi|221572364|gb|ACM23176.1| 50S ribosomal protein L16 [Thermotoga neapolitana DSM 4359]
          Length = 142

 Score =  186 bits (473), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 75/134 (55%), Positives = 92/134 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  KY KQ +GR+KG AKGG+ + FG + LKA E   I + +IEA R A+ R MKR
Sbjct: 1   MLMPRRVKYRKQQRGRMKGKAKGGTLVQFGEWGLKALEPAWITAQQIEACRIAMMRVMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AG++WI +FPD P T KP E RMGKGKGNVE WV  VKPG+ILFEI GV EE A  A R 
Sbjct: 61  AGKIWIRIFPDKPYTKKPAESRMGKGKGNVEGWVAVVKPGKILFEIAGVDEETAHEALRY 120

Query: 122 GAAKLSVVTKFIQR 135
            A+KL + TK + R
Sbjct: 121 AASKLPIATKVVPR 134


>gi|51209936|ref|YP_063600.1| ribosomal protein L16 [Gracilaria tenuistipitata var. liui]
 gi|132707|sp|P16633|RK16_GRATE RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|75120499|sp|Q6B8W0|RK16_GRATL RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|552547|gb|AAA84293.1| ribosomal protein rpl16 [Gracilaria tenuistipitata]
 gi|50657690|gb|AAT79675.1| 50S ribosomal protein L16 [Gracilaria tenuistipitata var. liui]
          Length = 135

 Score =  186 bits (473), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 66/135 (48%), Positives = 90/135 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ KQ + R+ G A  G+ I FG +AL+  E   + + +IEA RR I+R +KR
Sbjct: 1   MLSPKRTKFRKQHRNRMNGKASKGNTIAFGEYALQTLEPVWLTARQIEATRRTITRYVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD P+TA+P E RMG GKG  E WV  +KPG ILFEI GVS++ A+ A +L
Sbjct: 61  GGKIWIRVFPDKPITARPAETRMGSGKGATEYWVAVIKPGHILFEIAGVSKQTAQEAMKL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL + TKFI + 
Sbjct: 121 ASYKLPIKTKFITKQ 135


>gi|210631089|ref|ZP_03296745.1| hypothetical protein COLSTE_00630 [Collinsella stercoris DSM 13279]
 gi|229815768|ref|ZP_04446093.1| hypothetical protein COLINT_02817 [Collinsella intestinalis DSM
           13280]
 gi|210160177|gb|EEA91148.1| hypothetical protein COLSTE_00630 [Collinsella stercoris DSM 13279]
 gi|229808684|gb|EEP44461.1| hypothetical protein COLINT_02817 [Collinsella intestinalis DSM
           13280]
          Length = 141

 Score =  186 bits (473), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 68/134 (50%), Positives = 91/134 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK   + K  +G +KG AKG + + FG + + A + + I + +IEAAR A++R MKR
Sbjct: 1   MLAPKRILHRKVQRGSMKGQAKGNTELHFGEYGIVALDRHWITNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+V+I +FPD P+T KP E RMG GKGN E+WV  VKPGR++FEI GVSEE+AR A RL
Sbjct: 61  GGKVYITIFPDKPITKKPAETRMGSGKGNPEEWVAVVKPGRVMFEIAGVSEEIAREALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL + TK I R
Sbjct: 121 AQHKLPIKTKIITR 134


>gi|189485092|ref|YP_001956033.1| 50S ribosomal protein L16 [uncultured Termite group 1 bacterium
           phylotype Rs-D17]
 gi|226712372|sp|B1GZ90|RL16_UNCTG RecName: Full=50S ribosomal protein L16
 gi|170287051|dbj|BAG13572.1| 50S ribosomal protein L16 [uncultured Termite group 1 bacterium
           phylotype Rs-D17]
          Length = 137

 Score =  186 bits (473), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 68/134 (50%), Positives = 94/134 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY K  +GR+KG AKGG  + FG + L+A E   I S++IEAAR A++R +K+
Sbjct: 1   MLMPKRVKYRKMHRGRMKGKAKGGVSLAFGKYGLQALEPVWINSNQIEAARIALARSIKK 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD PVT KP E RMGKGKG+ + WV  VKPGR++FE++G+ E  A++A RL
Sbjct: 61  GGKVWIRIFPDKPVTKKPAETRMGKGKGDPQFWVAVVKPGRVMFEMEGIPETEAKKALRL 120

Query: 122 GAAKLSVVTKFIQR 135
            + KL + TK + R
Sbjct: 121 ASNKLPIHTKILVR 134


>gi|257866536|ref|ZP_05646189.1| ribosomal protein L16 [Enterococcus casseliflavus EC30]
 gi|257872949|ref|ZP_05652602.1| ribosomal protein L16 [Enterococcus casseliflavus EC10]
 gi|257876140|ref|ZP_05655793.1| ribosomal protein L16 [Enterococcus casseliflavus EC20]
 gi|325567369|ref|ZP_08144036.1| 50S ribosomal protein L16 [Enterococcus casseliflavus ATCC 12755]
 gi|257800494|gb|EEV29522.1| ribosomal protein L16 [Enterococcus casseliflavus EC30]
 gi|257807113|gb|EEV35935.1| ribosomal protein L16 [Enterococcus casseliflavus EC10]
 gi|257810306|gb|EEV39126.1| ribosomal protein L16 [Enterococcus casseliflavus EC20]
 gi|325158802|gb|EGC70948.1| 50S ribosomal protein L16 [Enterococcus casseliflavus ATCC 12755]
          Length = 144

 Score =  186 bits (473), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 68/135 (50%), Positives = 92/135 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ ++F+G+++G AKGG  + FG + L+A E++ I + +IEAAR A++R MKR
Sbjct: 1   MLVPKRVKHRREFRGKMRGEAKGGKEVAFGEYGLQAVESHWITNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP    TAK   VRMG GKG  E WV  VK G+I+FEI GV EEVAR A RL
Sbjct: 61  GGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVSPVKRGKIMFEIAGVPEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL V TK ++R 
Sbjct: 121 ASHKLPVKTKIVKRE 135


>gi|71280332|ref|YP_267615.1| 50S ribosomal protein L16 [Colwellia psychrerythraea 34H]
 gi|85541801|sp|Q488A0|RL16_COLP3 RecName: Full=50S ribosomal protein L16
 gi|71146072|gb|AAZ26545.1| ribosomal protein L16 [Colwellia psychrerythraea 34H]
          Length = 137

 Score =  186 bits (473), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 77/136 (56%), Positives = 102/136 (75%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQFK R +G+A  GS + FG F LK+ E  R+ + +IEAARRA++R +KR
Sbjct: 1   MLQPKRTKFRKQFKLRNRGLAHVGSSVSFGTFGLKSMERGRMTARQIEAARRAMTRHVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD P+T KP EVRMGKGKG+VE WVC++ PGR+L+E++GVSEE+AR AF L
Sbjct: 61  QGKIWIRVFPDKPITKKPLEVRMGKGKGSVEYWVCQILPGRVLYEMEGVSEEIAREAFAL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            A+KL   T F+ R  
Sbjct: 121 AASKLPFKTTFVTRTA 136


>gi|121608250|ref|YP_996057.1| 50S ribosomal protein L16 [Verminephrobacter eiseniae EF01-2]
 gi|166216123|sp|A1WHD2|RL16_VEREI RecName: Full=50S ribosomal protein L16
 gi|121552890|gb|ABM57039.1| LSU ribosomal protein L16P [Verminephrobacter eiseniae EF01-2]
          Length = 138

 Score =  186 bits (473), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 75/136 (55%), Positives = 98/136 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QP   KY K+ KGR  GVA  G+ + FG+F LK  +  R+ + +IEAARRAISR +KR
Sbjct: 1   MLQPARRKYRKEQKGRNTGVATRGATVAFGDFGLKCTDRGRLTARQIEAARRAISRHVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI VFPD P++ KP EVRMG GKGN E +V  ++PG+I+FEI GV EE+AR AFRL
Sbjct: 61  GGRIWIRVFPDKPISTKPAEVRMGNGKGNPEYYVAEIQPGKIVFEIVGVPEELAREAFRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + T F+ R++
Sbjct: 121 AAAKLPLRTTFVSRLI 136


>gi|315222813|ref|ZP_07864699.1| ribosomal protein L16 [Streptococcus anginosus F0211]
 gi|320548048|ref|ZP_08042328.1| 50S ribosomal protein L16 [Streptococcus equinus ATCC 9812]
 gi|315188116|gb|EFU21845.1| ribosomal protein L16 [Streptococcus anginosus F0211]
 gi|320447290|gb|EFW88053.1| 50S ribosomal protein L16 [Streptococcus equinus ATCC 9812]
          Length = 137

 Score =  186 bits (473), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 68/137 (49%), Positives = 93/137 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ ++F+G+++G AKGG  + FG + L+A  ++ I + +IEAAR A++R MKR
Sbjct: 1   MLVPKRVKHRREFRGKMRGEAKGGKEVAFGEYGLQATTSHWITNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP    TAK   VRMG GKG  E WV  VK G+++FEI GV EEVAR A RL
Sbjct: 61  GGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVAPVKRGKVMFEIAGVPEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            + KL V TKF++R  E
Sbjct: 121 ASHKLPVKTKFVKREAE 137


>gi|271962639|ref|YP_003336835.1| 50S ribosomal protein L16 [Streptosporangium roseum DSM 43021]
 gi|270505814|gb|ACZ84092.1| 50S ribosomal protein L16 [Streptosporangium roseum DSM 43021]
          Length = 139

 Score =  186 bits (473), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 62/136 (45%), Positives = 92/136 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  K+ KQ +    G AKGG+R+ FG F ++A E + + + +IE+AR A++R +KR
Sbjct: 1   MLIPRRVKHRKQHRPDRHGAAKGGTRVVFGEFGIQALEHSYVTNRQIESARIAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI ++PD P+T KP E RMG GKG+ E W+  VKPGR++FE+ GV+E VAR A R 
Sbjct: 61  GGKVWINIYPDRPLTKKPAETRMGSGKGSPEWWIANVKPGRVMFELSGVAEPVAREALRR 120

Query: 122 GAAKLSVVTKFIQRVV 137
              KL +  +F++R V
Sbjct: 121 AMHKLPMKCRFVKREV 136


>gi|257870524|ref|ZP_05650177.1| ribosomal protein L16 [Enterococcus gallinarum EG2]
 gi|257804688|gb|EEV33510.1| ribosomal protein L16 [Enterococcus gallinarum EG2]
          Length = 144

 Score =  186 bits (473), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 68/135 (50%), Positives = 92/135 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ ++F+G+++G AKGG  + FG + L+A E++ I + +IEAAR A++R MKR
Sbjct: 1   MLVPKRVKHRREFRGKMRGEAKGGKEVVFGEYGLQAVESHWITNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP    TAK   VRMG GKG  E WV  VK G+I+FEI GV EEVAR A RL
Sbjct: 61  GGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVSPVKRGKIMFEIAGVPEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL V TK ++R 
Sbjct: 121 ASHKLPVKTKIVKRE 135


>gi|197122346|ref|YP_002134297.1| 50S ribosomal protein L16 [Anaeromyxobacter sp. K]
 gi|220917128|ref|YP_002492432.1| ribosomal protein L16 [Anaeromyxobacter dehalogenans 2CP-1]
 gi|226710672|sp|B4UBA6|RL16_ANASK RecName: Full=50S ribosomal protein L16
 gi|254799173|sp|B8J867|RL16_ANAD2 RecName: Full=50S ribosomal protein L16
 gi|196172195|gb|ACG73168.1| ribosomal protein L16 [Anaeromyxobacter sp. K]
 gi|219954982|gb|ACL65366.1| ribosomal protein L16 [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 138

 Score =  186 bits (473), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 70/134 (52%), Positives = 93/134 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QP  TKY K  KGR++G A  GS +  G + L+A E  R+ S +IEAAR AI+R +KR
Sbjct: 1   MLQPARTKYRKMQKGRMRGKAYRGSDLAQGEYGLQATECGRLTSRQIEAARVAITRYVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD P+T KP E RMG GKGNVE +V  +KPGR+L+E+ GV +  A++AF L
Sbjct: 61  GGKLWIRVFPDKPITKKPAETRMGTGKGNVEFYVAVIKPGRVLYELAGVDDASAKKAFHL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL V TK ++R
Sbjct: 121 AAHKLPVATKMVKR 134


>gi|134093238|ref|YP_001109539.1| ribosomal protein L16 [Populus trichocarpa]
 gi|215274771|sp|A4GYU8|RK16_POPTR RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|133712100|gb|ABO36743.1| ribosomal protein L16 [Populus trichocarpa]
          Length = 135

 Score =  186 bits (473), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 65/132 (49%), Positives = 99/132 (75%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+RICFG +AL+A E   I S +IEA RRA++R ++R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGISSRGNRICFGRYALQALEPAWITSRQIEAGRRAMTRNVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +P+E RMG GKG+ E WV  VKPGR+++E+ GV+E +AR+A  +
Sbjct: 61  GGKIWVRIFPDKPVTLRPSETRMGSGKGSPEYWVAVVKPGRMIYEMGGVAENIARKAISI 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+FI
Sbjct: 121 AASKMPIRTQFI 132


>gi|251781522|ref|YP_002995823.1| 50S ribosomal protein L16 [Streptococcus dysgalactiae subsp.
           equisimilis GGS_124]
 gi|242390150|dbj|BAH80609.1| 50S ribosomal protein L16 [Streptococcus dysgalactiae subsp.
           equisimilis GGS_124]
 gi|322410865|gb|EFY01773.1| 50S ribosomal protein L16 [Streptococcus dysgalactiae subsp.
           dysgalactiae ATCC 27957]
 gi|323126318|gb|ADX23615.1| 50S ribosomal protein L16 [Streptococcus dysgalactiae subsp.
           equisimilis ATCC 12394]
          Length = 137

 Score =  186 bits (473), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 67/137 (48%), Positives = 93/137 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ ++F+G+++G AKGG  + FG + L+A  ++ I + +IEAAR A++R MKR
Sbjct: 1   MLVPKRVKHRREFRGKMRGEAKGGKTVDFGEYGLQAATSSWITNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP    TAK   VRMG GKG  E WV  VK G+++FEI GVSEE+AR A RL
Sbjct: 61  GGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVAPVKRGKVMFEIAGVSEEIAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            + KL V  KF++R  E
Sbjct: 121 ASHKLPVKCKFVKREAE 137


>gi|240129129|ref|ZP_04741790.1| 50S ribosomal protein L16 [Neisseria gonorrhoeae SK-93-1035]
 gi|268687512|ref|ZP_06154374.1| 50S ribosomal protein L16 [Neisseria gonorrhoeae SK-93-1035]
 gi|268627796|gb|EEZ60196.1| 50S ribosomal protein L16 [Neisseria gonorrhoeae SK-93-1035]
          Length = 138

 Score =  186 bits (473), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 74/136 (54%), Positives = 98/136 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QP   KY KQ KGR  G+A  G+++ FG F LKA    R+ + +IEAARRA++R +KR
Sbjct: 1   MLQPTRLKYRKQQKGRNTGIATRGNKVSFGEFGLKAVGRGRLTARQIEAARRAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI VFPD P+T KP +VRMG GKGNVE ++  +KPG++L+E+DGV EE+AR AF L
Sbjct: 61  GGRIWIRVFPDKPITEKPIQVRMGGGKGNVEYYIVEIKPGKVLYEMDGVPEELAREAFEL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + T F+ R V
Sbjct: 121 AAAKLPIPTTFVVRQV 136


>gi|322386347|ref|ZP_08059977.1| 50S ribosomal protein L16 [Streptococcus cristatus ATCC 51100]
 gi|321269571|gb|EFX52501.1| 50S ribosomal protein L16 [Streptococcus cristatus ATCC 51100]
          Length = 137

 Score =  186 bits (473), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 67/137 (48%), Positives = 93/137 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ ++F+G+++G AKGG  + FG + L+A  ++ I + +IEAAR A++R MKR
Sbjct: 1   MLVPKRVKHRREFRGKMRGEAKGGKEVTFGEYGLQATTSHWITNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP    TAK   VRMG GKG  E WV  VK G+++FEI GVSEE+AR A RL
Sbjct: 61  GGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVAPVKRGKVMFEIAGVSEEIAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            + KL V  KF++R  E
Sbjct: 121 ASHKLPVKCKFVKREAE 137


>gi|293567924|ref|ZP_06679265.1| ribosomal protein L16 [Enterococcus faecium E1071]
 gi|291589509|gb|EFF21316.1| ribosomal protein L16 [Enterococcus faecium E1071]
          Length = 144

 Score =  186 bits (473), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 66/135 (48%), Positives = 92/135 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ ++F+G+++G AKGG  + FG + L+A +++ I + +IEAAR A++R MKR
Sbjct: 1   MLVPKRVKHRREFRGKMRGEAKGGKEVAFGEYGLQAVDSHWITNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP    TAK   VRMG GKG  E WV  VK G+I+FEI GV EEVAR A RL
Sbjct: 61  GGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVAPVKRGKIMFEIAGVPEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL + TK ++R 
Sbjct: 121 ASHKLPMKTKIVKRE 135


>gi|121592719|ref|YP_984615.1| 50S ribosomal protein L16 [Acidovorax sp. JS42]
 gi|222109500|ref|YP_002551764.1| 50S ribosomal protein l16 [Acidovorax ebreus TPSY]
 gi|166234539|sp|A1W2R4|RL16_ACISJ RecName: Full=50S ribosomal protein L16
 gi|254799199|sp|B9MB80|RL16_DIAST RecName: Full=50S ribosomal protein L16
 gi|120604799|gb|ABM40539.1| LSU ribosomal protein L16P [Acidovorax sp. JS42]
 gi|221728944|gb|ACM31764.1| ribosomal protein L16 [Acidovorax ebreus TPSY]
          Length = 138

 Score =  186 bits (473), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 73/136 (53%), Positives = 97/136 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QP   K+ K+ KGR  GVA  G+ + FG+F LK  +  R+ + +IEAARRAISR +KR
Sbjct: 1   MLQPARRKFRKEQKGRNTGVATRGNSVAFGDFGLKCTDRGRLTARQIEAARRAISRHVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI VFPD P++ KP EVRMG GKGN E +V  ++PG+++FEI GV EE+AR AFRL
Sbjct: 61  GGRIWIRVFPDKPISTKPAEVRMGNGKGNPEYYVAEIQPGKVVFEIVGVPEELAREAFRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + T F+ R +
Sbjct: 121 AAAKLPLRTTFVARQI 136


>gi|91785458|ref|YP_560664.1| 50S ribosomal protein L16 [Burkholderia xenovorans LB400]
 gi|187925609|ref|YP_001897251.1| 50S ribosomal protein L16 [Burkholderia phytofirmans PsJN]
 gi|296163314|ref|ZP_06846075.1| ribosomal protein L16 [Burkholderia sp. Ch1-1]
 gi|115502739|sp|Q13TH7|RL16_BURXL RecName: Full=50S ribosomal protein L16
 gi|226710693|sp|B2T744|RL16_BURPP RecName: Full=50S ribosomal protein L16
 gi|91689412|gb|ABE32612.1| LSU ribosomal protein L16P [Burkholderia xenovorans LB400]
 gi|187716803|gb|ACD18027.1| ribosomal protein L16 [Burkholderia phytofirmans PsJN]
 gi|295886453|gb|EFG66310.1| ribosomal protein L16 [Burkholderia sp. Ch1-1]
          Length = 138

 Score =  186 bits (473), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 73/135 (54%), Positives = 98/135 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK  KY K+ KGR  G+A  G+ + FG F LKA    R+ + +IEAARRA++R +KR
Sbjct: 1   MLQPKRRKYRKEQKGRNTGIATRGNAVSFGEFGLKAIGRGRLTARQIEAARRAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI +FPD P++ KP EVRMG GKGN E +V  ++PG++L+E+DGV+EE+AR AFRL
Sbjct: 61  GGRIWIRIFPDKPISHKPAEVRMGNGKGNPEYYVAEIQPGKMLYEMDGVTEELAREAFRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            AAKL + T FI R 
Sbjct: 121 AAAKLPLKTTFIVRQ 135


>gi|4927756|gb|AAD33272.1| RpL16 [Streptococcus pneumoniae]
 gi|4927765|gb|AAD33281.1| RpL16 [Streptococcus pneumoniae]
          Length = 137

 Score =  186 bits (473), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 67/137 (48%), Positives = 93/137 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ ++F+G+++G AKGG  + FG + L+A  ++ I + +IEAAR A++R MKR
Sbjct: 1   MLVPKRVKHRREFRGKMRGEAKGGKEVAFGEYGLQATTSHWITNRQIEAARSAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP    TAK   VRMG GKG  E WV  VK G+++FEI GVSEE+AR A RL
Sbjct: 61  GGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVAPVKRGKVMFEIAGVSEEIAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            + KL V  KF++R  E
Sbjct: 121 ASHKLPVKCKFVKREAE 137


>gi|69247176|ref|ZP_00604238.1| Ribosomal protein L16 [Enterococcus faecium DO]
 gi|227550727|ref|ZP_03980776.1| ribosomal protein L16 [Enterococcus faecium TX1330]
 gi|257878732|ref|ZP_05658385.1| ribosomal protein L16 [Enterococcus faecium 1,230,933]
 gi|257881373|ref|ZP_05661026.1| ribosomal protein L16 [Enterococcus faecium 1,231,502]
 gi|257885641|ref|ZP_05665294.1| ribosomal protein L16 [Enterococcus faecium 1,231,501]
 gi|257888014|ref|ZP_05667667.1| ribosomal protein L16 [Enterococcus faecium 1,141,733]
 gi|257890591|ref|ZP_05670244.1| ribosomal protein L16 [Enterococcus faecium 1,231,410]
 gi|257893181|ref|ZP_05672834.1| ribosomal protein L16 [Enterococcus faecium 1,231,408]
 gi|257896367|ref|ZP_05676020.1| ribosomal protein L16 [Enterococcus faecium Com12]
 gi|257899341|ref|ZP_05678994.1| ribosomal protein L16 [Enterococcus faecium Com15]
 gi|258615204|ref|ZP_05712974.1| 50S ribosomal protein L16 [Enterococcus faecium DO]
 gi|260558294|ref|ZP_05830490.1| ribosomal protein L16 [Enterococcus faecium C68]
 gi|261207000|ref|ZP_05921689.1| ribosomal protein L16 [Enterococcus faecium TC 6]
 gi|289565365|ref|ZP_06445815.1| 50S ribosomal protein L16 [Enterococcus faecium D344SRF]
 gi|293379453|ref|ZP_06625597.1| ribosomal protein L16 [Enterococcus faecium PC4.1]
 gi|293553886|ref|ZP_06674492.1| ribosomal protein L16 [Enterococcus faecium E1039]
 gi|293562953|ref|ZP_06677420.1| ribosomal protein L16 [Enterococcus faecium E1162]
 gi|293570691|ref|ZP_06681741.1| ribosomal protein L16 [Enterococcus faecium E980]
 gi|294615386|ref|ZP_06695259.1| ribosomal protein L16 [Enterococcus faecium E1636]
 gi|294618313|ref|ZP_06697894.1| ribosomal protein L16 [Enterococcus faecium E1679]
 gi|294621085|ref|ZP_06700276.1| ribosomal protein L16 [Enterococcus faecium U0317]
 gi|314937615|ref|ZP_07844941.1| ribosomal protein L16 [Enterococcus faecium TX0133a04]
 gi|314942886|ref|ZP_07849699.1| ribosomal protein L16 [Enterococcus faecium TX0133C]
 gi|314947978|ref|ZP_07851382.1| ribosomal protein L16 [Enterococcus faecium TX0082]
 gi|314950895|ref|ZP_07853964.1| ribosomal protein L16 [Enterococcus faecium TX0133A]
 gi|314991457|ref|ZP_07856934.1| ribosomal protein L16 [Enterococcus faecium TX0133B]
 gi|314995022|ref|ZP_07860142.1| ribosomal protein L16 [Enterococcus faecium TX0133a01]
 gi|68194941|gb|EAN09409.1| Ribosomal protein L16 [Enterococcus faecium DO]
 gi|227180188|gb|EEI61160.1| ribosomal protein L16 [Enterococcus faecium TX1330]
 gi|257812960|gb|EEV41718.1| ribosomal protein L16 [Enterococcus faecium 1,230,933]
 gi|257817031|gb|EEV44359.1| ribosomal protein L16 [Enterococcus faecium 1,231,502]
 gi|257821497|gb|EEV48627.1| ribosomal protein L16 [Enterococcus faecium 1,231,501]
 gi|257824068|gb|EEV51000.1| ribosomal protein L16 [Enterococcus faecium 1,141,733]
 gi|257826951|gb|EEV53577.1| ribosomal protein L16 [Enterococcus faecium 1,231,410]
 gi|257829560|gb|EEV56167.1| ribosomal protein L16 [Enterococcus faecium 1,231,408]
 gi|257832932|gb|EEV59353.1| ribosomal protein L16 [Enterococcus faecium Com12]
 gi|257837253|gb|EEV62327.1| ribosomal protein L16 [Enterococcus faecium Com15]
 gi|260075468|gb|EEW63774.1| ribosomal protein L16 [Enterococcus faecium C68]
 gi|260078628|gb|EEW66330.1| ribosomal protein L16 [Enterococcus faecium TC 6]
 gi|289162855|gb|EFD10705.1| 50S ribosomal protein L16 [Enterococcus faecium D344SRF]
 gi|291291689|gb|ADD91680.1| 50S ribosomal protein L16 [Enterococcus faecium]
 gi|291591760|gb|EFF23396.1| ribosomal protein L16 [Enterococcus faecium E1636]
 gi|291595407|gb|EFF26719.1| ribosomal protein L16 [Enterococcus faecium E1679]
 gi|291599321|gb|EFF30347.1| ribosomal protein L16 [Enterococcus faecium U0317]
 gi|291601938|gb|EFF32184.1| ribosomal protein L16 [Enterococcus faecium E1039]
 gi|291605079|gb|EFF34546.1| ribosomal protein L16 [Enterococcus faecium E1162]
 gi|291609163|gb|EFF38435.1| ribosomal protein L16 [Enterococcus faecium E980]
 gi|292641976|gb|EFF60142.1| ribosomal protein L16 [Enterococcus faecium PC4.1]
 gi|313590748|gb|EFR69593.1| ribosomal protein L16 [Enterococcus faecium TX0133a01]
 gi|313593937|gb|EFR72782.1| ribosomal protein L16 [Enterococcus faecium TX0133B]
 gi|313596904|gb|EFR75749.1| ribosomal protein L16 [Enterococcus faecium TX0133A]
 gi|313598358|gb|EFR77203.1| ribosomal protein L16 [Enterococcus faecium TX0133C]
 gi|313642992|gb|EFS07572.1| ribosomal protein L16 [Enterococcus faecium TX0133a04]
 gi|313645576|gb|EFS10156.1| ribosomal protein L16 [Enterococcus faecium TX0082]
          Length = 144

 Score =  186 bits (473), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 66/135 (48%), Positives = 92/135 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ ++F+G+++G AKGG  + FG + L+A +++ I + +IEAAR A++R MKR
Sbjct: 1   MLVPKRVKHRREFRGKMRGEAKGGKEVAFGEYGLQAVDSHWITNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP    TAK   VRMG GKG  E WV  VK G+I+FEI GV EEVAR A RL
Sbjct: 61  GGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVAPVKRGKIMFEIAGVPEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL + TK ++R 
Sbjct: 121 ASHKLPMKTKIVKRE 135


>gi|299830385|ref|YP_003734600.1| 50S ribosomal protein L16 [Kryptoperidinium foliaceum]
 gi|297385087|gb|ADI40385.1| 50S ribosomal protein L16 [Kryptoperidinium foliaceum]
          Length = 138

 Score =  186 bits (473), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 71/136 (52%), Positives = 89/136 (65%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY K  +GR++G A  G+ ICFG F L+A E N I S +IEAARR I+R  +R
Sbjct: 1   MLSPKRTKYRKYHRGRMRGKATRGNEICFGKFGLQALEPNWITSRQIEAARRTITRYTRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
             ++WI +FPD  VTA+  E RMG GKG V+ WV  VKPG I+FEI  V EEVA+ A  L
Sbjct: 61  GAKLWIRIFPDKTVTARAAESRMGSGKGAVDYWVAVVKPGTIIFEISSVPEEVAKAALSL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            A KL + TKFI +  
Sbjct: 121 AAYKLPLKTKFINKDS 136


>gi|171778383|ref|ZP_02919562.1| hypothetical protein STRINF_00413 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
 gi|288904280|ref|YP_003429501.1| ribosomal protein L16 [Streptococcus gallolyticus UCN34]
 gi|306830309|ref|ZP_07463480.1| 50S ribosomal protein L16 [Streptococcus gallolyticus subsp.
           gallolyticus TX20005]
 gi|306832554|ref|ZP_07465694.1| 50S ribosomal protein L16 [Streptococcus bovis ATCC 700338]
 gi|325977259|ref|YP_004286975.1| 50S ribosomal protein L16 [Streptococcus gallolyticus subsp.
           gallolyticus ATCC BAA-2069]
 gi|171282914|gb|EDT48338.1| hypothetical protein STRINF_00413 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
 gi|288731005|emb|CBI12549.1| ribosomal protein L16 [Streptococcus gallolyticus UCN34]
 gi|304425312|gb|EFM28438.1| 50S ribosomal protein L16 [Streptococcus bovis ATCC 700338]
 gi|304427556|gb|EFM30657.1| 50S ribosomal protein L16 [Streptococcus gallolyticus subsp.
           gallolyticus TX20005]
 gi|325177187|emb|CBZ47231.1| 50S ribosomal protein L16 [Streptococcus gallolyticus subsp.
           gallolyticus ATCC BAA-2069]
          Length = 137

 Score =  186 bits (472), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 69/137 (50%), Positives = 94/137 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ ++F+G+++G AKGG  + FG + L+A  ++ I + +IEAAR A++R MKR
Sbjct: 1   MLVPKRVKHRREFRGKMRGEAKGGKEVAFGEYGLQATTSHWITNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP    TAK   VRMG GKG  E WV  VK G+++FEI GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVAPVKRGKVMFEIAGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            + KL V TKF++R  E
Sbjct: 121 ASHKLPVKTKFVKREAE 137


>gi|15900152|ref|NP_344756.1| 50S ribosomal protein L16 [Streptococcus pneumoniae TIGR4]
 gi|15902240|ref|NP_357790.1| 50S ribosomal protein L16 [Streptococcus pneumoniae R6]
 gi|111658794|ref|ZP_01409425.1| hypothetical protein SpneT_02000091 [Streptococcus pneumoniae
           TIGR4]
 gi|116515627|ref|YP_815719.1| 50S ribosomal protein L16 [Streptococcus pneumoniae D39]
 gi|148983615|ref|ZP_01816934.1| 50S ribosomal protein L16 [Streptococcus pneumoniae SP3-BS71]
 gi|148987953|ref|ZP_01819416.1| 50S ribosomal protein L16 [Streptococcus pneumoniae SP6-BS73]
 gi|148992793|ref|ZP_01822436.1| 50S ribosomal protein L16 [Streptococcus pneumoniae SP9-BS68]
 gi|148996638|ref|ZP_01824356.1| 50S ribosomal protein L16 [Streptococcus pneumoniae SP11-BS70]
 gi|149001678|ref|ZP_01826651.1| 50S ribosomal protein L16 [Streptococcus pneumoniae SP14-BS69]
 gi|149005966|ref|ZP_01829695.1| 50S ribosomal protein L16 [Streptococcus pneumoniae SP18-BS74]
 gi|149011085|ref|ZP_01832390.1| 50S ribosomal protein L16 [Streptococcus pneumoniae SP19-BS75]
 gi|149017905|ref|ZP_01834364.1| 50S ribosomal protein L16 [Streptococcus pneumoniae SP23-BS72]
 gi|168483852|ref|ZP_02708804.1| ribosomal protein L16 [Streptococcus pneumoniae CDC1873-00]
 gi|168486018|ref|ZP_02710526.1| ribosomal protein L16 [Streptococcus pneumoniae CDC1087-00]
 gi|168489693|ref|ZP_02713892.1| ribosomal protein L16 [Streptococcus pneumoniae SP195]
 gi|168493909|ref|ZP_02718052.1| ribosomal protein L16 [Streptococcus pneumoniae CDC3059-06]
 gi|168576357|ref|ZP_02722240.1| ribosomal protein L16 [Streptococcus pneumoniae MLV-016]
 gi|169833772|ref|YP_001693748.1| 50S ribosomal protein L16 [Streptococcus pneumoniae Hungary19A-6]
 gi|182683195|ref|YP_001834942.1| 50S ribosomal protein L16 [Streptococcus pneumoniae CGSP14]
 gi|194396695|ref|YP_002036917.1| 50S ribosomal protein L16 [Streptococcus pneumoniae G54]
 gi|221231120|ref|YP_002510272.1| 50S ribosomal protein L16 [Streptococcus pneumoniae ATCC 700669]
 gi|225853822|ref|YP_002735334.1| 50S ribosomal protein L16 [Streptococcus pneumoniae JJA]
 gi|225855981|ref|YP_002737492.1| 50S ribosomal protein L16 [Streptococcus pneumoniae P1031]
 gi|225858070|ref|YP_002739580.1| 50S ribosomal protein L16 [Streptococcus pneumoniae 70585]
 gi|225860258|ref|YP_002741767.1| 50S ribosomal protein L16 [Streptococcus pneumoniae Taiwan19F-14]
 gi|237649716|ref|ZP_04523968.1| 50S ribosomal protein L16 [Streptococcus pneumoniae CCRI 1974]
 gi|237821414|ref|ZP_04597259.1| 50S ribosomal protein L16 [Streptococcus pneumoniae CCRI 1974M2]
 gi|289168725|ref|YP_003446994.1| 50S ribosomal protein L16 [Streptococcus mitis B6]
 gi|293364340|ref|ZP_06611066.1| 50S ribosomal protein L16 [Streptococcus oralis ATCC 35037]
 gi|298230373|ref|ZP_06964054.1| 50S ribosomal protein L16 [Streptococcus pneumoniae str. Canada
           MDR_19F]
 gi|298255994|ref|ZP_06979580.1| 50S ribosomal protein L16 [Streptococcus pneumoniae str. Canada
           MDR_19A]
 gi|298502030|ref|YP_003723970.1| 50S ribosomal protein L16 [Streptococcus pneumoniae TCH8431/19A]
 gi|303255088|ref|ZP_07341164.1| 50S ribosomal protein L16 [Streptococcus pneumoniae BS455]
 gi|303259268|ref|ZP_07345246.1| 50S ribosomal protein L16 [Streptococcus pneumoniae SP-BS293]
 gi|303261023|ref|ZP_07346972.1| 50S ribosomal protein L16 [Streptococcus pneumoniae SP14-BS292]
 gi|303263351|ref|ZP_07349274.1| 50S ribosomal protein L16 [Streptococcus pneumoniae BS397]
 gi|303265516|ref|ZP_07351416.1| 50S ribosomal protein L16 [Streptococcus pneumoniae BS457]
 gi|303267926|ref|ZP_07353728.1| 50S ribosomal protein L16 [Streptococcus pneumoniae BS458]
 gi|307066894|ref|YP_003875860.1| hypothetical protein SPAP_0265 [Streptococcus pneumoniae AP200]
 gi|307126436|ref|YP_003878467.1| 50S ribosomal protein L16 [Streptococcus pneumoniae 670-6B]
 gi|307702693|ref|ZP_07639645.1| ribosomal protein L16 [Streptococcus oralis ATCC 35037]
 gi|307704072|ref|ZP_07641001.1| ribosomal protein L16 [Streptococcus mitis SK597]
 gi|307708067|ref|ZP_07644535.1| ribosomal protein L16 [Streptococcus mitis NCTC 12261]
 gi|307711048|ref|ZP_07647470.1| ribosomal protein L16 [Streptococcus mitis SK321]
 gi|315612339|ref|ZP_07887252.1| 50S ribosomal protein L16 [Streptococcus sanguinis ATCC 49296]
 gi|322375032|ref|ZP_08049546.1| ribosomal protein L16 [Streptococcus sp. C300]
 gi|322377223|ref|ZP_08051715.1| ribosomal protein L16 [Streptococcus sp. M334]
 gi|61230527|sp|P0A475|RL16_STRPN RecName: Full=50S ribosomal protein L16
 gi|61230535|sp|P0A476|RL16_STRR6 RecName: Full=50S ribosomal protein L16
 gi|122279395|sp|Q04MM9|RL16_STRP2 RecName: Full=50S ribosomal protein L16
 gi|226712361|sp|B5E6G2|RL16_STRP4 RecName: Full=50S ribosomal protein L16
 gi|226712362|sp|B1I8K5|RL16_STRPI RecName: Full=50S ribosomal protein L16
 gi|226712363|sp|B2IS47|RL16_STRPS RecName: Full=50S ribosomal protein L16
 gi|254799223|sp|C1CAL9|RL16_STRP7 RecName: Full=50S ribosomal protein L16
 gi|254799224|sp|B8ZKG4|RL16_STRPJ RecName: Full=50S ribosomal protein L16
 gi|254799226|sp|C1CC13|RL16_STRZJ RecName: Full=50S ribosomal protein L16
 gi|254799227|sp|C1CIA4|RL16_STRZP RecName: Full=50S ribosomal protein L16
 gi|254799228|sp|C1CP95|RL16_STRZT RecName: Full=50S ribosomal protein L16
 gi|4927747|gb|AAD33263.1|AF126059_4 RpL16 [Streptococcus pneumoniae]
 gi|14971684|gb|AAK74396.1| ribosomal protein L16 [Streptococcus pneumoniae TIGR4]
 gi|15457741|gb|AAK99000.1| 50S Ribosomal protein L16 [Streptococcus pneumoniae R6]
 gi|116076203|gb|ABJ53923.1| ribosomal protein L16 [Streptococcus pneumoniae D39]
 gi|147757213|gb|EDK64252.1| 50S ribosomal protein L16 [Streptococcus pneumoniae SP11-BS70]
 gi|147760136|gb|EDK67125.1| 50S ribosomal protein L16 [Streptococcus pneumoniae SP14-BS69]
 gi|147762322|gb|EDK69283.1| 50S ribosomal protein L16 [Streptococcus pneumoniae SP18-BS74]
 gi|147764721|gb|EDK71651.1| 50S ribosomal protein L16 [Streptococcus pneumoniae SP19-BS75]
 gi|147923762|gb|EDK74874.1| 50S ribosomal protein L16 [Streptococcus pneumoniae SP3-BS71]
 gi|147926417|gb|EDK77490.1| 50S ribosomal protein L16 [Streptococcus pneumoniae SP6-BS73]
 gi|147928519|gb|EDK79534.1| 50S ribosomal protein L16 [Streptococcus pneumoniae SP9-BS68]
 gi|147931469|gb|EDK82447.1| 50S ribosomal protein L16 [Streptococcus pneumoniae SP23-BS72]
 gi|168996274|gb|ACA36886.1| ribosomal protein L16 [Streptococcus pneumoniae Hungary19A-6]
 gi|172042853|gb|EDT50899.1| ribosomal protein L16 [Streptococcus pneumoniae CDC1873-00]
 gi|182628529|gb|ACB89477.1| 50S ribosomal protein L16 [Streptococcus pneumoniae CGSP14]
 gi|183570903|gb|EDT91431.1| ribosomal protein L16 [Streptococcus pneumoniae CDC1087-00]
 gi|183571856|gb|EDT92384.1| ribosomal protein L16 [Streptococcus pneumoniae SP195]
 gi|183576153|gb|EDT96681.1| ribosomal protein L16 [Streptococcus pneumoniae CDC3059-06]
 gi|183577824|gb|EDT98352.1| ribosomal protein L16 [Streptococcus pneumoniae MLV-016]
 gi|194356362|gb|ACF54810.1| 50S ribosomal protein L16 [Streptococcus pneumoniae G54]
 gi|220673580|emb|CAR68066.1| 50S ribosomal protein L16 [Streptococcus pneumoniae ATCC 700669]
 gi|225720291|gb|ACO16145.1| ribosomal protein L16 [Streptococcus pneumoniae 70585]
 gi|225722710|gb|ACO18563.1| ribosomal protein L16 [Streptococcus pneumoniae JJA]
 gi|225725749|gb|ACO21601.1| ribosomal protein L16 [Streptococcus pneumoniae P1031]
 gi|225727151|gb|ACO23002.1| ribosomal protein L16 [Streptococcus pneumoniae Taiwan19F-14]
 gi|288908292|emb|CBJ23134.1| 50S ribosomal protein L16 [Streptococcus mitis B6]
 gi|291317186|gb|EFE57613.1| 50S ribosomal protein L16 [Streptococcus oralis ATCC 35037]
 gi|298237625|gb|ADI68756.1| 50S ribosomal protein L16 [Streptococcus pneumoniae TCH8431/19A]
 gi|301793489|emb|CBW35862.1| 50S ribosomal protein L16 [Streptococcus pneumoniae INV104]
 gi|301799365|emb|CBW31900.1| 50S ribosomal protein L16 [Streptococcus pneumoniae OXC141]
 gi|301801160|emb|CBW33833.1| 50S ribosomal protein L16 [Streptococcus pneumoniae INV200]
 gi|302597918|gb|EFL64988.1| 50S ribosomal protein L16 [Streptococcus pneumoniae BS455]
 gi|302637860|gb|EFL68346.1| 50S ribosomal protein L16 [Streptococcus pneumoniae SP14-BS292]
 gi|302639686|gb|EFL70143.1| 50S ribosomal protein L16 [Streptococcus pneumoniae SP-BS293]
 gi|302642622|gb|EFL72967.1| 50S ribosomal protein L16 [Streptococcus pneumoniae BS458]
 gi|302644956|gb|EFL75203.1| 50S ribosomal protein L16 [Streptococcus pneumoniae BS457]
 gi|302647124|gb|EFL77348.1| 50S ribosomal protein L16 [Streptococcus pneumoniae BS397]
 gi|306408431|gb|ADM83858.1| hypothetical protein SPAP_0265 [Streptococcus pneumoniae AP200]
 gi|306483498|gb|ADM90367.1| ribosomal protein L16 [Streptococcus pneumoniae 670-6B]
 gi|307615852|gb|EFN95057.1| ribosomal protein L16 [Streptococcus mitis NCTC 12261]
 gi|307617010|gb|EFN96188.1| ribosomal protein L16 [Streptococcus mitis SK321]
 gi|307622362|gb|EFO01370.1| ribosomal protein L16 [Streptococcus mitis SK597]
 gi|307623809|gb|EFO02794.1| ribosomal protein L16 [Streptococcus oralis ATCC 35037]
 gi|315315320|gb|EFU63359.1| 50S ribosomal protein L16 [Streptococcus sanguinis ATCC 49296]
 gi|321280532|gb|EFX57571.1| ribosomal protein L16 [Streptococcus sp. C300]
 gi|321281936|gb|EFX58944.1| ribosomal protein L16 [Streptococcus sp. M334]
 gi|327390635|gb|EGE88975.1| ribosomal protein L16 [Streptococcus pneumoniae GA04375]
 gi|332075881|gb|EGI86348.1| ribosomal protein L16 [Streptococcus pneumoniae GA17570]
 gi|332076662|gb|EGI87124.1| ribosomal protein L16 [Streptococcus pneumoniae GA17545]
 gi|332077517|gb|EGI87978.1| ribosomal protein L16 [Streptococcus pneumoniae GA41301]
          Length = 137

 Score =  186 bits (472), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 67/137 (48%), Positives = 93/137 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ ++F+G+++G AKGG  + FG + L+A  ++ I + +IEAAR A++R MKR
Sbjct: 1   MLVPKRVKHRREFRGKMRGEAKGGKEVAFGEYGLQATTSHWITNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP    TAK   VRMG GKG  E WV  VK G+++FEI GVSEE+AR A RL
Sbjct: 61  GGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVAPVKRGKVMFEIAGVSEEIAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            + KL V  KF++R  E
Sbjct: 121 ASHKLPVKCKFVKREAE 137


>gi|226968559|ref|YP_002808512.1| large subunit ribosomal protein 16 [Micromonas pusilla CCMP1545]
 gi|226348854|gb|ACO50757.1| large subunit ribosomal protein 16 [Micromonas pusilla CCMP1545]
          Length = 140

 Score =  186 bits (472), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 69/135 (51%), Positives = 92/135 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY K  +GR+ G A  G++I FG+FAL+A E   I S +IEA RRA+SR  +R
Sbjct: 1   MLSPKRTKYRKPHRGRLTGKAMRGNKIAFGDFALQALEPGWITSRQIEAGRRAMSRYARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD  +TA+  E RMG GKG  + WV  VKPG+IL+E+ GVSE +AR + R+
Sbjct: 61  GGKLWIRVFPDKSITARAAETRMGAGKGAPDYWVAVVKPGKILYEMRGVSEAIARSSMRI 120

Query: 122 GAAKLSVVTKFIQRV 136
            A K+ V TKF+ R 
Sbjct: 121 AAYKMPVKTKFLIRE 135


>gi|260909757|ref|ZP_05916451.1| 50S ribosomal protein L16 [Prevotella sp. oral taxon 472 str.
           F0295]
 gi|288929333|ref|ZP_06423178.1| ribosomal protein L16 [Prevotella sp. oral taxon 317 str. F0108]
 gi|260636182|gb|EEX54178.1| 50S ribosomal protein L16 [Prevotella sp. oral taxon 472 str.
           F0295]
 gi|288329435|gb|EFC68021.1| ribosomal protein L16 [Prevotella sp. oral taxon 317 str. F0108]
          Length = 142

 Score =  186 bits (472), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 71/135 (52%), Positives = 94/135 (69%), Gaps = 1/135 (0%)

Query: 2   LRQPKNTKYPKQFKGR-IKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMK 60
           + QPK  +Y +   GR  KG A  G+++ FG+F +K  EA  I S +IEAAR A++R M+
Sbjct: 1   MLQPKRVRYRRPQDGRGNKGNASRGTQLAFGSFGIKTLEAKWIDSRQIEAARVAVNRYMQ 60

Query: 61  RAGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFR 120
           R G+VWI +FPD P+T KP +VRMGKGKG+   WV  V PGRILFE++GVS ++A+ A R
Sbjct: 61  REGQVWIRIFPDKPITRKPADVRMGKGKGDPAGWVAPVTPGRILFEVEGVSFDIAKEALR 120

Query: 121 LGAAKLSVVTKFIQR 135
           L A KL V TKF+ R
Sbjct: 121 LAAQKLPVKTKFVVR 135


>gi|125716992|ref|YP_001034125.1| 50S ribosomal protein L16 [Streptococcus sanguinis SK36]
 gi|157150036|ref|YP_001451228.1| 50S ribosomal protein L16 [Streptococcus gordonii str. Challis
           substr. CH1]
 gi|262283576|ref|ZP_06061341.1| ribosomal protein L16 [Streptococcus sp. 2_1_36FAA]
 gi|270292007|ref|ZP_06198222.1| ribosomal protein L16 [Streptococcus sp. M143]
 gi|306828790|ref|ZP_07461982.1| 50S ribosomal protein L16 [Streptococcus mitis ATCC 6249]
 gi|309799065|ref|ZP_07693318.1| ribosomal protein L16 [Streptococcus infantis SK1302]
 gi|322391206|ref|ZP_08064678.1| 50S ribosomal protein L16 [Streptococcus peroris ATCC 700780]
 gi|323350947|ref|ZP_08086605.1| 50S ribosomal protein L16 [Streptococcus sanguinis VMC66]
 gi|331267129|ref|YP_004326759.1| 50S ribosomal protein L16 [Streptococcus oralis Uo5]
 gi|166216115|sp|A3CK70|RL16_STRSV RecName: Full=50S ribosomal protein L16
 gi|189041488|sp|A8AZL8|RL16_STRGC RecName: Full=50S ribosomal protein L16
 gi|125496909|gb|ABN43575.1| 50S ribosomal protein L16, putative [Streptococcus sanguinis SK36]
 gi|157074830|gb|ABV09513.1| ribosomal protein L16 [Streptococcus gordonii str. Challis substr.
           CH1]
 gi|262260633|gb|EEY79334.1| ribosomal protein L16 [Streptococcus sp. 2_1_36FAA]
 gi|270279535|gb|EFA25377.1| ribosomal protein L16 [Streptococcus sp. M143]
 gi|304428968|gb|EFM32056.1| 50S ribosomal protein L16 [Streptococcus mitis ATCC 6249]
 gi|308117300|gb|EFO54723.1| ribosomal protein L16 [Streptococcus infantis SK1302]
 gi|321145959|gb|EFX41348.1| 50S ribosomal protein L16 [Streptococcus peroris ATCC 700780]
 gi|322122929|gb|EFX94635.1| 50S ribosomal protein L16 [Streptococcus sanguinis VMC66]
 gi|324989995|gb|EGC21936.1| 50S ribosomal protein L16 [Streptococcus sanguinis SK353]
 gi|324991822|gb|EGC23747.1| 50S ribosomal protein L16 [Streptococcus sanguinis SK405]
 gi|324996288|gb|EGC28196.1| 50S ribosomal protein L16 [Streptococcus sanguinis SK678]
 gi|325686412|gb|EGD28442.1| 50S ribosomal protein L16 [Streptococcus sanguinis SK72]
 gi|325689224|gb|EGD31230.1| 50S ribosomal protein L16 [Streptococcus sanguinis SK115]
 gi|325695803|gb|EGD37700.1| 50S ribosomal protein L16 [Streptococcus sanguinis SK150]
 gi|325697983|gb|EGD39866.1| 50S ribosomal protein L16 [Streptococcus sanguinis SK160]
 gi|326683801|emb|CBZ01419.1| 50S ribosomal protein L16 [Streptococcus oralis Uo5]
 gi|327458438|gb|EGF04794.1| 50S ribosomal protein L16 [Streptococcus sanguinis SK1]
 gi|327463716|gb|EGF10032.1| 50S ribosomal protein L16 [Streptococcus sanguinis SK1057]
 gi|327467342|gb|EGF12842.1| 50S ribosomal protein L16 [Streptococcus sanguinis SK330]
 gi|327471735|gb|EGF17176.1| 50S ribosomal protein L16 [Streptococcus sanguinis SK408]
 gi|327490456|gb|EGF22238.1| 50S ribosomal protein L16 [Streptococcus sanguinis SK1058]
 gi|328945210|gb|EGG39364.1| 50S ribosomal protein L16 [Streptococcus sanguinis SK1087]
          Length = 137

 Score =  186 bits (472), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 66/137 (48%), Positives = 93/137 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ ++F+G+++G AKGG  + FG + L+A  ++ I + +IEAAR A++R MKR
Sbjct: 1   MLVPKRVKHRREFRGKMRGEAKGGKEVAFGEYGLQATTSHWITNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP    TAK   VRMG GKG  E WV  VK G+++FE+ GVSEE+AR A RL
Sbjct: 61  GGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVAPVKRGKVMFEVAGVSEEIAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            + KL V  KF++R  E
Sbjct: 121 ASHKLPVKCKFVKREAE 137


>gi|284033995|ref|YP_003383926.1| 50S ribosomal protein L16 [Kribbella flavida DSM 17836]
 gi|283813288|gb|ADB35127.1| ribosomal protein L16 [Kribbella flavida DSM 17836]
          Length = 139

 Score =  186 bits (472), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 59/136 (43%), Positives = 90/136 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  K+ KQ   +  G AKGG+ + FG+F ++A E++ + + +IE+AR A++R +KR
Sbjct: 1   MLIPRKVKHRKQHHPKRSGAAKGGTTLAFGDFGIQALESHYVTNRQIESARIAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI ++PD P+T KP E RMG GKG+ E W+  VK GR++FE+ GV E++AR A R 
Sbjct: 61  GGKVWINIYPDRPLTKKPAETRMGSGKGSPEWWIANVKAGRVMFELSGVPEDIAREAMRR 120

Query: 122 GAAKLSVVTKFIQRVV 137
              KL +  +FI R  
Sbjct: 121 AIHKLPMKCRFISREA 136


>gi|156598127|gb|ABU85328.1| ribosomal protein L16 [Elaeis oleifera]
          Length = 130

 Score =  186 bits (472), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 67/129 (51%), Positives = 94/129 (72%)

Query: 5   PKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKRAGR 64
           PK T++ KQ +GR+KG++  G+ ICFG +AL+A E   I + +IEA RRA++R  +R G+
Sbjct: 2   PKRTRFRKQHRGRMKGISCRGNHICFGGYALQALEPAWITARQIEAGRRAMTRYARRGGK 61

Query: 65  VWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRLGAA 124
           +W+ +FPD PVT +PTE RMG GKG+ E WV  VKPGRIL+E+ GVSE VAR A  + A 
Sbjct: 62  IWVRIFPDKPVTVRPTETRMGSGKGSPEYWVSVVKPGRILYEMGGVSETVARAAISIAAY 121

Query: 125 KLSVVTKFI 133
           K+ + T+F+
Sbjct: 122 KMPIRTQFV 130


>gi|282880993|ref|ZP_06289684.1| ribosomal protein L16 [Prevotella timonensis CRIS 5C-B1]
 gi|281305216|gb|EFA97285.1| ribosomal protein L16 [Prevotella timonensis CRIS 5C-B1]
          Length = 142

 Score =  186 bits (472), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 72/135 (53%), Positives = 93/135 (68%), Gaps = 1/135 (0%)

Query: 2   LRQPKNTKYPKQFKGR-IKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMK 60
           + QPK  KY +   GR  KG A  G+++ FG+F +K  E   I S +IEAAR A++R M+
Sbjct: 1   MLQPKRVKYRRPQDGRGNKGNAHRGTQLVFGSFGIKTLEPKWIDSRQIEAARVAVNRYMQ 60

Query: 61  RAGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFR 120
           R G+VWI +FPD P+T KP +VRMGKGKG+   WV  V PGRILFE++GVS +VA+ A R
Sbjct: 61  REGQVWIRIFPDKPITRKPADVRMGKGKGDPMGWVAPVTPGRILFEVEGVSLDVAKEALR 120

Query: 121 LGAAKLSVVTKFIQR 135
           L A KL V TKF+ R
Sbjct: 121 LAAQKLPVKTKFVIR 135


>gi|238025939|ref|YP_002910170.1| 50S ribosomal protein L16 [Burkholderia glumae BGR1]
 gi|237875133|gb|ACR27466.1| 50S ribosomal protein L16 [Burkholderia glumae BGR1]
          Length = 138

 Score =  186 bits (472), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 72/135 (53%), Positives = 98/135 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK  KY K+ KGR  G+A  G+ + FG + LKA    R+ + +IEAARRA++R +KR
Sbjct: 1   MLQPKRRKYRKEQKGRNTGIATRGNAVSFGEYGLKAIGRGRLTARQIEAARRAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI +FPD P++ KP EVRMG GKGN E +V  ++PG++L+E+DGV+EE+AR AFRL
Sbjct: 61  GGRIWIRIFPDKPISQKPAEVRMGNGKGNPEYYVAEIQPGKMLYEMDGVTEELAREAFRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            AAKL + T FI R 
Sbjct: 121 AAAKLPLKTAFIVRQ 135


>gi|322831079|ref|YP_004211106.1| ribosomal protein L16 [Rahnella sp. Y9602]
 gi|321166280|gb|ADW71979.1| ribosomal protein L16 [Rahnella sp. Y9602]
          Length = 136

 Score =  186 bits (472), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 74/136 (54%), Positives = 102/136 (75%), Gaps = 1/136 (0%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGR +G+A+ G+ + FG + LKA    R+ + +IEAARRA++R +KR
Sbjct: 1   MLQPKRTKFRKVHKGRNRGLAQ-GTDVSFGTYGLKAVGRGRLTARQIEAARRAMTRAVKR 59

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD P+T KP EVRMGKGKGNVE WV  ++PG++L+E+DGV EE+AR AF+L
Sbjct: 60  QGKIWIRVFPDKPITEKPLEVRMGKGKGNVEYWVALIQPGKVLYEMDGVPEELAREAFQL 119

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + T F+ + V
Sbjct: 120 AAAKLPIKTTFVTKTV 135


>gi|114798200|ref|YP_761522.1| 50S ribosomal protein L16 [Hyphomonas neptunium ATCC 15444]
 gi|123128467|sp|Q0BYC1|RL16_HYPNA RecName: Full=50S ribosomal protein L16
 gi|114738374|gb|ABI76499.1| ribosomal protein L16 [Hyphomonas neptunium ATCC 15444]
          Length = 138

 Score =  186 bits (472), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 86/135 (63%), Positives = 105/135 (77%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K FKG+I G +KGG  + FG F LKA E  R+ + +IEA RRAI+R MKR
Sbjct: 1   MLQPKRTKFRKAFKGQINGQSKGGFTLSFGQFGLKALEPERVTARQIEATRRAITREMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI VFPDVPVTAKP EVRMGKGKG V++WV RV PGRILFEIDGV E++AR+A  L
Sbjct: 61  QGKVWIRVFPDVPVTAKPIEVRMGKGKGGVDRWVARVAPGRILFEIDGVPEDIARQALAL 120

Query: 122 GAAKLSVVTKFIQRV 136
           GAAKL + TK ++R+
Sbjct: 121 GAAKLPIKTKVVKRI 135


>gi|57238707|ref|YP_179838.1| 50S ribosomal protein L16 [Campylobacter jejuni RM1221]
 gi|57504691|ref|ZP_00370769.1| ribosomal protein L16 [Campylobacter coli RM2228]
 gi|86149289|ref|ZP_01067520.1| ribosomal protein L16 [Campylobacter jejuni subsp. jejuni CF93-6]
 gi|86152210|ref|ZP_01070421.1| ribosomal protein L16 [Campylobacter jejuni subsp. jejuni 260.94]
 gi|86152647|ref|ZP_01070852.1| ribosomal protein L16 [Campylobacter jejuni subsp. jejuni HB93-13]
 gi|88596272|ref|ZP_01099509.1| ribosomal protein L16 [Campylobacter jejuni subsp. jejuni 84-25]
 gi|121613671|ref|YP_001001344.1| 50S ribosomal protein L16 [Campylobacter jejuni subsp. jejuni
           81-176]
 gi|148926791|ref|ZP_01810470.1| 50S ribosomal protein L16 [Campylobacter jejuni subsp. jejuni
           CG8486]
 gi|153951170|ref|YP_001398979.1| 50S ribosomal protein L16 [Campylobacter jejuni subsp. doylei
           269.97]
 gi|157415922|ref|YP_001483178.1| 50S ribosomal protein L16 [Campylobacter jejuni subsp. jejuni
           81116]
 gi|167006233|ref|ZP_02271991.1| 50S ribosomal protein L16 [Campylobacter jejuni subsp. jejuni
           81-176]
 gi|205355714|ref|ZP_03222484.1| 50S ribosomal protein L16 [Campylobacter jejuni subsp. jejuni
           CG8421]
 gi|218563286|ref|YP_002345066.1| 50S ribosomal protein L16 [Campylobacter jejuni subsp. jejuni NCTC
           11168]
 gi|283956156|ref|ZP_06373641.1| ribosomal protein L16 [Campylobacter jejuni subsp. jejuni 1336]
 gi|305432605|ref|ZP_07401766.1| 50S ribosomal protein L16 [Campylobacter coli JV20]
 gi|315125087|ref|YP_004067091.1| 50S ribosomal protein L16 [Campylobacter jejuni subsp. jejuni
           ICDCCJ07001]
 gi|81557382|sp|Q5HS97|RL16_CAMJR RecName: Full=50S ribosomal protein L16
 gi|81624155|sp|Q9PLX8|RL16_CAMJE RecName: Full=50S ribosomal protein L16
 gi|166234565|sp|A7H649|RL16_CAMJD RecName: Full=50S ribosomal protein L16
 gi|166234566|sp|A1W1V3|RL16_CAMJJ RecName: Full=50S ribosomal protein L16
 gi|172047264|sp|A8FP14|RL16_CAMJ8 RecName: Full=50S ribosomal protein L16
 gi|57019460|gb|EAL56155.1| ribosomal protein L16 [Campylobacter coli RM2228]
 gi|57167511|gb|AAW36290.1| ribosomal protein L16 [Campylobacter jejuni RM1221]
 gi|85840071|gb|EAQ57329.1| ribosomal protein L16 [Campylobacter jejuni subsp. jejuni CF93-6]
 gi|85840699|gb|EAQ57950.1| ribosomal protein L16 [Campylobacter jejuni subsp. jejuni 260.94]
 gi|85843532|gb|EAQ60742.1| ribosomal protein L16 [Campylobacter jejuni subsp. jejuni HB93-13]
 gi|87249597|gb|EAQ72556.1| ribosomal protein L16 [Campylobacter jejuni subsp. jejuni 81-176]
 gi|88191113|gb|EAQ95085.1| ribosomal protein L16 [Campylobacter jejuni subsp. jejuni 84-25]
 gi|112360993|emb|CAL35794.1| 50S ribosomal protein L16 [Campylobacter jejuni subsp. jejuni NCTC
           11168]
 gi|145844516|gb|EDK21623.1| 50S ribosomal protein L16 [Campylobacter jejuni subsp. jejuni
           CG8486]
 gi|152938616|gb|ABS43357.1| ribosomal protein L16 [Campylobacter jejuni subsp. doylei 269.97]
 gi|157386886|gb|ABV53201.1| 50S ribosomal protein L16 [Campylobacter jejuni subsp. jejuni
           81116]
 gi|205346491|gb|EDZ33124.1| 50S ribosomal protein L16 [Campylobacter jejuni subsp. jejuni
           CG8421]
 gi|283792310|gb|EFC31094.1| ribosomal protein L16 [Campylobacter jejuni subsp. jejuni 1336]
 gi|284926891|gb|ADC29243.1| 50S ribosomal protein L16 [Campylobacter jejuni subsp. jejuni
           IA3902]
 gi|304444316|gb|EFM36968.1| 50S ribosomal protein L16 [Campylobacter coli JV20]
 gi|307748560|gb|ADN91830.1| 50S ribosomal protein L16 [Campylobacter jejuni subsp. jejuni M1]
 gi|315018809|gb|ADT66902.1| 50S ribosomal protein L16 [Campylobacter jejuni subsp. jejuni
           ICDCCJ07001]
 gi|315059146|gb|ADT73475.1| LSU ribosomal protein L16p [Campylobacter jejuni subsp. jejuni S3]
 gi|315926627|gb|EFV06007.1| ribosomal protein L16 [Campylobacter jejuni subsp. jejuni DFVF1099]
 gi|315930388|gb|EFV09464.1| ribosomal protein L16 [Campylobacter jejuni subsp. jejuni 305]
 gi|315931332|gb|EFV10301.1| ribosomal protein L16 [Campylobacter jejuni subsp. jejuni 327]
          Length = 141

 Score =  186 bits (472), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 77/137 (56%), Positives = 94/137 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY K  KGR +G A  G+   FG FALKA EA RI S +IEAAR A++R +KR
Sbjct: 1   MLMPKRTKYRKMMKGRNRGYANRGTEFTFGEFALKATEAGRINSRQIEAARIALTRFVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+ WI VFPD P+T KP E RMGKGKG VE+WV  +KPGRI++E+ GVSEE+AR A  L
Sbjct: 61  QGKTWIRVFPDKPLTKKPLETRMGKGKGAVEEWVMNIKPGRIIYEMAGVSEEMAREALTL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
              KL   TKF+ R  +
Sbjct: 121 AMHKLPFKTKFVTRESQ 137


>gi|319639556|ref|ZP_07994303.1| 50S ribosomal protein L16 [Neisseria mucosa C102]
 gi|317399127|gb|EFV79801.1| 50S ribosomal protein L16 [Neisseria mucosa C102]
          Length = 138

 Score =  186 bits (472), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 72/136 (52%), Positives = 96/136 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QP   KY KQ KGR  G+A  G+++ FG F LKA    R+ + +IEAARR ++R +KR
Sbjct: 1   MLQPTRLKYRKQQKGRNTGIATRGNKVSFGEFGLKAVGRGRLTARQIEAARRTMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI VFPD P+T KP +VRMG GKGNVE ++  +KPG++L+E+DGV E +AR AF L
Sbjct: 61  GGRIWIRVFPDKPITEKPIQVRMGGGKGNVEYYIAEIKPGKVLYEMDGVPESLAREAFEL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + T F+ R V
Sbjct: 121 AAAKLPIPTTFVVRQV 136


>gi|317477744|ref|ZP_07936937.1| ribosomal protein L16 [Bacteroides sp. 4_1_36]
 gi|316906089|gb|EFV27850.1| ribosomal protein L16 [Bacteroides sp. 4_1_36]
          Length = 144

 Score =  186 bits (472), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 70/134 (52%), Positives = 94/134 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ +Q KGR KG A+ G+ + FG+F +KA E   I   +IEAAR A++R M+R
Sbjct: 1   MLQPKKTKFRRQQKGRQKGNAQRGNLLAFGSFGIKALETKWITGRQIEAARIAVTRYMQR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T KP +VRMGKGKG  E +V  V PGRI+ E +GVS E+A+ A RL
Sbjct: 61  QGQIWIRIFPDKPITRKPADVRMGKGKGAPEGFVAPVTPGRIIIEAEGVSYEIAKEALRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + TKF+ R
Sbjct: 121 AAQKLPITTKFVVR 134


>gi|65317569|ref|ZP_00390528.1| COG0197: Ribosomal protein L16/L10E [Bacillus anthracis str. A2012]
          Length = 139

 Score =  186 bits (472), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 76/135 (56%), Positives = 96/135 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY ++ +G+++G AKGG+ I FG F L+AQ A+ I + +IEAARRA++R MKR
Sbjct: 1   MLMPKRVKYRREHRGKMRGRAKGGTEIAFGEFGLQAQAASWITNRQIEAARRAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI + P  P TAKP EVRMG GKG  E WV  VKPG+I+ EI GVSEEVAR A RL
Sbjct: 61  GGKVWIKISPSKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKIMSEIAGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL V  KF++R 
Sbjct: 121 AAHKLPVKCKFVKRE 135


>gi|319761145|ref|YP_004125082.1| ribosomal protein l16 [Alicycliphilus denitrificans BC]
 gi|330823003|ref|YP_004386306.1| 50S ribosomal protein L16 [Alicycliphilus denitrificans K601]
 gi|317115706|gb|ADU98194.1| ribosomal protein L16 [Alicycliphilus denitrificans BC]
 gi|329308375|gb|AEB82790.1| ribosomal protein L16 [Alicycliphilus denitrificans K601]
          Length = 138

 Score =  186 bits (472), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 72/136 (52%), Positives = 97/136 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QP   K+ K+ KGR  G+A  G+ + FG+F LK  +  R+ + +IEAARRAISR +KR
Sbjct: 1   MLQPARRKFRKEQKGRNTGIATRGNSVAFGDFGLKCTDRGRLTARQIEAARRAISRHVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI VFPD P++ KP EVRMG GKGN E +V  ++PG+++FEI GV EE+AR AFRL
Sbjct: 61  GGRIWIRVFPDKPISTKPAEVRMGNGKGNPEYYVAEIQPGKVVFEIVGVPEELAREAFRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + T F+ R +
Sbjct: 121 AAAKLPLRTTFVARQI 136


>gi|199598839|ref|ZP_03212250.1| 50S ribosomal protein L16 [Lactobacillus rhamnosus HN001]
 gi|229552715|ref|ZP_04441440.1| ribosomal protein L16 [Lactobacillus rhamnosus LMS2-1]
 gi|258509475|ref|YP_003172226.1| 50S ribosomal protein L16 [Lactobacillus rhamnosus GG]
 gi|258540672|ref|YP_003175171.1| 50S ribosomal protein L16 [Lactobacillus rhamnosus Lc 705]
 gi|199590251|gb|EDY98346.1| 50S ribosomal protein L16 [Lactobacillus rhamnosus HN001]
 gi|229313921|gb|EEN79894.1| ribosomal protein L16 [Lactobacillus rhamnosus LMS2-1]
 gi|257149402|emb|CAR88375.1| LSU/50S ribosomal protein L16P [Lactobacillus rhamnosus GG]
 gi|257152348|emb|CAR91320.1| LSU/50S ribosomal protein L16P [Lactobacillus rhamnosus Lc 705]
 gi|259650754|dbj|BAI42916.1| 50S ribosomal protein L16 [Lactobacillus rhamnosus GG]
 gi|328478160|gb|EGF48006.1| 50S ribosomal protein L16 [Lactobacillus rhamnosus MTCC 5462]
          Length = 144

 Score =  186 bits (472), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 62/135 (45%), Positives = 89/135 (65%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ ++F+G+++G AKGG  + FG + L+A E++ I + +IEAAR A++R MKR
Sbjct: 1   MLVPKRVKHRREFRGKMRGAAKGGKNVDFGEYGLEALESHWITNRQIEAARVAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP    T+K   VRMG GKG    WV  VK  +I+FE+ GVSE VA+ A RL
Sbjct: 61  GGKVWIRIFPHKSYTSKGVGVRMGNGKGAPTGWVAVVKREKIMFEVGGVSEAVAKEALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL + TK + R 
Sbjct: 121 ASNKLPIRTKIVSRE 135


>gi|308178129|ref|YP_003917535.1| 50S ribosomal protein L16 [Arthrobacter arilaitensis Re117]
 gi|307745592|emb|CBT76564.1| 50S ribosomal protein L16 [Arthrobacter arilaitensis Re117]
          Length = 138

 Score =  186 bits (472), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 60/135 (44%), Positives = 89/135 (65%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  K+ KQ   +  G AKGG+ + FG + ++A     + + +IEAAR A++R +KR
Sbjct: 1   MLIPRRVKFRKQHHPKRSGAAKGGTTVSFGEYGIQALTPAYVTNRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI ++PD P+T KP E RMG GKG+ E WV  VKPGR++FE+ GVSE+VA+ A RL
Sbjct: 61  GGKVWINIYPDRPLTKKPAETRMGSGKGSPEWWVANVKPGRVMFELGGVSEKVAKEALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  + ++R 
Sbjct: 121 AIHKLPMKARIVRRE 135


>gi|296875397|ref|ZP_06899471.1| 50S ribosomal protein L16 [Streptococcus parasanguinis ATCC 15912]
 gi|306825979|ref|ZP_07459315.1| 50S ribosomal protein L16 [Streptococcus sp. oral taxon 071 str.
           73H25AP]
 gi|312866971|ref|ZP_07727182.1| ribosomal protein L16 [Streptococcus parasanguinis F0405]
 gi|322390667|ref|ZP_08064181.1| 50S ribosomal protein L16 [Streptococcus parasanguinis ATCC 903]
 gi|296433590|gb|EFH19363.1| 50S ribosomal protein L16 [Streptococcus parasanguinis ATCC 15912]
 gi|304431695|gb|EFM34675.1| 50S ribosomal protein L16 [Streptococcus sp. oral taxon 071 str.
           73H25AP]
 gi|311097453|gb|EFQ55686.1| ribosomal protein L16 [Streptococcus parasanguinis F0405]
 gi|321142640|gb|EFX38104.1| 50S ribosomal protein L16 [Streptococcus parasanguinis ATCC 903]
          Length = 137

 Score =  186 bits (472), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 68/137 (49%), Positives = 94/137 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ ++F+G+++G AKGG  + FG + L+A  ++ I + +IEAAR A++R MKR
Sbjct: 1   MLVPKRVKHRREFRGKMRGEAKGGKEVAFGEYGLQATTSHWITNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP    TAK   VRMG GKG  E WV  VK G+++FEI GVSEE+AR A RL
Sbjct: 61  GGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVAPVKRGKVMFEIAGVSEEIAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            + KL V TKF++R  E
Sbjct: 121 ASHKLPVKTKFVKREAE 137


>gi|238916272|ref|YP_002929789.1| large subunit ribosomal protein L16 [Eubacterium eligens ATCC
           27750]
 gi|259645649|sp|C4Z2T7|RL16_EUBE2 RecName: Full=50S ribosomal protein L16
 gi|238871632|gb|ACR71342.1| large subunit ribosomal protein L16 [Eubacterium eligens ATCC
           27750]
          Length = 145

 Score =  186 bits (472), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 69/134 (51%), Positives = 90/134 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ +QF+G + G A  G++I  G F + A E   I S++IEAAR A++R +KR
Sbjct: 1   MLLPKRVKHRRQFRGSMAGKATRGNKITNGEFGIVATEPCWIKSNQIEAARVAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+V+I +FPD PVT KP  VRMGKGKGN+E WV  VKPGR++FEI GV+EE AR A RL
Sbjct: 61  GGKVFIKIFPDKPVTGKPIGVRMGKGKGNLECWVAVVKPGRVMFEISGVAEETAREALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL    K + R
Sbjct: 121 ATHKLPCKCKIVSR 134


>gi|315639314|ref|ZP_07894476.1| 50S ribosomal protein L16 [Campylobacter upsaliensis JV21]
 gi|315480640|gb|EFU71282.1| 50S ribosomal protein L16 [Campylobacter upsaliensis JV21]
          Length = 141

 Score =  186 bits (472), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 75/137 (54%), Positives = 96/137 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY K  KGR +G A  G+   FG +ALKA EA RI S +IEAAR A++R +KR
Sbjct: 1   MLMPKRTKYRKMMKGRNRGYANRGTEFTFGEYALKATEAGRINSRQIEAARIALTRFVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+ WI VFPD P+T KP E RMGKGKG+VE+WV  +KPGRI++E+ GVSE++AR+A  L
Sbjct: 61  QGKTWIRVFPDKPLTKKPLETRMGKGKGSVEEWVMNIKPGRIIYEMAGVSEDMARQALTL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
              KL   TKF+ R  +
Sbjct: 121 AMHKLPFKTKFVTRESQ 137


>gi|268680580|ref|YP_003305011.1| ribosomal protein L16 [Sulfurospirillum deleyianum DSM 6946]
 gi|268618611|gb|ACZ12976.1| ribosomal protein L16 [Sulfurospirillum deleyianum DSM 6946]
          Length = 141

 Score =  186 bits (472), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 77/137 (56%), Positives = 93/137 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY KQ KGR +G A+ G+ I FG   LKA EA RI S +IEAAR A +R +KR
Sbjct: 1   MLMPKRTKYKKQMKGRNRGEAQSGASISFGEIGLKAVEAGRIDSRQIEAARIAYTRHVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
             + WI VFPD P+TAKP E RMGKGKG+V+KWV  +KPGRI+FE+ GV EE+AR A  L
Sbjct: 61  QAKTWIRVFPDKPLTAKPLETRMGKGKGSVDKWVMNIKPGRIIFEMAGVPEELAREALTL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
              KL   TK + R  E
Sbjct: 121 AMHKLPFKTKIVTRESE 137


>gi|256831834|ref|YP_003160561.1| 50S ribosomal protein L16 [Jonesia denitrificans DSM 20603]
 gi|256685365|gb|ACV08258.1| ribosomal protein L16 [Jonesia denitrificans DSM 20603]
          Length = 139

 Score =  186 bits (472), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 58/135 (42%), Positives = 86/135 (63%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  K+ KQ      G +KGG+ + FG++ ++A     + + +IEAAR A++R +KR
Sbjct: 1   MLIPRRLKHRKQHHPSRSGASKGGNVVTFGDYGIQALTPAYVTNRQIEAARIAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI ++PD P+T KP E RMG GKG+ E WV  VKPG+I+FE+ GV E +AR A R 
Sbjct: 61  GGKVWINIYPDRPLTKKPAETRMGSGKGSPEWWVANVKPGKIVFELAGVPEPLAREAMRR 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  +F+ R 
Sbjct: 121 AMHKLPMKCRFVVRE 135


>gi|72163038|ref|YP_290695.1| 50S ribosomal protein L16 [Thermobifida fusca YX]
 gi|85542089|sp|Q47LK0|RL16_THEFY RecName: Full=50S ribosomal protein L16
 gi|71916770|gb|AAZ56672.1| LSU ribosomal protein L16P [Thermobifida fusca YX]
          Length = 138

 Score =  186 bits (472), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 59/136 (43%), Positives = 88/136 (64%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  K+ KQ    ++G AKGG+ + FG + ++A E+  + + +IEAAR A++R ++R
Sbjct: 1   MLIPRKVKHRKQHHPSLRGRAKGGTSVHFGEYGIQALESAYVTNRQIEAARIAMTRHIRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T KP E RMG GKG+ E WV  VK GR++FE+ GV E VA+ A R 
Sbjct: 61  GGKVWINIFPDRPLTKKPAETRMGSGKGSPEWWVAPVKAGRVMFELAGVPEPVAKEALRR 120

Query: 122 GAAKLSVVTKFIQRVV 137
              KL +  K ++R  
Sbjct: 121 AIHKLPMKCKVVKREA 136


>gi|284992867|ref|YP_003411421.1| 50S ribosomal protein L16 [Geodermatophilus obscurus DSM 43160]
 gi|284066112|gb|ADB77050.1| ribosomal protein L16 [Geodermatophilus obscurus DSM 43160]
          Length = 138

 Score =  186 bits (472), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 64/137 (46%), Positives = 89/137 (64%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  K+ KQ      G AKGG+ I FG +A++A E   + + +IE+AR A++R ++R
Sbjct: 1   MLIPRRVKHRKQHHPSRSGRAKGGTEINFGEYAIQALEPAYVTNRQIESARIAMTRHIRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI ++PD P+T KP E RMG GKG+ E WV  VKPGRI+FE+ GV+E VAR A R 
Sbjct: 61  GGKVWISIYPDRPLTKKPAETRMGSGKGSPEWWVANVKPGRIMFELSGVAEPVAREAMRR 120

Query: 122 GAAKLSVVTKFIQRVVE 138
              KL +  +FI R  E
Sbjct: 121 AIHKLPMKCRFITREGE 137


>gi|110227116|ref|YP_665595.1| ribosomal protein L16 [Populus alba]
 gi|115502627|sp|Q14FC0|RK16_POPAL RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|109945554|dbj|BAE97242.1| ribosomal protein L16 [Populus alba]
          Length = 135

 Score =  186 bits (472), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 64/132 (48%), Positives = 99/132 (75%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+RICFG +AL+A E   I S +IEA RRA++R ++R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGISSRGNRICFGRYALQALEPAWITSRQIEAGRRAMTRNVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +P+E RMG GKG+ E WV  VKPGR+++E+ GV+E +A++A  +
Sbjct: 61  GGKIWVRIFPDKPVTLRPSETRMGSGKGSPEYWVAVVKPGRMIYEMGGVAENIAKKAISI 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+FI
Sbjct: 121 AASKMPIRTQFI 132


>gi|238855075|ref|ZP_04645403.1| ribosomal protein L16 [Lactobacillus jensenii 269-3]
 gi|256852043|ref|ZP_05557430.1| ribosomal protein L16 [Lactobacillus jensenii 27-2-CHN]
 gi|260661388|ref|ZP_05862301.1| ribosomal protein L16 [Lactobacillus jensenii 115-3-CHN]
 gi|260664860|ref|ZP_05865711.1| ribosomal protein L16 [Lactobacillus jensenii SJ-7A-US]
 gi|297205082|ref|ZP_06922478.1| 50S ribosomal protein L16 [Lactobacillus jensenii JV-V16]
 gi|313472588|ref|ZP_07813077.1| ribosomal protein L16 [Lactobacillus jensenii 1153]
 gi|238832319|gb|EEQ24628.1| ribosomal protein L16 [Lactobacillus jensenii 269-3]
 gi|256615455|gb|EEU20645.1| ribosomal protein L16 [Lactobacillus jensenii 27-2-CHN]
 gi|260547843|gb|EEX23820.1| ribosomal protein L16 [Lactobacillus jensenii 115-3-CHN]
 gi|260561343|gb|EEX27316.1| ribosomal protein L16 [Lactobacillus jensenii SJ-7A-US]
 gi|297149660|gb|EFH29957.1| 50S ribosomal protein L16 [Lactobacillus jensenii JV-V16]
 gi|313448945|gb|EFR61263.1| ribosomal protein L16 [Lactobacillus jensenii 1153]
          Length = 146

 Score =  186 bits (472), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 68/138 (49%), Positives = 90/138 (65%)

Query: 1   MLRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMK 60
           M   PK  K+ ++F+G+++G AKGG  I FG + L A E++ I + +IEAAR A++R MK
Sbjct: 1   MPLVPKRVKHRREFRGKMRGAAKGGKTIAFGEYGLMALESHWITNRQIEAARVAMTRYMK 60

Query: 61  RAGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFR 120
           R G+VWI +FP    TAK   VRMG GKG    WV  VK  +I+FEI GVSEEVAR A R
Sbjct: 61  RGGKVWIRIFPHKSYTAKGVGVRMGSGKGAPAGWVAVVKREKIMFEIGGVSEEVAREALR 120

Query: 121 LGAAKLSVVTKFIQRVVE 138
           L + KL +  KF+ +  E
Sbjct: 121 LASTKLPIKCKFVAKSTE 138


>gi|197131816|gb|ACH47426.1| ribosomal protein L16 [Geranium carolinianum]
          Length = 139

 Score =  186 bits (472), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 65/132 (49%), Positives = 96/132 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ K+ +G+++G+A  GSRI FG +AL+A E   I S +IEA RRA++R ++R
Sbjct: 1   MLSPKKTKFRKEHRGKMRGIASKGSRISFGRYALQALEPAWITSRQIEAGRRAMTRNVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT + TE RMG GKG+ E WV  VKPGRIL+E+ GV+E +AR+A  +
Sbjct: 61  GGKIWVRIFPDKPVTVRSTETRMGSGKGSPEYWVAVVKPGRILYEMGGVAENIARKAISI 120

Query: 122 GAAKLSVVTKFI 133
             +K+ + T+FI
Sbjct: 121 AGSKMPIRTQFI 132


>gi|189465425|ref|ZP_03014210.1| hypothetical protein BACINT_01778 [Bacteroides intestinalis DSM
           17393]
 gi|224537824|ref|ZP_03678363.1| hypothetical protein BACCELL_02711 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|189437699|gb|EDV06684.1| hypothetical protein BACINT_01778 [Bacteroides intestinalis DSM
           17393]
 gi|224520510|gb|EEF89615.1| hypothetical protein BACCELL_02711 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 144

 Score =  186 bits (472), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 70/134 (52%), Positives = 96/134 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ +Q KGR KG+A+ G+++ FG+F +KA E   I   +IEAAR A++R M+R
Sbjct: 1   MLQPKKTKFRRQQKGRQKGIAQRGNQLAFGSFGIKALETKWITGRQIEAARIAVTRYMQR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T KP +VRMGKGKG  E +V  V PGRI+ E +GVS E+A+ A RL
Sbjct: 61  QGQIWIRIFPDKPITRKPADVRMGKGKGAPEGFVAPVTPGRIIIEAEGVSYEIAKEALRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + TKF+ R
Sbjct: 121 AAQKLPITTKFVVR 134


>gi|85709050|ref|ZP_01040116.1| 50S ribosomal protein L16 [Erythrobacter sp. NAP1]
 gi|85690584|gb|EAQ30587.1| 50S ribosomal protein L16 [Erythrobacter sp. NAP1]
          Length = 144

 Score =  186 bits (472), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 84/134 (62%), Positives = 100/134 (74%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TKY K FKG+IKG AKGG+ + FG++ LKA E  RI + +IEAARRAI+R MKR
Sbjct: 1   MLQPKKTKYRKAFKGKIKGDAKGGTTLNFGSYGLKALEPERITARQIEAARRAITRAMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI VFPDVPV+ KP EVR GKGKG+VE W  RVKPGRILFE+DGV  +VA  AF  
Sbjct: 61  QGRLWIRVFPDVPVSKKPAEVRQGKGKGSVEYWAARVKPGRILFELDGVDGQVAALAFER 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + TK + R
Sbjct: 121 AAMKLPIKTKVVAR 134


>gi|283782764|ref|YP_003373518.1| ribosomal protein L16 [Gardnerella vaginalis 409-05]
 gi|298253065|ref|ZP_06976857.1| ribosomal protein L16/L10E [Gardnerella vaginalis 5-1]
 gi|283441699|gb|ADB14165.1| ribosomal protein L16 [Gardnerella vaginalis 409-05]
 gi|297532460|gb|EFH71346.1| ribosomal protein L16/L10E [Gardnerella vaginalis 5-1]
          Length = 139

 Score =  186 bits (472), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 63/135 (46%), Positives = 86/135 (63%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY KQ +    G++KGG+ I FG+F ++A     I + +IEAAR A++R +KR
Sbjct: 1   MLIPKRTKYRKQHRPTRSGMSKGGTEIAFGDFGIQALAPAYITNRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPD P+T  P   RMG GKG  E W+  + PGR++FEI GVSE++AR A R 
Sbjct: 61  GGRVWITIFPDRPLTKHPLGARMGSGKGAPEFWIANIHPGRVMFEIGGVSEDIAREALRR 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  + I R 
Sbjct: 121 AIDKLPMKCRVIARE 135


>gi|239817866|ref|YP_002946776.1| 50S ribosomal protein L16 [Variovorax paradoxus S110]
 gi|259646064|sp|C5CP46|RL16_VARPS RecName: Full=50S ribosomal protein L16
 gi|239804443|gb|ACS21510.1| ribosomal protein L16 [Variovorax paradoxus S110]
          Length = 138

 Score =  186 bits (472), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 74/135 (54%), Positives = 96/135 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QP   K+ K+ KGR  GVA  G+ + FG+F LK  +  R+ + +IEAARRAISR +KR
Sbjct: 1   MLQPARRKFRKEQKGRNTGVATRGNSVAFGDFGLKCTDRGRLTARQIEAARRAISRHVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI VFPD P++ KP EVRMG GKGN E +V  ++PG+I+FEI GV EE+AR AFRL
Sbjct: 61  GGRIWIRVFPDKPISTKPAEVRMGNGKGNPEYYVAEIQPGKIVFEIVGVPEELAREAFRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            AAKL + T F+ R 
Sbjct: 121 AAAKLPLRTTFVARQ 135


>gi|160894749|ref|ZP_02075524.1| hypothetical protein CLOL250_02300 [Clostridium sp. L2-50]
 gi|156863683|gb|EDO57114.1| hypothetical protein CLOL250_02300 [Clostridium sp. L2-50]
          Length = 145

 Score =  185 bits (471), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 68/135 (50%), Positives = 89/135 (65%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K  KQF+G + G A  G++I  G + L A E   I S++IEAAR A++R MKR
Sbjct: 1   MLMPKRVKRRKQFRGTMAGKALRGNKITNGQYGLVALEPAWIKSNQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           +G+V+I +FPD PVTAKP E RMG GKG +E WV  VKPGR++FEI  V EEVA+ A RL
Sbjct: 61  SGKVFIKIFPDKPVTAKPAETRMGSGKGALEYWVAVVKPGRVMFEIADVPEEVAKEALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  K + + 
Sbjct: 121 AMHKLPLKCKIVSKE 135


>gi|37912956|gb|AAR05288.1| ribosomal protein L16/L10E [uncultured marine gamma proteobacterium
           EB000-45B06]
 gi|40063184|gb|AAR38021.1| ribosomal protein L16 [uncultured marine bacterium 562]
          Length = 136

 Score =  185 bits (471), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 76/136 (55%), Positives = 101/136 (74%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGR +G+A+ G+ + FG F L A +  RI + +IEAARRA++R +KR
Sbjct: 1   MLQPKQTKFRKMHKGRNRGLAQNGNTVAFGRFGLVASDRGRITARQIEAARRAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G +WI +FPD P+T KP EVRMGKGKGNVE WV  V+PG+++FE+ GV EE+AR AF+L
Sbjct: 61  GGNIWIRIFPDKPITKKPLEVRMGKGKGNVEYWVALVQPGKVMFEMAGVEEELAREAFKL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL V T FI++ V
Sbjct: 121 AAAKLPVKTHFIRKDV 136


>gi|260599632|ref|YP_003212203.1| 50S ribosomal protein L16 [Cronobacter turicensis z3032]
 gi|260218809|emb|CBA34159.1| 50S ribosomal protein L16 [Cronobacter turicensis z3032]
          Length = 136

 Score =  185 bits (471), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 74/136 (54%), Positives = 102/136 (75%), Gaps = 1/136 (0%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGR +G+A+ G+ + FG + LKA    R+ + +IEAARRA++R +KR
Sbjct: 1   MLQPKRTKFRKVHKGRNRGLAQ-GTDVSFGTYGLKAVGRGRLTARQIEAARRAMTRAVKR 59

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD P+T KP EVRMGKGKGNVE WV  ++PG++L+E+DGV EE+AR AF+L
Sbjct: 60  QGKIWIRVFPDKPITEKPLEVRMGKGKGNVEYWVALIQPGKVLYEMDGVPEELAREAFKL 119

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + T F+ + V
Sbjct: 120 AAAKLPIKTTFVTKTV 135


>gi|237653989|ref|YP_002890303.1| 50S ribosomal protein L16 [Thauera sp. MZ1T]
 gi|237625236|gb|ACR01926.1| ribosomal protein L16 [Thauera sp. MZ1T]
          Length = 138

 Score =  185 bits (471), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 70/136 (51%), Positives = 98/136 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QP   KY K+ KGR  GVA  G+++ FG + LKA    R+ + +IE+ARRA++R +KR
Sbjct: 1   MLQPTRRKYRKEQKGRNTGVATRGAKVSFGEYGLKAIGRGRLTARQIESARRAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI +FPD P++ KP EVRMG GKGN E WV  ++PG++L+E+DGV E +AR AFRL
Sbjct: 61  GGRIWIRIFPDKPISKKPAEVRMGNGKGNPEYWVAEIQPGKVLYEMDGVDEALAREAFRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + T F+ R++
Sbjct: 121 AAAKLPIETVFVTRLI 136


>gi|119025346|ref|YP_909191.1| 50S ribosomal protein L16 [Bifidobacterium adolescentis ATCC 15703]
 gi|212716604|ref|ZP_03324732.1| hypothetical protein BIFCAT_01533 [Bifidobacterium catenulatum DSM
           16992]
 gi|225351038|ref|ZP_03742061.1| hypothetical protein BIFPSEUDO_02620 [Bifidobacterium
           pseudocatenulatum DSM 20438]
 gi|166234549|sp|A1A076|RL16_BIFAA RecName: Full=50S ribosomal protein L16
 gi|118764930|dbj|BAF39109.1| 50S ribosomal protein L16 [Bifidobacterium adolescentis ATCC 15703]
 gi|212660308|gb|EEB20883.1| hypothetical protein BIFCAT_01533 [Bifidobacterium catenulatum DSM
           16992]
 gi|225158494|gb|EEG71736.1| hypothetical protein BIFPSEUDO_02620 [Bifidobacterium
           pseudocatenulatum DSM 20438]
          Length = 139

 Score =  185 bits (471), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 65/135 (48%), Positives = 88/135 (65%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY KQ +   +G++KGG+ I FG+F ++A     + + +IEAAR A++R +KR
Sbjct: 1   MLIPKRTKYRKQHRPVRRGMSKGGNEIAFGDFGIQALAPAYVTNRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPD P+T KP   RMG GKG  E W+  V PGR++FEI GVSE+VAR A R 
Sbjct: 61  GGRVWITIFPDRPLTKKPLGTRMGSGKGTPEFWIANVHPGRVMFEIGGVSEDVAREALRR 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  + I R 
Sbjct: 121 AIDKLPMKCRVIARE 135


>gi|154249810|ref|YP_001410635.1| 50S ribosomal protein L16 [Fervidobacterium nodosum Rt17-B1]
 gi|171769375|sp|A7HM45|RL16_FERNB RecName: Full=50S ribosomal protein L16
 gi|154153746|gb|ABS60978.1| ribosomal protein L16 [Fervidobacterium nodosum Rt17-B1]
          Length = 142

 Score =  185 bits (471), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 67/134 (50%), Positives = 89/134 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY KQ +GR KG AKGG+ + FG + LKA E   I + +IEA R AI+R +K+
Sbjct: 1   MLMPKRVKYRKQHRGRTKGDAKGGALVMFGEYGLKALEPAWITAQQIEACRLAITRTLKK 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD   T  P E ++GKGKGNVE WV  VKPG+++FEI GV EE+A +A   
Sbjct: 61  EGKLWIKIFPDKSYTKHPPETKLGKGKGNVEGWVAVVKPGKVMFEIGGVEEELAIKALEY 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + TK + R
Sbjct: 121 AATKLPIKTKIVTR 134


>gi|91216903|ref|ZP_01253867.1| 50S ribosomal protein L16 [Psychroflexus torquis ATCC 700755]
 gi|91185064|gb|EAS71443.1| 50S ribosomal protein L16 [Psychroflexus torquis ATCC 700755]
          Length = 139

 Score =  185 bits (471), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 72/133 (54%), Positives = 94/133 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQ KG +KGV++ G R+  G F +K+ +++ + + +IEA+R A +R MKR
Sbjct: 1   MLQPKRTKFRKQQKGSMKGVSQRGHRLSNGTFGIKSLDSSFVTARQIEASRIAATRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G +WI +FPD P+T KP EVRMGKGKG+VE W   V+PGRILFEI GV   VA+ A RL
Sbjct: 61  EGSIWIKIFPDKPITKKPLEVRMGKGKGSVEYWAAVVQPGRILFEIGGVPHSVAKEALRL 120

Query: 122 GAAKLSVVTKFIQ 134
            A KL V TKFI 
Sbjct: 121 AAQKLPVKTKFIV 133


>gi|86141147|ref|ZP_01059693.1| 50S ribosomal protein L16 [Leeuwenhoekiella blandensis MED217]
 gi|85831706|gb|EAQ50161.1| 50S ribosomal protein L16 [Leeuwenhoekiella blandensis MED217]
          Length = 140

 Score =  185 bits (471), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 76/133 (57%), Positives = 94/133 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQ KGR+KG A  G ++  G F +K+ +AN + + +IEAAR A +R MKR
Sbjct: 1   MLQPKKTKFRKQQKGRMKGNAGRGHQLSNGTFGIKSLDANFLTARQIEAARIAATRFMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G +WI +FPD P+T KP EVRMGKGKG VE W   VKPGR+LFEI GVSE VAR A RL
Sbjct: 61  EGSLWIRIFPDKPITKKPLEVRMGKGKGAVEYWAAVVKPGRMLFEIGGVSEPVAREALRL 120

Query: 122 GAAKLSVVTKFIQ 134
            A KL V TK++ 
Sbjct: 121 AAQKLPVRTKYVV 133


>gi|307565136|ref|ZP_07627644.1| 50S ribosomal protein L16 [Prevotella amnii CRIS 21A-A]
 gi|307346167|gb|EFN91496.1| 50S ribosomal protein L16 [Prevotella amnii CRIS 21A-A]
          Length = 142

 Score =  185 bits (471), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 72/135 (53%), Positives = 92/135 (68%), Gaps = 1/135 (0%)

Query: 2   LRQPKNTKYPKQFKGR-IKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMK 60
           + QPK  KY +   GR  KG A  G+++ FG+F +K  EA  I S +IEAAR AI+R M 
Sbjct: 1   MLQPKRVKYRRPQDGRGNKGNAHRGTQLAFGSFGIKTLEAKWIDSRQIEAARVAINRYMN 60

Query: 61  RAGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFR 120
           R G+VWI +FPD P+T KP +VRMGKGKG+   WV  V PGR+LFE++GV  ++A+ A R
Sbjct: 61  RQGQVWIRIFPDKPITRKPADVRMGKGKGDPAGWVAPVTPGRVLFEVEGVGFDIAKEALR 120

Query: 121 LGAAKLSVVTKFIQR 135
           L A KL V TKFI R
Sbjct: 121 LAAQKLPVKTKFIVR 135


>gi|42524368|ref|NP_969748.1| 50S ribosomal protein L16 [Bdellovibrio bacteriovorus HD100]
 gi|81616517|sp|Q6MJ21|RL16_BDEBA RecName: Full=50S ribosomal protein L16
 gi|39576577|emb|CAE80741.1| 50S ribosomal protein L16 [Bdellovibrio bacteriovorus HD100]
          Length = 135

 Score =  185 bits (471), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 66/135 (48%), Positives = 90/135 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQF GR  G A  G+ + FG++ L+A E  R+ + ++EA R AISR +KR
Sbjct: 1   MLSPKRVKWRKQFVGRATGFAVRGANLDFGDYGLQAVEEGRLTARQLEAGRIAISRSVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W  VFP++PVT KP E RMG GKGN E WV RV PG++LFE++GV+ E A+ AF  
Sbjct: 61  GGKIWCRVFPNIPVTKKPAETRMGSGKGNPELWVARVLPGKVLFEMNGVTREQAKEAFER 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL   T+F+ R 
Sbjct: 121 AAHKLPFKTRFLVRE 135


>gi|119899699|ref|YP_934912.1| 50S ribosomal protein L16 [Azoarcus sp. BH72]
 gi|166234546|sp|A1KB20|RL16_AZOSB RecName: Full=50S ribosomal protein L16
 gi|119672112|emb|CAL96026.1| 50S ribosomal protein L16 [Azoarcus sp. BH72]
          Length = 137

 Score =  185 bits (471), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 71/136 (52%), Positives = 98/136 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QP   KY K+ KGR  G+A  G+++ FG+F LKA    R+ + +IE+ARRA++R +KR
Sbjct: 1   MLQPSRRKYRKEQKGRNTGLATRGTKVSFGDFGLKAIARGRLTARQIESARRAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI +FPD P++ KP EVRMG GKGN E WV  ++PG++L+E+DGV E +AR AFRL
Sbjct: 61  GGRIWIRIFPDKPISKKPAEVRMGNGKGNPEYWVAEIQPGKVLYEMDGVDEALAREAFRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + T F+ R V
Sbjct: 121 AAAKLPLETVFVTRQV 136


>gi|256370787|ref|YP_003108612.1| 50S ribosomal protein L16 [Candidatus Sulcia muelleri SMDSEM]
 gi|256009579|gb|ACU52939.1| 50S ribosomal subunit protein L16 [Candidatus Sulcia muelleri
           SMDSEM]
          Length = 136

 Score =  185 bits (471), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 68/132 (51%), Positives = 90/132 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQ KGRIKG +  G+++ FG + +K+ +   I   +IE+AR A +R +KR
Sbjct: 1   MLQPKKTKFEKQQKGRIKGNSTRGTKLYFGKYGIKSLDPGWITDRQIESARVAATRFLKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD PVT KP EVRMGKGKG  + WV  +KPGRIL EID V   + + A RL
Sbjct: 61  QGKLWINIFPDKPVTKKPQEVRMGKGKGGRDHWVAVIKPGRILIEIDEVDFLLGKEALRL 120

Query: 122 GAAKLSVVTKFI 133
            + KL V TKFI
Sbjct: 121 ASQKLPVKTKFI 132


>gi|268593548|ref|ZP_06127769.1| ribosomal protein L16 [Providencia rettgeri DSM 1131]
 gi|291310826|gb|EFE51279.1| ribosomal protein L16 [Providencia rettgeri DSM 1131]
          Length = 136

 Score =  185 bits (471), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 75/136 (55%), Positives = 101/136 (74%), Gaps = 1/136 (0%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGR +G+A+ G+ + FG F LKA    R+ + +IEAARRA++R +KR
Sbjct: 1   MLQPKRTKFRKVHKGRNRGLAQ-GTDVSFGTFGLKAVGRGRLTARQIEAARRAMTRAIKR 59

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD P+T KP EVRMGKGKGNVE WV  ++PG++L+E+DGV EE+AR AF L
Sbjct: 60  QGKIWIRVFPDKPITEKPLEVRMGKGKGNVEYWVALIQPGKVLYEMDGVPEELAREAFSL 119

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + T F+ + V
Sbjct: 120 AAAKLPIKTTFVTKTV 135


>gi|255067451|ref|ZP_05319306.1| ribosomal protein L16 [Neisseria sicca ATCC 29256]
 gi|261364862|ref|ZP_05977745.1| ribosomal protein L16 [Neisseria mucosa ATCC 25996]
 gi|261378048|ref|ZP_05982621.1| ribosomal protein L16 [Neisseria cinerea ATCC 14685]
 gi|261400059|ref|ZP_05986184.1| ribosomal protein L16 [Neisseria lactamica ATCC 23970]
 gi|298370584|ref|ZP_06981899.1| ribosomal protein L16 [Neisseria sp. oral taxon 014 str. F0314]
 gi|313667448|ref|YP_004047732.1| 50S ribosomal protein L16 [Neisseria lactamica ST-640]
 gi|255048246|gb|EET43710.1| ribosomal protein L16 [Neisseria sicca ATCC 29256]
 gi|269145498|gb|EEZ71916.1| ribosomal protein L16 [Neisseria cinerea ATCC 14685]
 gi|269210285|gb|EEZ76740.1| ribosomal protein L16 [Neisseria lactamica ATCC 23970]
 gi|288566911|gb|EFC88471.1| ribosomal protein L16 [Neisseria mucosa ATCC 25996]
 gi|298281194|gb|EFI22684.1| ribosomal protein L16 [Neisseria sp. oral taxon 014 str. F0314]
 gi|313004910|emb|CBN86336.1| 50S ribosomal protein L16 [Neisseria lactamica 020-06]
          Length = 138

 Score =  185 bits (471), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 72/136 (52%), Positives = 96/136 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QP   KY KQ KGR  G+A  G+++ FG F LKA    R+ + +IEAARR ++R +KR
Sbjct: 1   MLQPTRLKYRKQQKGRNTGIATRGNKVSFGEFGLKAVGRGRLTARQIEAARRTMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI VFPD P+T KP +VRMG GKGNVE ++  +KPG++L+E+DGV E +AR AF L
Sbjct: 61  GGRIWIRVFPDKPITEKPIQVRMGGGKGNVEYYIAEIKPGKVLYEMDGVPEALAREAFEL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + T F+ R V
Sbjct: 121 AAAKLPIPTTFVVRQV 136


>gi|145225618|ref|YP_001136296.1| 50S ribosomal protein L16 [Mycobacterium gilvum PYR-GCK]
 gi|315445971|ref|YP_004078850.1| 50S ribosomal protein L16P [Mycobacterium sp. Spyr1]
 gi|189041469|sp|A4TEB7|RL16_MYCGI RecName: Full=50S ribosomal protein L16
 gi|145218104|gb|ABP47508.1| LSU ribosomal protein L16P [Mycobacterium gilvum PYR-GCK]
 gi|315264274|gb|ADU01016.1| LSU ribosomal protein L16P [Mycobacterium sp. Spyr1]
          Length = 138

 Score =  185 bits (471), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 58/135 (42%), Positives = 85/135 (62%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  K+ KQ   R +G+A GG+ + FG++ ++A     I + +IE+AR AI+R +KR
Sbjct: 1   MLIPRKVKHRKQHHPRQRGIASGGTSVSFGDYGIQAMGHAYITNRQIESARIAINRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T KP E RMG GKG+ E WV  VKPGR+LFE+    E++AR A   
Sbjct: 61  GGKVWINIFPDRPLTKKPAETRMGSGKGSPEWWVANVKPGRVLFELSYPDEKIAREALTR 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  + + R 
Sbjct: 121 AIHKLPIKARIVTRE 135


>gi|296130488|ref|YP_003637738.1| ribosomal protein L16 [Cellulomonas flavigena DSM 20109]
 gi|296022303|gb|ADG75539.1| ribosomal protein L16 [Cellulomonas flavigena DSM 20109]
          Length = 138

 Score =  185 bits (471), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 62/135 (45%), Positives = 86/135 (63%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  K+ KQ      G A GG+ I FG + ++A E   + + +IEAAR A++R +KR
Sbjct: 1   MLIPRRLKHRKQHHPGRSGAATGGTVISFGEYGIQALEPAYVTNRQIEAARIAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI ++PD P+T KP E RMG GKG+ E W+  VKPGR+LFE+ GV E +AR A R 
Sbjct: 61  GGKVWINIYPDRPLTKKPAETRMGSGKGSPEWWIANVKPGRVLFELAGVPEPLAREAMRR 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL + T+FI R 
Sbjct: 121 AQHKLPMKTRFIVRE 135


>gi|184200269|ref|YP_001854476.1| 50S ribosomal protein L16 [Kocuria rhizophila DC2201]
 gi|226710738|sp|B2GJ00|RL16_KOCRD RecName: Full=50S ribosomal protein L16
 gi|183580499|dbj|BAG28970.1| 50S ribosomal protein L16 [Kocuria rhizophila DC2201]
          Length = 138

 Score =  185 bits (471), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 62/135 (45%), Positives = 91/135 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  K+ KQ   R +G AKGG+++ FG + ++A     + + +IEAAR A++R +KR
Sbjct: 1   MLIPRRVKFRKQHHPRRRGQAKGGTQVTFGEWGIQAMSPAYVTNRQIEAARIAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI ++PD P+T KP E RMG GKG+ E W+  VKPGR++FEI GVSE+VAR A RL
Sbjct: 61  GGKVWINIYPDRPLTKKPAETRMGSGKGSPEWWIANVKPGRVMFEISGVSEDVAREALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  + ++R 
Sbjct: 121 AIHKLPMKARIVRRE 135


>gi|85715124|ref|ZP_01046108.1| 50S ribosomal protein L16 [Nitrobacter sp. Nb-311A]
 gi|85698039|gb|EAQ35912.1| 50S ribosomal protein L16 [Nitrobacter sp. Nb-311A]
          Length = 137

 Score =  185 bits (471), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 81/137 (59%), Positives = 99/137 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGRI G A  G+ + FG F LKA    RI + +IEAARRA++R MKR
Sbjct: 1   MMQPKKTKFRKAHKGRIHGTASSGATLAFGQFGLKAMAPERITARQIEAARRALTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AGRVWI +FPDVPV+ KP EVRMG GKG  E WV RVKPGR+LFEIDGV+ + A+ A  L
Sbjct: 61  AGRVWIRIFPDVPVSKKPAEVRMGSGKGAPELWVVRVKPGRVLFEIDGVAPQTAKEALTL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            AAKL + T+F+ R+ E
Sbjct: 121 AAAKLPIKTRFVARIAE 137


>gi|94312241|ref|YP_585451.1| 50S ribosomal protein L16 [Cupriavidus metallidurans CH34]
 gi|115502778|sp|Q1LI44|RL16_RALME RecName: Full=50S ribosomal protein L16
 gi|93356093|gb|ABF10182.1| 50S ribosomal subunit protein L16 [Cupriavidus metallidurans CH34]
          Length = 138

 Score =  185 bits (471), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 73/136 (53%), Positives = 98/136 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK  KY K+ KGR  G A  G+ + FG F LKA    R+ + +IE+ARRA++R +KR
Sbjct: 1   MLQPKRRKYRKEQKGRNTGKATRGNAVSFGEFGLKAMGRGRLTARQIESARRAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI +FPD P++ KP EVRMG GKGN E +V  ++PG++L+E+DGVSEE+AR AFRL
Sbjct: 61  GGRIWIRIFPDKPISKKPAEVRMGNGKGNPEYYVAEIQPGKMLYEMDGVSEELAREAFRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + T F+ R V
Sbjct: 121 AAAKLPIATNFVVRQV 136


>gi|183600746|ref|ZP_02962239.1| hypothetical protein PROSTU_04340 [Providencia stuartii ATCC 25827]
 gi|212708988|ref|ZP_03317116.1| hypothetical protein PROVALCAL_00020 [Providencia alcalifaciens DSM
           30120]
 gi|261346928|ref|ZP_05974572.1| ribosomal protein L16 [Providencia rustigianii DSM 4541]
 gi|188019724|gb|EDU57764.1| hypothetical protein PROSTU_04340 [Providencia stuartii ATCC 25827]
 gi|212688354|gb|EEB47882.1| hypothetical protein PROVALCAL_00020 [Providencia alcalifaciens DSM
           30120]
 gi|282564993|gb|EFB70528.1| ribosomal protein L16 [Providencia rustigianii DSM 4541]
          Length = 136

 Score =  185 bits (471), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 75/136 (55%), Positives = 101/136 (74%), Gaps = 1/136 (0%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGR +G+A+ G+ + FG F LKA    R+ + +IEAARRA++R +KR
Sbjct: 1   MLQPKRTKFRKVHKGRNRGLAQ-GTDVSFGTFGLKAVGRGRLTARQIEAARRAMTRAVKR 59

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD P+T KP EVRMGKGKGNVE WV  ++PG++L+E+DGV EE+AR AF L
Sbjct: 60  QGKIWIRVFPDKPITEKPLEVRMGKGKGNVEYWVALIQPGKVLYEMDGVPEELAREAFSL 119

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + T F+ + V
Sbjct: 120 AAAKLPIKTTFVTKTV 135


>gi|73542856|ref|YP_297376.1| 50S ribosomal protein L16 [Ralstonia eutropha JMP134]
 gi|113869424|ref|YP_727913.1| 50S ribosomal protein L16 [Ralstonia eutropha H16]
 gi|194291015|ref|YP_002006922.1| 50S ribosomal protein l16 [Cupriavidus taiwanensis LMG 19424]
 gi|85541820|sp|Q46WF1|RL16_RALEJ RecName: Full=50S ribosomal protein L16
 gi|122946540|sp|Q0K626|RL16_RALEH RecName: Full=50S ribosomal protein L16
 gi|226710708|sp|B3R7R6|RL16_CUPTR RecName: Full=50S ribosomal protein L16
 gi|72120269|gb|AAZ62532.1| LSU ribosomal protein L16P [Ralstonia eutropha JMP134]
 gi|113528200|emb|CAJ94545.1| LSU ribosomal protein L16 [Ralstonia eutropha H16]
 gi|193224850|emb|CAQ70861.1| 50S ribosomal subunit protein L16 [Cupriavidus taiwanensis LMG
           19424]
          Length = 138

 Score =  185 bits (471), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 72/136 (52%), Positives = 98/136 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK  KY K+ KGR  G A  G+ + FG F LKA    R+ + +IE+ARRA++R +KR
Sbjct: 1   MLQPKRRKYRKEQKGRNTGKATRGNAVSFGEFGLKAMGRGRLTARQIESARRAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI +FPD P++ KP EVRMG GKGN E +V  ++PG++L+E+DGVSE++AR AFRL
Sbjct: 61  GGRIWIRIFPDKPISKKPAEVRMGNGKGNPEYYVAEIQPGKMLYEMDGVSEDLAREAFRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + T F+ R V
Sbjct: 121 AAAKLPIATNFVVRQV 136


>gi|50234009|ref|YP_052787.1| ribosomal protein L16 [Oryza nivara]
 gi|68566028|sp|Q6END6|RK16_ORYNI RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|148839614|sp|P0C442|RK16_ORYSI RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|49615033|dbj|BAD26816.1| ribosomal protein L16 [Oryza nivara]
          Length = 136

 Score =  185 bits (471), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 66/136 (48%), Positives = 97/136 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG +  G+ ICFG +AL+A E   I + +IEA RRA++R  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGKSYRGNCICFGRYALQALEPTWITARQIEAGRRAMTRYARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +PTE RMG GKG+ E WV  VKPGRIL+E+ GVSE VAR A  +
Sbjct: 61  GGKIWVRIFPDKPVTIRPTETRMGSGKGSPEYWVAVVKPGRILYEMGGVSETVARVAISI 120

Query: 122 GAAKLSVVTKFIQRVV 137
            A+K+ + ++F++  +
Sbjct: 121 AASKMPIRSQFLRLEI 136


>gi|186477581|ref|YP_001859051.1| 50S ribosomal protein L16 [Burkholderia phymatum STM815]
 gi|226710692|sp|B2JI59|RL16_BURP8 RecName: Full=50S ribosomal protein L16
 gi|184194040|gb|ACC72005.1| ribosomal protein L16 [Burkholderia phymatum STM815]
          Length = 138

 Score =  185 bits (471), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 73/135 (54%), Positives = 98/135 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK  KY K+ KGR  GVA  G+ + FG + LKA    R+ + +IEAARRA++R +KR
Sbjct: 1   MLQPKRRKYRKEQKGRNTGVATRGNAVSFGEYGLKAIGRGRLTARQIEAARRAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI +FPD P++ KP EVRMG GKGN E +V  ++PG++L+E+DGVSEE+AR AFRL
Sbjct: 61  GGRIWIRIFPDKPISQKPAEVRMGNGKGNPEYYVAEIQPGKMLYEMDGVSEELAREAFRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            AAKL + T F+ R 
Sbjct: 121 AAAKLPLKTTFMVRQ 135


>gi|108804967|ref|YP_644904.1| 50S ribosomal protein L16 [Rubrobacter xylanophilus DSM 9941]
 gi|115502789|sp|Q1AU36|RL16_RUBXD RecName: Full=50S ribosomal protein L16
 gi|108766210|gb|ABG05092.1| LSU ribosomal protein L16P [Rubrobacter xylanophilus DSM 9941]
          Length = 138

 Score =  185 bits (471), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 67/134 (50%), Positives = 94/134 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  K+ K  +GR+KG AKGG+ + FG + L+A E   I + +IEAAR A++R ++R
Sbjct: 1   MLVPRKLKWRKPQRGRMKGRAKGGTEVQFGEYGLQALEPAWITNRQIEAARIAMTRKIRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP  PVT KP E RMG GKG+ E++V  VKPGR++FE+ GV EE+AR A RL
Sbjct: 61  GGKVWINIFPHKPVTKKPAETRMGSGKGSPEEYVAVVKPGRVMFEMSGVGEELAREAMRL 120

Query: 122 GAAKLSVVTKFIQR 135
            A KL + T+F+ R
Sbjct: 121 AAQKLPIKTRFLVR 134


>gi|294674764|ref|YP_003575380.1| 50S ribosomal protein L16 [Prevotella ruminicola 23]
 gi|294473906|gb|ADE83295.1| ribosomal protein L16 [Prevotella ruminicola 23]
          Length = 142

 Score =  185 bits (471), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 71/135 (52%), Positives = 92/135 (68%), Gaps = 1/135 (0%)

Query: 2   LRQPKNTKYPKQFKGR-IKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMK 60
           + QPK  +Y +   GR  KG A  G+ + FG+F +K  +A  I S +IEAAR AI+R M 
Sbjct: 1   MLQPKRVRYRRPQDGRGNKGNAHRGTTLAFGSFGIKTLDAKWIDSRQIEAARVAINRYMN 60

Query: 61  RAGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFR 120
           R G+VWI +FPD P+T KP +VRMGKGKG+   WV  V PGRILFE++GV  ++A+ A R
Sbjct: 61  REGQVWIRIFPDKPITRKPADVRMGKGKGDPAGWVAPVTPGRILFEVEGVPFDIAKEALR 120

Query: 121 LGAAKLSVVTKFIQR 135
           LGA KL V TKF+ R
Sbjct: 121 LGAQKLPVKTKFVVR 135


>gi|75675563|ref|YP_317984.1| 50S ribosomal protein L16 [Nitrobacter winogradskyi Nb-255]
 gi|85541811|sp|Q3SSV9|RL16_NITWN RecName: Full=50S ribosomal protein L16
 gi|74420433|gb|ABA04632.1| LSU ribosomal protein L16P [Nitrobacter winogradskyi Nb-255]
          Length = 137

 Score =  185 bits (471), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 83/137 (60%), Positives = 100/137 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGRI GVA  G+ + FG F LKA    RI + +IEAARRA++R MKR
Sbjct: 1   MMQPKKTKFRKAHKGRIHGVASSGATLAFGQFGLKAMAPERITARQIEAARRALTRHMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AGRVWI VFPDVPV+ KP EVRMG GKG  E WV RVKPGR+LFEIDGV+ + A+ A  L
Sbjct: 61  AGRVWIRVFPDVPVSKKPAEVRMGSGKGAPELWVVRVKPGRVLFEIDGVAPQTAKEALTL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            AAKL + T+F+ R+ E
Sbjct: 121 AAAKLPIKTRFVARIAE 137


>gi|332107873|gb|EGJ09097.1| 50S ribosomal protein L16 [Rubrivivax benzoatilyticus JA2]
          Length = 138

 Score =  185 bits (471), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 71/136 (52%), Positives = 96/136 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QP   K+ K+ KGR  G+A  G+ + FG F LKA E  RI + +IEAARRAISR +KR
Sbjct: 1   MLQPARRKFRKEHKGRNTGIATRGNNVSFGEFGLKATERGRITARQIEAARRAISRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR++I +FPD P++ KP EVRMG GKGN E +V  ++PG++L+EI+GV E++AR AF L
Sbjct: 61  GGRIFIRIFPDKPISQKPAEVRMGNGKGNPEFYVAEIQPGKVLYEINGVPEQLAREAFTL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL +   F+ R V
Sbjct: 121 AAAKLPLRCTFVARQV 136


>gi|220903941|ref|YP_002479253.1| ribosomal protein L16 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
 gi|254799197|sp|B8IYH9|RL16_DESDA RecName: Full=50S ribosomal protein L16
 gi|219868240|gb|ACL48575.1| ribosomal protein L16 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
          Length = 137

 Score =  185 bits (471), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 66/135 (48%), Positives = 86/135 (63%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ K  KGR++G+A  G+ + FG+  LKA +  ++ S +IEAAR A+ R +KR
Sbjct: 1   MLAPKKVKFRKWQKGRLRGLATRGATVAFGDIGLKAVQHGQLTSQQIEAARIAMMRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI VFPD PVTAKP E R G GKG    W   VKPGR+L+EI GVS ++AR A   
Sbjct: 61  GGKVWIRVFPDRPVTAKPLETRQGSGKGAPVGWCAPVKPGRVLYEIKGVSLDLAREALTR 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL V T  + R 
Sbjct: 121 AAHKLPVKTVIVVRE 135


>gi|149195490|ref|ZP_01872568.1| 50S ribosomal protein L16 [Caminibacter mediatlanticus TB-2]
 gi|149134372|gb|EDM22870.1| 50S ribosomal protein L16 [Caminibacter mediatlanticus TB-2]
          Length = 141

 Score =  185 bits (471), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 77/137 (56%), Positives = 93/137 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY KQ KGR +G A  G+ + FG + LKA E  RI S +IEA R A+SR MKR
Sbjct: 1   MLMPKRTKYRKQQKGRNRGKAYRGNSLAFGTYGLKAIELGRINSRQIEAGRVALSRTMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD P+TAKP  VRMGKGKG+VE+WV  +KPGRI+FEI GV  + A RA  L
Sbjct: 61  TGKIWIRVFPDKPLTAKPVGVRMGKGKGSVEEWVMNIKPGRIIFEITGVDNDTAIRALTL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            AAKL   TK +    E
Sbjct: 121 AAAKLPFKTKIVTMESE 137


>gi|69215720|gb|AAZ03856.1| ribosomal protein L16 [Ranunculus macranthus]
          Length = 135

 Score =  185 bits (471), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 69/129 (53%), Positives = 95/129 (73%)

Query: 5   PKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKRAGR 64
           PK T++ KQ +GR+KG++  G+RICFG +AL+A E   I S +IEA RRA++R  +R G+
Sbjct: 4   PKRTRFRKQHRGRMKGISYRGNRICFGGYALQALEPAWITSRQIEAGRRAMTRYARRGGK 63

Query: 65  VWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRLGAA 124
           +W+ +FPD PVT +P E RMG GKG+ E WV  VKPGRIL+E+ GVSE VAR A  + A+
Sbjct: 64  IWVRIFPDKPVTVRPAETRMGSGKGSPEFWVFVVKPGRILYEMGGVSEIVAREAISIAAS 123

Query: 125 KLSVVTKFI 133
           K+ + T+FI
Sbjct: 124 KMPIRTQFI 132


>gi|296111436|ref|YP_003621818.1| 50S ribosomal protein L16 [Leuconostoc kimchii IMSNU 11154]
 gi|295832968|gb|ADG40849.1| 50S ribosomal protein L16 [Leuconostoc kimchii IMSNU 11154]
          Length = 137

 Score =  185 bits (471), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 65/137 (47%), Positives = 88/137 (64%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ +  +G ++G AKGG+ + FG++ L+A  ++ I + +IEAAR AI+R MKR
Sbjct: 1   MLVPKRVKFRRVHRGHMRGEAKGGTTVTFGDYGLQATTSSWITNRQIEAARIAITRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP    T+K   VRMG GKG  E WV  VK G+++FE+ GVSE  AR A RL
Sbjct: 61  GGKVWIKIFPHKSYTSKGVGVRMGNGKGAPEGWVEPVKRGKVMFEVAGVSEATAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
              KL V TK I R  E
Sbjct: 121 AQHKLPVRTKIIAREAE 137


>gi|219674012|ref|YP_002456496.1| ribosomal protein L16 [Trifolium subterraneum]
 gi|193788981|gb|ACF20577.1| ribosomal protein L16 [Trifolium subterraneum]
          Length = 136

 Score =  185 bits (471), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 69/133 (51%), Positives = 97/133 (72%)

Query: 1   MLRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMK 60
           M   PK T++ KQ +GR+KG A  G++ICFG +AL+A E   I S +IEA RRA+SR ++
Sbjct: 1   MNYNPKRTRFRKQHRGRMKGKAYRGNKICFGKYALQALEPAWITSRQIEAGRRAMSRNVR 60

Query: 61  RAGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFR 120
           R G++W+ +FPD PVT +PTE RMG GKG+ E WV  VKPG+IL+E+ GV E +AR+A  
Sbjct: 61  RGGKIWVRIFPDKPVTVRPTETRMGSGKGSPEYWVAVVKPGKILYEMGGVPENIARKAIS 120

Query: 121 LGAAKLSVVTKFI 133
           + A+K+ + T+FI
Sbjct: 121 IAASKMPIRTQFI 133


>gi|156573683|gb|ABU85174.1| ribosomal protein L16 [Anethum graveolens]
          Length = 136

 Score =  185 bits (471), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 66/133 (49%), Positives = 95/133 (71%)

Query: 1   MLRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMK 60
           M   PK T++ KQ +GR+KG++  G+ I FG +AL+A E   I S +IEA RRA++R  +
Sbjct: 1   MNYNPKRTRFRKQHRGRMKGISYRGNHISFGKYALQALEPAWITSRQIEAGRRAMTRNAR 60

Query: 61  RAGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFR 120
           R G++W+ +FPD PVT +P E RMG GKG+ E WV  VKPGRIL+E+ GV+E +ARRA  
Sbjct: 61  RGGKIWVRIFPDKPVTVRPAETRMGSGKGSPEYWVAVVKPGRILYEMGGVTENIARRAIS 120

Query: 121 LGAAKLSVVTKFI 133
           + ++K+ + T+FI
Sbjct: 121 IASSKMPIRTQFI 133


>gi|116495940|ref|YP_807674.1| 50S ribosomal protein L16 [Lactobacillus casei ATCC 334]
 gi|191639421|ref|YP_001988587.1| 50S ribosomal protein L16 [Lactobacillus casei BL23]
 gi|227533967|ref|ZP_03964016.1| 50S ribosomal protein L16 [Lactobacillus paracasei subsp. paracasei
           ATCC 25302]
 gi|239630344|ref|ZP_04673375.1| 50S ribosomal protein L16 [Lactobacillus paracasei subsp. paracasei
           8700:2]
 gi|301067496|ref|YP_003789519.1| 50S ribosomal protein L16 [Lactobacillus casei str. Zhang]
 gi|122262660|sp|Q034Z0|RL16_LACC3 RecName: Full=50S ribosomal protein L16
 gi|226710739|sp|B3WAL0|RL16_LACCB RecName: Full=50S ribosomal protein L16
 gi|116106090|gb|ABJ71232.1| LSU ribosomal protein L16P [Lactobacillus casei ATCC 334]
 gi|190713723|emb|CAQ67729.1| 50S ribosomal protein L16 [Lactobacillus casei BL23]
 gi|227188344|gb|EEI68411.1| 50S ribosomal protein L16 [Lactobacillus paracasei subsp. paracasei
           ATCC 25302]
 gi|239527956|gb|EEQ66957.1| 50S ribosomal protein L16 [Lactobacillus paracasei subsp. paracasei
           8700:2]
 gi|300439903|gb|ADK19669.1| Ribosomal protein L16 [Lactobacillus casei str. Zhang]
 gi|327383510|gb|AEA54986.1| 50S ribosomal protein L16 [Lactobacillus casei LC2W]
 gi|327386703|gb|AEA58177.1| 50S ribosomal protein L16 [Lactobacillus casei BD-II]
          Length = 144

 Score =  185 bits (471), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 62/135 (45%), Positives = 89/135 (65%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ ++F+G+++G AKGG  + FG + L+A E++ I + +IEAAR A++R MKR
Sbjct: 1   MLVPKRVKHRREFRGKMRGAAKGGRNVDFGEYGLEALESHWITNRQIEAARVAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP    T+K   VRMG GKG    WV  VK  +I+FE+ GVSE VA+ A RL
Sbjct: 61  GGKVWIRIFPHKSYTSKGVGVRMGNGKGAPTGWVAVVKREKIMFEVGGVSEAVAKEALRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL + TK + R 
Sbjct: 121 ASNKLPIRTKIVSRE 135


>gi|307823449|ref|ZP_07653678.1| ribosomal protein L16 [Methylobacter tundripaludum SV96]
 gi|307735434|gb|EFO06282.1| ribosomal protein L16 [Methylobacter tundripaludum SV96]
          Length = 137

 Score =  185 bits (470), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 78/136 (57%), Positives = 100/136 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQ KGR  G A  GS + FG+F LK+ E  R+ + +IE+ARR I+R +KR
Sbjct: 1   MLQPKRTKFRKQHKGRNNGTAVRGSSVSFGDFGLKSVERGRLTARQIESARRTITRHVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T KP EVRMGKGKG+VE WV +VKPG +L+EI GVSEE+AR AF L
Sbjct: 61  GGKIWIRIFPDKPITKKPLEVRMGKGKGSVEYWVAQVKPGTMLYEIQGVSEELAREAFAL 120

Query: 122 GAAKLSVVTKFIQRVV 137
           GAAKL + T F  R +
Sbjct: 121 GAAKLPLKTLFTARTI 136


>gi|115350329|ref|YP_772168.1| 50S ribosomal protein L16 [Burkholderia ambifaria AMMD]
 gi|170700701|ref|ZP_02891696.1| ribosomal protein L16 [Burkholderia ambifaria IOP40-10]
 gi|171318355|ref|ZP_02907513.1| ribosomal protein L16 [Burkholderia ambifaria MEX-5]
 gi|172059348|ref|YP_001807000.1| 50S ribosomal protein L16 [Burkholderia ambifaria MC40-6]
 gi|122324259|sp|Q0BJ39|RL16_BURCM RecName: Full=50S ribosomal protein L16
 gi|226710688|sp|B1YRD7|RL16_BURA4 RecName: Full=50S ribosomal protein L16
 gi|115280317|gb|ABI85834.1| LSU ribosomal protein L16P [Burkholderia ambifaria AMMD]
 gi|170134371|gb|EDT02704.1| ribosomal protein L16 [Burkholderia ambifaria IOP40-10]
 gi|171096433|gb|EDT41332.1| ribosomal protein L16 [Burkholderia ambifaria MEX-5]
 gi|171991865|gb|ACB62784.1| ribosomal protein L16 [Burkholderia ambifaria MC40-6]
          Length = 138

 Score =  185 bits (470), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 73/135 (54%), Positives = 98/135 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK  KY K+ KGR  G A  G+ + FG+F LKA    R+ + +IEAARRA++R +KR
Sbjct: 1   MLQPKRRKYRKEQKGRNTGKATRGNAVSFGDFGLKAIGRGRLTARQIEAARRAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI +FPD P++ KP EVRMG GKGN E +V  ++PG++L+E+DGV+EE+AR AFRL
Sbjct: 61  GGRIWIRIFPDKPISQKPAEVRMGNGKGNPEYYVAEIQPGKMLYEMDGVTEELAREAFRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            AAKL + T FI R 
Sbjct: 121 AAAKLPLKTAFIVRQ 135


>gi|325126902|ref|YP_004286139.1| ribosomal protein L16 [Fragaria vesca subsp. vesca]
 gi|324022814|gb|ADY15388.1| ribosomal protein L16 [Fragaria vesca subsp. vesca]
          Length = 136

 Score =  185 bits (470), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 68/133 (51%), Positives = 98/133 (73%), Gaps = 1/133 (0%)

Query: 2   LRQ-PKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMK 60
           +   PK T++ KQ +GR+KG++  G+RICFG +AL+A E   I S +IEA RRA++R  +
Sbjct: 1   MLSNPKRTRFRKQHRGRMKGISYRGNRICFGRYALQALEPAWITSRQIEAGRRAMTRNAR 60

Query: 61  RAGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFR 120
           R G++W+ +FPD PVT +PTE RMG GKG+ E WV  VKPGRIL+E+ GV+E +AR+A  
Sbjct: 61  RGGKIWVRIFPDKPVTVRPTETRMGSGKGSPEYWVAVVKPGRILYEMSGVAENIARKAIS 120

Query: 121 LGAAKLSVVTKFI 133
           + A+K+ + T+FI
Sbjct: 121 IAASKMPIRTQFI 133


>gi|30248425|ref|NP_840495.1| 50S ribosomal protein L16 [Nitrosomonas europaea ATCC 19718]
 gi|81584770|sp|Q82X82|RL16_NITEU RecName: Full=50S ribosomal protein L16
 gi|30138311|emb|CAD84319.1| Ribosomal protein L16 [Nitrosomonas europaea ATCC 19718]
          Length = 138

 Score =  185 bits (470), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 75/134 (55%), Positives = 98/134 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QP  TK+ KQ KGR  G+A  G+++ FG F LKA    R+ S +IEAARRA++R +KR
Sbjct: 1   MLQPARTKFRKQHKGRNTGIATRGAKVSFGEFGLKAIGRGRLTSRQIEAARRAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI VFPD PV+ KP EVRMGKGKGN E +V  ++PG++L+E+DGV E +AR AFRL
Sbjct: 61  GGRIWIRVFPDKPVSQKPAEVRMGKGKGNPEYYVAEIQPGKMLYEMDGVDESLAREAFRL 120

Query: 122 GAAKLSVVTKFIQR 135
            AAKL + T F+ R
Sbjct: 121 AAAKLPMQTTFVIR 134


>gi|222823110|ref|YP_002574683.1| 50S ribosomal protein L16 [Campylobacter lari RM2100]
 gi|254799187|sp|B9KEE7|RL16_CAMLR RecName: Full=50S ribosomal protein L16
 gi|222538331|gb|ACM63432.1| 50S ribosomal protein L16 [Campylobacter lari RM2100]
          Length = 141

 Score =  185 bits (470), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 76/137 (55%), Positives = 96/137 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY K  KGR +G A  G+   FG+FALKA EA RI S +IEAAR A++R +KR
Sbjct: 1   MLMPKRTKYRKMMKGRNRGYANRGTEFTFGDFALKATEAGRINSRQIEAARIALTRFVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+ WI VFPD P+T KP E RMGKGKG VE+WV  +KPGRI++E+ GV+EE+AR+A  L
Sbjct: 61  QGKTWIRVFPDKPLTKKPLETRMGKGKGAVEEWVMNIKPGRIIYEMAGVNEEMARQALTL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
              KL   TKF+ R  +
Sbjct: 121 AMHKLPFKTKFVTRESQ 137


>gi|11465429|ref|NP_045180.1| ribosomal protein L16 [Cyanidium caldarium]
 gi|14285740|sp|Q9TLT9|RK16_CYACA RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|6466332|gb|AAF12914.1|AF022186_36 unknown [Cyanidium caldarium]
          Length = 140

 Score =  185 bits (470), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 66/133 (49%), Positives = 88/133 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY K  +GR+KG A  GS + FG + ++A  ++ I S +IE+ RR I R +KR
Sbjct: 1   MLSPKKTKYRKFHRGRLKGHATKGSALAFGRYGIQALTSSWITSRQIESVRRVIVRHLKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD  VTAKP E RMG GKG+ E W+  VK G ILFEIDGVS E+A+ A +L
Sbjct: 61  GGKLWIRIFPDKAVTAKPLETRMGSGKGSPEHWIAVVKSGHILFEIDGVSLELAKEAVKL 120

Query: 122 GAAKLSVVTKFIQ 134
              KL +  KF+ 
Sbjct: 121 AIYKLPIKCKFLS 133


>gi|257069501|ref|YP_003155756.1| 50S ribosomal protein L16P [Brachybacterium faecium DSM 4810]
 gi|256560319|gb|ACU86166.1| LSU ribosomal protein L16P [Brachybacterium faecium DSM 4810]
          Length = 139

 Score =  185 bits (470), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 64/136 (47%), Positives = 93/136 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+ TK+ KQ      G+AKGG+ + FG++ ++A E   + + +IEAAR A++R MKR
Sbjct: 1   MLIPRRTKHRKQHHPTRSGMAKGGTDLAFGDYGIQALEPAYVTNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+V+I ++PD P+T KP EVRMG GKG+VE W+  +KPGR++FEI GV EEVAR A RL
Sbjct: 61  GGKVFINIYPDRPLTKKPAEVRMGSGKGSVEWWIANIKPGRVMFEIAGVEEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
              KL + ++ + R  
Sbjct: 121 AQHKLPMKSRILSRES 136


>gi|197287075|ref|YP_002152947.1| 50S ribosomal protein L16 [Proteus mirabilis HI4320]
 gi|227354927|ref|ZP_03839341.1| 50S ribosomal protein L16 [Proteus mirabilis ATCC 29906]
 gi|226712338|sp|B4F1J1|RL16_PROMH RecName: Full=50S ribosomal protein L16
 gi|194684562|emb|CAR46392.1| 50S ribosomal protein L16 [Proteus mirabilis HI4320]
 gi|227165009|gb|EEI49848.1| 50S ribosomal protein L16 [Proteus mirabilis ATCC 29906]
          Length = 136

 Score =  185 bits (470), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 75/136 (55%), Positives = 101/136 (74%), Gaps = 1/136 (0%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGR +G+A  G+ + FG + LKA    R+ + +IEAARRA++R +KR
Sbjct: 1   MLQPKRTKFRKVHKGRNRGLAI-GTDVSFGTYGLKAVGRGRLTARQIEAARRAMTRAVKR 59

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD P+T KP EVRMGKGKGNVE WV  ++PG++L+E+DGV EEVAR AF+L
Sbjct: 60  QGKIWIRVFPDKPITEKPLEVRMGKGKGNVEYWVALIQPGKVLYEMDGVPEEVAREAFQL 119

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + T F+ + V
Sbjct: 120 AAAKLPIKTTFVTKTV 135


>gi|330815256|ref|YP_004358961.1| 50S ribosomal protein L16 [Burkholderia gladioli BSR3]
 gi|327367649|gb|AEA59005.1| 50S ribosomal protein L16 [Burkholderia gladioli BSR3]
          Length = 138

 Score =  185 bits (470), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 73/135 (54%), Positives = 98/135 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK  KY K+ KGR  G+A  G+ + FG F LKA    R+ + +IEAARRA++R +KR
Sbjct: 1   MLQPKRRKYRKEQKGRNTGIATRGNAVSFGEFGLKAIGRGRLTARQIEAARRAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI +FPD P++ KP EVRMG GKGN E +V  ++PG++L+E+DGV+EE+AR AFRL
Sbjct: 61  GGRIWIRIFPDKPISQKPAEVRMGNGKGNPEYYVAEIQPGKMLYEMDGVTEELAREAFRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            AAKL + T FI R 
Sbjct: 121 AAAKLPLKTAFIVRQ 135


>gi|11466827|ref|NP_039423.1| ribosomal protein L16 [Oryza sativa Japonica Group]
 gi|669084|emb|CAA33933.1| ribosomal protein L16 [Oryza sativa Japonica Group]
 gi|226645|prf||1603356BV ribosomal protein L16
          Length = 136

 Score =  185 bits (470), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 67/136 (49%), Positives = 98/136 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG +  G+ ICFG +AL+A E   I + +IEA RRA++R  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGKSYRGNCICFGRYALQALEPTWITARQIEAGRRAMTRYARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +PTE RMG GKG+ E WV  VKPGRIL+E+ GVSE VARRA  +
Sbjct: 61  GGKIWVRIFPDKPVTIRPTETRMGSGKGSPEYWVAVVKPGRILYEMGGVSETVARRAISI 120

Query: 122 GAAKLSVVTKFIQRVV 137
            A+K+ + ++F++  +
Sbjct: 121 AASKMPIRSQFLRLEI 136


>gi|50122944|ref|YP_052111.1| 50S ribosomal protein L16 [Pectobacterium atrosepticum SCRI1043]
 gi|227115265|ref|ZP_03828921.1| 50S ribosomal protein L16 [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
 gi|227328942|ref|ZP_03832966.1| 50S ribosomal protein L16 [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
 gi|253690176|ref|YP_003019366.1| ribosomal protein L16 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|261823225|ref|YP_003261331.1| 50S ribosomal protein L16 [Pectobacterium wasabiae WPP163]
 gi|81643769|sp|Q6CZX7|RL16_ERWCT RecName: Full=50S ribosomal protein L16
 gi|259646056|sp|C6DG67|RL16_PECCP RecName: Full=50S ribosomal protein L16
 gi|49613470|emb|CAG76921.1| 50S ribosomal subunit protein L16 [Pectobacterium atrosepticum
           SCRI1043]
 gi|251756754|gb|ACT14830.1| ribosomal protein L16 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|261607238|gb|ACX89724.1| ribosomal protein L16 [Pectobacterium wasabiae WPP163]
          Length = 136

 Score =  185 bits (470), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 75/136 (55%), Positives = 102/136 (75%), Gaps = 1/136 (0%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGR +G+A+ G+ + FG F LKA    R+ + +IEAARRA++R +KR
Sbjct: 1   MLQPKRTKFRKVHKGRNRGLAQ-GTDVSFGTFGLKAVGRGRLTARQIEAARRAMTRAVKR 59

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD P+T KP EVRMGKGKGNVE WV  ++PG++L+E+DGV EE+AR AF+L
Sbjct: 60  QGKIWIRVFPDKPITEKPLEVRMGKGKGNVEYWVALIQPGKVLYEMDGVPEELAREAFQL 119

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + T F+ + V
Sbjct: 120 AAAKLPIKTTFVTKTV 135


>gi|291296984|ref|YP_003508382.1| 50S ribosomal protein L16 [Meiothermus ruber DSM 1279]
 gi|290471943|gb|ADD29362.1| ribosomal protein L16 [Meiothermus ruber DSM 1279]
          Length = 141

 Score =  185 bits (470), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 69/134 (51%), Positives = 93/134 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  KY K  +GR++G AKGG  + FG++ L A E + + S +IEAAR A+ R  +R
Sbjct: 1   MLMPKRMKYRKAHRGRMRGTAKGGDYVAFGDWGLVAMEPSWVTSQQIEAARVAMVRHFRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+++I +FPD P T KP EVRMGKGKGNVE +V  VKPGR++FE+ GV+EE AR A RL
Sbjct: 61  GGKIFIRIFPDKPYTKKPLEVRMGKGKGNVEGYVAVVKPGRVMFEVSGVTEEQAREALRL 120

Query: 122 GAAKLSVVTKFIQR 135
              KL + TK ++R
Sbjct: 121 AGHKLPIKTKVVRR 134


>gi|167587765|ref|ZP_02380153.1| 50S ribosomal protein L16 [Burkholderia ubonensis Bu]
 gi|254253510|ref|ZP_04946828.1| 50S ribosomal protein L16 [Burkholderia dolosa AUO158]
 gi|124896119|gb|EAY69999.1| 50S ribosomal protein L16 [Burkholderia dolosa AUO158]
          Length = 138

 Score =  185 bits (470), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 74/135 (54%), Positives = 97/135 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK  KY K+ KGR  G A  G+ + FG F LKA    R+ + +IEAARRA++R +KR
Sbjct: 1   MLQPKRRKYRKEQKGRNTGKATRGNAVSFGEFGLKAIGRGRLTARQIEAARRAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI +FPD P++ KP EVRMG GKGN E +V  ++PG++L+E+DGVSEE+AR AFRL
Sbjct: 61  GGRIWIRIFPDKPISQKPAEVRMGNGKGNPEYYVAEIQPGKMLYEMDGVSEELAREAFRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            AAKL + T FI R 
Sbjct: 121 AAAKLPLKTAFIVRQ 135


>gi|157372769|ref|YP_001480758.1| 50S ribosomal protein L16 [Serratia proteamaculans 568]
 gi|270264366|ref|ZP_06192632.1| 50S ribosomal protein L16 [Serratia odorifera 4Rx13]
 gi|166983717|sp|A8GKJ0|RL16_SERP5 RecName: Full=50S ribosomal protein L16
 gi|157324533|gb|ABV43630.1| ribosomal protein L16 [Serratia proteamaculans 568]
 gi|270041502|gb|EFA14600.1| 50S ribosomal protein L16 [Serratia odorifera 4Rx13]
          Length = 136

 Score =  185 bits (470), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 76/136 (55%), Positives = 102/136 (75%), Gaps = 1/136 (0%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGR +G+A+ G+ + FG F LKA    R+ + +IEAARRA++R +KR
Sbjct: 1   MLQPKRTKFRKMHKGRNRGLAQ-GTDVSFGTFGLKAVGRGRLTARQIEAARRAMTRAVKR 59

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD P+T KP EVRMGKGKGNVE WV  ++PG++L+E+DGV EEVAR AF+L
Sbjct: 60  QGKIWIRVFPDKPITEKPLEVRMGKGKGNVEYWVALIQPGKVLYEMDGVPEEVAREAFKL 119

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + T F+ + V
Sbjct: 120 AAAKLPIKTTFVTKTV 135


>gi|320160421|ref|YP_004173645.1| 50S ribosomal protein L16 [Anaerolinea thermophila UNI-1]
 gi|319994274|dbj|BAJ63045.1| 50S ribosomal protein L16 [Anaerolinea thermophila UNI-1]
          Length = 142

 Score =  185 bits (470), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 69/135 (51%), Positives = 92/135 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ KQ +G ++G A  G+ I FG +AL+A E   + + +IEAARRAI R M+R
Sbjct: 1   MLMPKRVKWRKQQRGNMRGKALRGAEIAFGEYALQALEPGWVSARQIEAARRAIVREMRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P T +P E RMGKGKGNVE WV  V+PGRI+FE+ G+ EEVA+ A R 
Sbjct: 61  RGKIWIRIFPDKPYTHRPPETRMGKGKGNVEYWVAVVRPGRIMFEVGGLPEEVAKEALRQ 120

Query: 122 GAAKLSVVTKFIQRV 136
            + K S+ TK I R 
Sbjct: 121 ASYKFSIKTKVIARE 135


>gi|319796210|ref|YP_004157850.1| ribosomal protein l16 [Variovorax paradoxus EPS]
 gi|315598673|gb|ADU39739.1| ribosomal protein L16 [Variovorax paradoxus EPS]
          Length = 138

 Score =  185 bits (470), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 73/135 (54%), Positives = 96/135 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QP   K+ K+ KGR  G+A  G+ + FG+F LK  +  R+ + +IEAARRAISR +KR
Sbjct: 1   MLQPARRKFRKEQKGRNTGIATTGNSVAFGDFGLKCTDRGRLTARQIEAARRAISRHVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI VFPD P++ KP EVRMG GKGN E +V  ++PG+I+FEI GV EE+AR AFRL
Sbjct: 61  GGRIWIRVFPDKPISTKPAEVRMGNGKGNPEYYVAEIQPGKIVFEIVGVPEELAREAFRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            AAKL + T F+ R 
Sbjct: 121 AAAKLPLRTTFVARQ 135


>gi|301630260|ref|XP_002944240.1| PREDICTED: 50S ribosomal protein L16-like [Xenopus (Silurana)
           tropicalis]
          Length = 138

 Score =  185 bits (470), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 72/136 (52%), Positives = 98/136 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QP   K+ K+ KGR  G+A  G+ + FG+F LK+ +  R+ + +IEAARRAISR +KR
Sbjct: 1   MLQPARRKFRKEQKGRNTGIATRGNAVSFGDFGLKSTDRGRLTARQIEAARRAISRHVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI VFPD P++ KP EVRMG GKGN E +V  ++PG++L+EI GV EE+AR AFRL
Sbjct: 61  GGRIWIRVFPDKPISTKPAEVRMGNGKGNPEYYVAEIQPGKMLYEIVGVPEELAREAFRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + T F+ R +
Sbjct: 121 AAAKLPLRTTFVARQI 136


>gi|326200317|gb|ADZ52356.1| ribosomal protein L16 [Asclepias syriaca]
          Length = 138

 Score =  185 bits (470), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 67/132 (50%), Positives = 95/132 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG++  G+RICFG +AL+A E   I S +IEA RRA++R  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGISYRGNRICFGKYALQALEPAWITSRQIEAGRRAMTRNARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +  E RMG GKG+ E WV  VKPGRIL+E+ GV E +ARRA  +
Sbjct: 61  GGKLWVRIFPDKPVTLRAAETRMGSGKGSPEYWVAVVKPGRILYEMGGVKENIARRAISI 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+FI
Sbjct: 121 AASKMPIRTQFI 132


>gi|229915525|gb|ACQ90869.1| ribosomal protein L16 [Pedinomonas minor]
          Length = 138

 Score =  185 bits (470), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 59/134 (44%), Positives = 91/134 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY +  +GR+KG A  G+ + FG F L+A EA  I + ++EA+RR ++R ++R
Sbjct: 1   MLSPKRTKYRRPHRGRLKGKASSGNTVVFGEFGLQAAEAAWITARQLEASRRVLTRYVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD  +T +P E RMG GKG+ E WV  VKPG I+FEI G+ E  AR A ++
Sbjct: 61  GGKIWIRIFPDKAITMRPAETRMGSGKGSPEYWVAVVKPGTIMFEITGIPESSAREALKI 120

Query: 122 GAAKLSVVTKFIQR 135
            ++K+ + T+F+ +
Sbjct: 121 ASSKMPMKTQFVLK 134


>gi|150251511|ref|YP_001312244.1| ribosomal protein L16 [Cycas taitungensis]
 gi|215275561|sp|A6H5L9|RK16_CYCTA RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|149941561|dbj|BAF64985.1| ribosomal protein L16 [Cycas taitungensis]
          Length = 138

 Score =  185 bits (470), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 66/134 (49%), Positives = 93/134 (69%), Gaps = 1/134 (0%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKG-GSRICFGNFALKAQEANRIGSSEIEAARRAISRGMK 60
           +  P+ TK+ KQ +GR+KGV+   G+ ICFG FAL+A E   I S +IEA RRAI+R  +
Sbjct: 1   MLSPQKTKFRKQHRGRMKGVSHRRGNHICFGRFALQALEPAWITSGQIEAGRRAITRYAR 60

Query: 61  RAGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFR 120
           R G++W+ +FPD P+T +P E RMG GKG+ E WV  ++P RIL+E+ GVSE VAR A  
Sbjct: 61  RGGKIWVRIFPDKPITMRPAETRMGSGKGSPEYWVSVIRPYRILYEMGGVSETVARAATE 120

Query: 121 LGAAKLSVVTKFIQ 134
           + A K+ + T+F+ 
Sbjct: 121 IAAYKMPIRTRFVT 134


>gi|149928557|ref|ZP_01916783.1| 50S ribosomal protein L16 [Limnobacter sp. MED105]
 gi|149822720|gb|EDM81981.1| 50S ribosomal protein L16 [Limnobacter sp. MED105]
          Length = 138

 Score =  185 bits (470), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 69/136 (50%), Positives = 97/136 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QP   KY K+ KGR  G+A  G+ + FG + LK+    R+ + +IE+ARRA+ R +KR
Sbjct: 1   MLQPSRRKYRKEHKGRNTGLATRGASVSFGVYGLKSTGRGRLTARQIESARRAMVRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD P+T KP EVRMG GKG+VE +V  ++PG++L+E+DGVSEE+AR AFRL
Sbjct: 61  GGKIWIRVFPDKPITNKPAEVRMGNGKGSVEFYVAEIQPGKVLYEMDGVSEELAREAFRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL +   F+ R +
Sbjct: 121 AAAKLPLPCVFVTRQI 136


>gi|303328087|ref|ZP_07358526.1| ribosomal protein L16 [Desulfovibrio sp. 3_1_syn3]
 gi|302861913|gb|EFL84848.1| ribosomal protein L16 [Desulfovibrio sp. 3_1_syn3]
          Length = 137

 Score =  185 bits (470), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 67/135 (49%), Positives = 85/135 (62%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ K  KGR++G+A  G+ I FG+  LKA +   + S +IEAAR A+ R +KR
Sbjct: 1   MLAPKKVKFRKWQKGRLRGLATRGASIAFGDIGLKAVQHGHLSSQQIEAARIAMMRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI VFPD PVT+KP E R G GKG    W   VKPGR+L+EI GVS E+AR A   
Sbjct: 61  GGKVWIRVFPDRPVTSKPLETRQGSGKGAPVGWCAPVKPGRVLYEIKGVSLELAREALTR 120

Query: 122 GAAKLSVVTKFIQRV 136
            A KL V T  + R 
Sbjct: 121 AAHKLPVKTVIVVRE 135


>gi|161833826|ref|YP_001598022.1| 50S ribosomal protein L16 [Candidatus Sulcia muelleri GWSS]
 gi|293977938|ref|YP_003543368.1| 50S ribosomal protein L16P [Candidatus Sulcia muelleri DMIN]
 gi|189041489|sp|A8Z675|RL16_SULMW RecName: Full=50S ribosomal protein L16
 gi|152206316|gb|ABS30626.1| 50S ribosomal subunit protein L16 [Candidatus Sulcia muelleri GWSS]
 gi|292667869|gb|ADE35504.1| LSU ribosomal protein L16P [Candidatus Sulcia muelleri DMIN]
          Length = 136

 Score =  185 bits (470), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 71/134 (52%), Positives = 93/134 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TKY K+ KGRIKG A  G+++CFG + LK+ +   I   +IE+AR A +R MKR
Sbjct: 1   MLQPKKTKYDKRHKGRIKGNATRGTKLCFGKYGLKSLDPGWITDRQIESARVAATRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT KP EVRMGKGKG  + WV  VKPGR+L E+DGV   + + A RL
Sbjct: 61  QGQLWLNIFPDKPVTKKPQEVRMGKGKGVRDHWVSVVKPGRVLIEVDGVDLLMGKEALRL 120

Query: 122 GAAKLSVVTKFIQR 135
            + KL V TKFI +
Sbjct: 121 ASQKLPVRTKFIIK 134


>gi|41410266|ref|NP_963102.1| 50S ribosomal protein L16 [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|118463172|ref|YP_883599.1| 50S ribosomal protein L16 [Mycobacterium avium 104]
 gi|81570786|sp|Q73SA7|RL16_MYCPA RecName: Full=50S ribosomal protein L16
 gi|166199684|sp|A0QL11|RL16_MYCA1 RecName: Full=50S ribosomal protein L16
 gi|41399100|gb|AAS06718.1| RplP [Mycobacterium avium subsp. paratuberculosis K-10]
 gi|118164459|gb|ABK65356.1| ribosomal protein L16 [Mycobacterium avium 104]
          Length = 138

 Score =  185 bits (470), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 59/135 (43%), Positives = 86/135 (63%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  K+ KQ   R +G+A GG+ + FG++ ++A E   + + +IE+AR AI+R +KR
Sbjct: 1   MLIPRKVKHRKQHHPRQRGIASGGTAVNFGDYGIQALEHAYVTNRQIESARIAINRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI VFPD P+T KP E RMG GKG+ E WV  VKPGR+LFE+   +E+ AR A   
Sbjct: 61  GGKVWINVFPDRPLTKKPAETRMGSGKGSPEWWVVNVKPGRVLFELSYPNEQTARAALTR 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  + + R 
Sbjct: 121 AIHKLPIKARIVTRE 135


>gi|313673460|ref|YP_004051571.1| LSU ribosomal protein l16p [Calditerrivibrio nitroreducens DSM
           19672]
 gi|312940216|gb|ADR19408.1| LSU ribosomal protein L16P [Calditerrivibrio nitroreducens DSM
           19672]
          Length = 144

 Score =  185 bits (470), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 67/135 (49%), Positives = 93/135 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P  TKY K FKGRI+G A  G+ I FG++ L++ E  ++ S +IEAAR AI+R ++R
Sbjct: 1   MLMPSRTKYRKAFKGRIRGKATKGNTIAFGDYGLQSLEKGKLTSRQIEAARIAINRYIRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G ++I +FP  P+T +P E RMGKGKG VE +V  VK G +L+EI GV+EE AR AFRL
Sbjct: 61  GGNLYIRIFPHKPITKRPAETRMGKGKGAVEYYVAPVKEGTMLYEIKGVTEEQAREAFRL 120

Query: 122 GAAKLSVVTKFIQRV 136
            + KL V  KF+++ 
Sbjct: 121 ASHKLPVKCKFVKKE 135


>gi|77165780|ref|YP_344305.1| 50S ribosomal protein L16 [Nitrosococcus oceani ATCC 19707]
 gi|85541810|sp|Q3J8S1|RL16_NITOC RecName: Full=50S ribosomal protein L16
 gi|76884094|gb|ABA58775.1| LSU ribosomal protein L16P [Nitrosococcus oceani ATCC 19707]
          Length = 137

 Score =  185 bits (470), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 75/136 (55%), Positives = 98/136 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQ KGR +G A  GS+I FG + LKA    RI + +IEAARRA++R +KR
Sbjct: 1   MLQPKRTKFRKQQKGRNRGQALRGSQIDFGEYGLKAIGRGRITARQIEAARRAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T KP EVR GKGKG VE W   ++PGR+L+E++GV E VARRAF L
Sbjct: 61  GGKIWIRIFPDKPITQKPLEVRQGKGKGGVEFWAANIQPGRVLYEMEGVPEGVARRAFEL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + T F+ R +
Sbjct: 121 AAAKLPIKTVFVTRAI 136


>gi|57505349|ref|ZP_00371278.1| ribosomal protein L16 [Campylobacter upsaliensis RM3195]
 gi|57016485|gb|EAL53270.1| ribosomal protein L16 [Campylobacter upsaliensis RM3195]
          Length = 141

 Score =  185 bits (470), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 75/137 (54%), Positives = 96/137 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY K  KGR +G A  G+   FG +ALKA EA RI S +IEAAR A++R +KR
Sbjct: 1   MLMPKRTKYRKMMKGRNRGYANRGAEFTFGEYALKATEAGRINSRQIEAARIALTRFVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+ WI VFPD P+T KP E RMGKGKG+VE+WV  +KPGRI++E+ GVSE++AR+A  L
Sbjct: 61  QGKTWIRVFPDKPLTKKPLETRMGKGKGSVEEWVMNIKPGRIIYEMAGVSEDMARQALTL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
              KL   TKF+ R  +
Sbjct: 121 AMHKLPFKTKFVTRESQ 137


>gi|306486159|gb|ADM92725.1| ribosomal protein L16 [Davidia involucrata]
          Length = 130

 Score =  184 bits (469), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 67/129 (51%), Positives = 96/129 (74%)

Query: 5   PKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKRAGR 64
           PK T++ KQ +GR+KG++  G+ ICFG +AL+A E   I S +IEA RRA++R  +R G+
Sbjct: 2   PKRTRFRKQHRGRMKGISYRGNHICFGKYALQALEPAWITSRQIEAGRRAMTRNARRGGK 61

Query: 65  VWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRLGAA 124
           +W+ +FPD PVT +PTE RMG GKG+ E WV  VKPGRIL+E+ GV+E +AR+A  + A+
Sbjct: 62  IWVRIFPDKPVTVRPTETRMGSGKGSPEYWVAVVKPGRILYEMGGVTENIARKAISIAAS 121

Query: 125 KLSVVTKFI 133
           K+ + T+FI
Sbjct: 122 KMPIRTQFI 130


>gi|156618939|ref|YP_001430074.1| ribosomal protein L16 [Cuscuta gronovii]
 gi|215275558|sp|A7M933|RK16_CUSGR RecName: Full=50S ribosomal protein L16, plastid
 gi|156555977|emb|CAM98361.1| ribosomal protein L16 [Cuscuta gronovii]
          Length = 137

 Score =  184 bits (469), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 66/137 (48%), Positives = 98/137 (71%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ +Q +GR+KG+A  G+ I FG + L+A E   I S +IEA RRA++R  +R
Sbjct: 1   MLSPKKTRFRRQHRGRMKGLASRGNHISFGKYGLQALEPAWITSRQIEAGRRAMTRNARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT +P E RMG GKG+ E WV  VKPGRIL+E+DGV++ VA+RAF +
Sbjct: 61  GGKIWVRIFPDKPVTIRPAETRMGSGKGSPEFWVSVVKPGRILYEMDGVTKNVAKRAFGI 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            A+K+ + T+FI   ++
Sbjct: 121 AASKMPIRTQFIFSEIK 137


>gi|114107084|ref|YP_740240.1| ribosomal protein L16 [Liriodendron tulipifera]
 gi|122221285|sp|Q0G9I1|RK16_LIRTU RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|113201032|gb|ABI32547.1| ribosomal protein L16 [Liriodendron tulipifera]
          Length = 133

 Score =  184 bits (469), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 69/130 (53%), Positives = 95/130 (73%)

Query: 4   QPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKRAG 63
            PK T++ KQ +GR+KG++  G+ ICFG +AL+A E   I S +IEA RRA++R  +R G
Sbjct: 1   MPKRTRFRKQHRGRMKGISYRGNHICFGRYALQALEPAWITSRQIEAGRRAMTRYARRGG 60

Query: 64  RVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRLGA 123
           ++W+ +FPD PVT +PTE RMG GKG+ E WV  VKPGRIL+E+ GVSE VAR A ++ A
Sbjct: 61  KIWVRIFPDKPVTVRPTETRMGSGKGSPEYWVSVVKPGRILYEMGGVSETVARAAIKIAA 120

Query: 124 AKLSVVTKFI 133
            K+ + T+FI
Sbjct: 121 CKMPIRTQFI 130


>gi|85060249|ref|YP_455951.1| 50S ribosomal protein L16 [Sodalis glossinidius str. 'morsitans']
 gi|115502793|sp|Q2NQM9|RL16_SODGM RecName: Full=50S ribosomal protein L16
 gi|84780769|dbj|BAE75546.1| 50S ribosomal protein L16 [Sodalis glossinidius str. 'morsitans']
          Length = 136

 Score =  184 bits (469), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 74/136 (54%), Positives = 101/136 (74%), Gaps = 1/136 (0%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGR +G+A  G+ + FG F LKA    R+ + +IEAARRA++R +KR
Sbjct: 1   MLQPKRTKFRKMHKGRNRGLA-VGTDVSFGTFGLKAVGRGRLTARQIEAARRAMTRAVKR 59

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T KP EVRMGKGKGNVE WV  ++PG++L+E+DGV EE+AR AF+L
Sbjct: 60  QGKIWIRIFPDKPITEKPLEVRMGKGKGNVEYWVALIQPGKVLYEMDGVPEELAREAFKL 119

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + T F+ + V
Sbjct: 120 AAAKLPIKTTFVTKTV 135


>gi|255038096|ref|YP_003088717.1| 50S ribosomal protein L16 [Dyadobacter fermentans DSM 18053]
 gi|254950852|gb|ACT95552.1| ribosomal protein L16 [Dyadobacter fermentans DSM 18053]
          Length = 142

 Score =  184 bits (469), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 72/136 (52%), Positives = 92/136 (67%), Gaps = 2/136 (1%)

Query: 2   LRQPKNTKYPKQFK--GRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGM 59
           + QPK TK+ KQ K  G  +G+A  G  I FG+FA+KA E   + + +IEAAR +++R M
Sbjct: 1   MLQPKRTKFRKQQKNKGSHRGLATRGHEIAFGSFAIKALEPGWLTARQIEAARISVTRAM 60

Query: 60  KRAGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAF 119
           KR G+VWI VFPD P+T KP EVRMGKGKG  E WV  VKPG I+FE  GV+ + A  A 
Sbjct: 61  KREGQVWIRVFPDKPITKKPAEVRMGKGKGAPEYWVAPVKPGTIIFEATGVALDTANEAL 120

Query: 120 RLGAAKLSVVTKFIQR 135
           RL A KL + T+F+ R
Sbjct: 121 RLAAQKLPIKTRFVVR 136


>gi|120402323|ref|YP_952152.1| 50S ribosomal protein L16 [Mycobacterium vanbaalenii PYR-1]
 gi|166199691|sp|A1T4P6|RL16_MYCVP RecName: Full=50S ribosomal protein L16
 gi|119955141|gb|ABM12146.1| LSU ribosomal protein L16P [Mycobacterium vanbaalenii PYR-1]
          Length = 138

 Score =  184 bits (469), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 56/135 (41%), Positives = 85/135 (62%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  K+ KQ   + +G+A GG+ + FG++ ++A     + + +IE+AR AI+R +KR
Sbjct: 1   MLIPRKVKHRKQHHPKQRGIASGGTSVSFGDYGIQALGHAYVTNRQIESARIAINRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T KP E RMG GKG+ E WV  VKPGR+LFE+    E++AR A   
Sbjct: 61  GGKVWINIFPDRPLTKKPAETRMGSGKGSPEWWVANVKPGRVLFELSYPDEKIAREALTR 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  + + R 
Sbjct: 121 AIHKLPIKARIVTRE 135


>gi|313123118|ref|YP_004033377.1| 50S ribosomal protein l16 [Lactobacillus delbrueckii subsp.
           bulgaricus ND02]
 gi|312279681|gb|ADQ60400.1| 50S ribosomal protein L16 [Lactobacillus delbrueckii subsp.
           bulgaricus ND02]
          Length = 147

 Score =  184 bits (469), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 67/136 (49%), Positives = 91/136 (66%)

Query: 1   MLRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMK 60
           M   PK  K+ ++F+G+++G AKGG  + FG + L+A E++ I + +IEAAR A++R MK
Sbjct: 1   MPLVPKRVKHRREFRGKMRGAAKGGKTVAFGEYGLEALESHWITNRQIEAARIAMTRYMK 60

Query: 61  RAGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFR 120
           R G+VWI +FP    TAK   VRMG GKG    WV  VK  +I+FEI GVSEE AR A R
Sbjct: 61  RGGKVWIRIFPQKSYTAKGVGVRMGSGKGAPAGWVAVVKREKIMFEIGGVSEETAREAMR 120

Query: 121 LGAAKLSVVTKFIQRV 136
           L A+KL +  KF++R 
Sbjct: 121 LAASKLPIKCKFVKRE 136


>gi|308746013|ref|YP_003934596.1| ribosomal protein L16 [Cheilanthes lindheimeri]
 gi|302375446|gb|ADL29820.1| ribosomal protein L16 [Cheilanthes lindheimeri]
          Length = 137

 Score =  184 bits (469), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 63/132 (47%), Positives = 92/132 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+ TKY KQ +GR+KG++  G+ + FG FAL+A E   I + +IEA RRAI+R  +R
Sbjct: 1   MLSPRRTKYRKQHRGRLKGISSRGNVVSFGKFALQALEPAWITARQIEAGRRAITRHARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T +P E RMG GKG+ E WV  +KPGRI++E+ GVSE+VA  A  +
Sbjct: 61  GGKLWIRIFPDKPITMRPAETRMGSGKGSPEYWVSVIKPGRIIYELGGVSEDVAEAAMLM 120

Query: 122 GAAKLSVVTKFI 133
            A K+ + T+ +
Sbjct: 121 AAHKMPIPTRLV 132


>gi|188535271|ref|YP_001909068.1| 50S ribosomal protein L16 [Erwinia tasmaniensis Et1/99]
 gi|259909992|ref|YP_002650348.1| 50S ribosomal protein L16 [Erwinia pyrifoliae Ep1/96]
 gi|291619168|ref|YP_003521910.1| RplP [Pantoea ananatis LMG 20103]
 gi|300718698|ref|YP_003743501.1| 50S ribosomal protein L16/L10E [Erwinia billingiae Eb661]
 gi|317049833|ref|YP_004117481.1| 50S ribosomal protein L16 [Pantoea sp. At-9b]
 gi|317494335|ref|ZP_07952749.1| ribosomal protein L16 [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|226710725|sp|B2VK57|RL16_ERWT9 RecName: Full=50S ribosomal protein L16
 gi|188030313|emb|CAO98202.1| 50S ribosomal protein L16 [Erwinia tasmaniensis Et1/99]
 gi|224965614|emb|CAX57146.1| 50S ribosomal protein L16/L10E [Erwinia pyrifoliae Ep1/96]
 gi|283480089|emb|CAY76005.1| 50S ribosomal protein L16 [Erwinia pyrifoliae DSM 12163]
 gi|291154198|gb|ADD78782.1| RplP [Pantoea ananatis LMG 20103]
 gi|299064534|emb|CAX61654.1| 50S ribosomal protein L16/L10E [Erwinia billingiae Eb661]
 gi|316917585|gb|EFV38930.1| ribosomal protein L16 [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316951450|gb|ADU70925.1| ribosomal protein L16 [Pantoea sp. At-9b]
 gi|327395498|dbj|BAK12920.1| 50S ribosomal protein L16 RplP [Pantoea ananatis AJ13355]
          Length = 136

 Score =  184 bits (469), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 75/136 (55%), Positives = 102/136 (75%), Gaps = 1/136 (0%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGR +G+A+ G+ + FG F LKA    R+ + +IEAARRA++R +KR
Sbjct: 1   MLQPKRTKFRKVHKGRNRGLAQ-GTDVSFGTFGLKAVGRGRLTARQIEAARRAMTRAVKR 59

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD P+T KP EVRMGKGKGNVE WV  ++PG++L+E+DGV EE+AR AF+L
Sbjct: 60  QGKIWIRVFPDKPITEKPLEVRMGKGKGNVEYWVALIQPGKVLYEMDGVPEELAREAFKL 119

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + T F+ + V
Sbjct: 120 AAAKLPIKTTFVTKTV 135


>gi|313199602|ref|YP_004021217.1| ribosomal protein L16 [Isoetes flaccida]
 gi|291575331|gb|ADE18044.1| ribosomal protein L16 [Isoetes flaccida]
          Length = 141

 Score =  184 bits (469), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 66/133 (49%), Positives = 91/133 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ KQ +GR+KG++  G+ ICFG FAL+A     I S ++EA RRAI+R  +R
Sbjct: 1   MLSPKRTKFRKQHRGRMKGISARGNLICFGRFALQALGPAWITSRQVEAGRRAITRYARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +F D P+T +P E RMG GKG+ E WV  VKPGRIL+E+ GV E +A  A ++
Sbjct: 61  GGKIWIRIFSDKPITVRPAETRMGSGKGSPEFWVSVVKPGRILYEMGGVPEAIATAALKM 120

Query: 122 GAAKLSVVTKFIQ 134
            A K+ V T+FI 
Sbjct: 121 AAYKMPVRTQFIT 133


>gi|300114729|ref|YP_003761304.1| 50S ribosomal protein L16 [Nitrosococcus watsonii C-113]
 gi|299540666|gb|ADJ28983.1| ribosomal protein L16 [Nitrosococcus watsonii C-113]
          Length = 137

 Score =  184 bits (469), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 74/136 (54%), Positives = 99/136 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ KQ KGR +G A  GS+I FG + LKA    +I + +IEAARRA++R +KR
Sbjct: 1   MLQPKRTKFRKQQKGRNRGQALRGSQIDFGEYGLKAIGRGQITARQIEAARRAMTRHVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI +FPD P+T KP EVR GKGKG+VE W   ++PGR+L+E++GV E VARRAF L
Sbjct: 61  GGKIWIRIFPDKPITQKPLEVRQGKGKGSVEFWAANIQPGRVLYEMEGVPEGVARRAFEL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + T F+ R +
Sbjct: 121 AAAKLPIKTVFVTRAI 136


>gi|310765591|gb|ADP10541.1| 50S ribosomal protein L16 [Erwinia sp. Ejp617]
          Length = 136

 Score =  184 bits (469), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 76/136 (55%), Positives = 102/136 (75%), Gaps = 1/136 (0%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGR +G+A+ G+ I FG F LKA    R+ + +IEAARRA++R +KR
Sbjct: 1   MLQPKRTKFRKVHKGRNRGLAQ-GTDISFGTFGLKAVGRGRLTARQIEAARRAMTRAVKR 59

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD P+T KP EVRMGKGKGNVE WV  ++PG++L+E+DGV EE+AR AF+L
Sbjct: 60  QGKIWIRVFPDKPITEKPLEVRMGKGKGNVEYWVALIQPGKVLYEMDGVPEELAREAFKL 119

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + T F+ + V
Sbjct: 120 AAAKLPIKTTFVTKTV 135


>gi|75247033|sp|Q8MCA4|RK16_PHAAN RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|22725682|gb|AAN04889.1| ribosomal protein L16 [Vigna angularis]
          Length = 136

 Score =  184 bits (469), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 65/133 (48%), Positives = 96/133 (72%), Gaps = 1/133 (0%)

Query: 2   LRQ-PKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMK 60
           +   P+ T++ KQ +GR+KG++  G+ ICFG +AL+A E   I S +IEA RRA+SR ++
Sbjct: 1   MLSNPQRTRFRKQHRGRMKGISYRGNHICFGRYALQALEPAWITSRQIEAGRRAMSRNVR 60

Query: 61  RAGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFR 120
           R G++W+ +FPD PVT +PTE RMG GKG  E WV  VKPG+IL+E+ GV E +AR+A  
Sbjct: 61  RGGQIWVRIFPDKPVTVRPTETRMGSGKGFPEYWVAVVKPGKILYEMGGVPENIARKAIS 120

Query: 121 LGAAKLSVVTKFI 133
           + ++K+ + T+FI
Sbjct: 121 IASSKMPIRTQFI 133


>gi|119718118|ref|YP_925083.1| 50S ribosomal protein L16 [Nocardioides sp. JS614]
 gi|166199694|sp|A1SNL1|RL16_NOCSJ RecName: Full=50S ribosomal protein L16
 gi|119538779|gb|ABL83396.1| LSU ribosomal protein L16P [Nocardioides sp. JS614]
          Length = 139

 Score =  184 bits (469), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 63/136 (46%), Positives = 91/136 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  K+ KQ     +G AKGG+R+ FG+F ++A EA+ + + +IE+AR A++R +KR
Sbjct: 1   MLMPRRVKHRKQHHPTRRGAAKGGTRLAFGDFGIQAVEAHYVTNRQIESARIAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI ++PD P+T KP E RMG GKG+ E W+  VKPGR++FE+ GV E VAR A R 
Sbjct: 61  GGKVWINIYPDRPLTKKPAETRMGSGKGSPEWWIANVKPGRVMFELSGVDETVAREAMRR 120

Query: 122 GAAKLSVVTKFIQRVV 137
              KL +  +FI R  
Sbjct: 121 AMHKLPMKCRFISREA 136


>gi|293393304|ref|ZP_06637618.1| 50S ribosomal protein L16 [Serratia odorifera DSM 4582]
 gi|291424214|gb|EFE97429.1| 50S ribosomal protein L16 [Serratia odorifera DSM 4582]
          Length = 136

 Score =  184 bits (469), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 75/136 (55%), Positives = 102/136 (75%), Gaps = 1/136 (0%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGR +G+A+ G+ + FG F LKA    R+ + +IEAARRA++R +KR
Sbjct: 1   MLQPKRTKFRKMHKGRNRGLAQ-GTDVSFGTFGLKAVGRGRLTARQIEAARRAMTRAVKR 59

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD P+T KP EVRMGKGKGNVE WV  ++PG++L+E+DGV EE+AR AF+L
Sbjct: 60  QGKIWIRVFPDKPITEKPLEVRMGKGKGNVEYWVALIQPGKVLYEMDGVPEELAREAFKL 119

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + T F+ + V
Sbjct: 120 AAAKLPIKTTFVTKTV 135


>gi|269128509|ref|YP_003301879.1| 50S ribosomal protein L16 [Thermomonospora curvata DSM 43183]
 gi|268313467|gb|ACY99841.1| ribosomal protein L16 [Thermomonospora curvata DSM 43183]
          Length = 139

 Score =  184 bits (469), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 63/136 (46%), Positives = 91/136 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  KY KQ   + KG+AKGG+++ FG+F ++A E   + + +IEAAR A++R ++R
Sbjct: 1   MLIPRKVKYRKQHHPKRKGMAKGGTKVVFGDFGIQALEGAYVTNRQIEAARIAMTRHIRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T KP E RMG GKG+ E WV  +KPGR++FEI   +EEVAR A   
Sbjct: 61  GGKVWINIFPDRPLTKKPAETRMGSGKGSPEWWVANIKPGRVMFEISYPNEEVAREALTR 120

Query: 122 GAAKLSVVTKFIQRVV 137
              KL +  K ++R V
Sbjct: 121 AIHKLPMKCKIVKREV 136


>gi|57234671|ref|YP_181225.1| 50S ribosomal protein L16 [Dehalococcoides ethenogenes 195]
 gi|85541804|sp|Q3Z974|RL16_DEHE1 RecName: Full=50S ribosomal protein L16
 gi|57225119|gb|AAW40176.1| ribosomal protein L16 [Dehalococcoides ethenogenes 195]
          Length = 149

 Score =  184 bits (469), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 67/136 (49%), Positives = 91/136 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK  K+ K  +GR  G A  G+ + FG FAL++ EA  I + +IEA RRAI+R ++R
Sbjct: 1   MLQPKRVKFRKVQRGRRDGAAHKGNTVAFGEFALQSLEAGWITARQIEATRRAITRYIRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T KP E R G GKG  E+WV  V+ GRI+FEI GV+ E A+ A RL
Sbjct: 61  GGQVWIRIFPDKPITKKPAETRQGGGKGAPEEWVAVVRRGRIMFEIGGVTPEAAKEAMRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            + K+ V T+F+ R V
Sbjct: 121 ASYKMPVKTRFVARDV 136


>gi|254483411|ref|ZP_05096640.1| ribosomal protein L16 [marine gamma proteobacterium HTCC2148]
 gi|214036285|gb|EEB76963.1| ribosomal protein L16 [marine gamma proteobacterium HTCC2148]
          Length = 137

 Score =  184 bits (469), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 76/136 (55%), Positives = 102/136 (75%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGR +G+A  GS++ FG + LKA    RI + +IEAARRA++R +KR
Sbjct: 1   MLQPKRTKFRKTHKGRNRGLAHRGSKVSFGEYGLKATGRGRITARQIEAARRAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD P+T KP EVR GKGKGNVE WV +++PG++L+E+ GVSEE+AR AF L
Sbjct: 61  GGKIWIRVFPDKPITGKPLEVRQGKGKGNVEYWVAQIQPGKVLYEVQGVSEELAREAFDL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAK+ V T F++R V
Sbjct: 121 AAAKIPVATTFVKRSV 136


>gi|17547731|ref|NP_521133.1| 50S ribosomal protein L16 [Ralstonia solanacearum GMI1000]
 gi|83748156|ref|ZP_00945183.1| LSU ribosomal protein L16P [Ralstonia solanacearum UW551]
 gi|187930357|ref|YP_001900844.1| 50S ribosomal protein L16 [Ralstonia pickettii 12J]
 gi|207721890|ref|YP_002252328.1| 50s ribosomal subunit protein l16 [Ralstonia solanacearum MolK2]
 gi|241664525|ref|YP_002982885.1| 50S ribosomal protein L16 [Ralstonia pickettii 12D]
 gi|300690167|ref|YP_003751162.1| 50S ribosomal subunit protein L16 [Ralstonia solanacearum PSI07]
 gi|300702787|ref|YP_003744388.1| 50S ribosomal protein L16 [Ralstonia solanacearum CFBP2957]
 gi|309782841|ref|ZP_07677561.1| ribosomal protein L16 [Ralstonia sp. 5_7_47FAA]
 gi|81592130|sp|Q8XV19|RL16_RALSO RecName: Full=50S ribosomal protein L16
 gi|226712341|sp|B2UEL2|RL16_RALPJ RecName: Full=50S ribosomal protein L16
 gi|17430036|emb|CAD16721.1| probable 50s ribosomal subunit protein l16 [Ralstonia solanacearum
           GMI1000]
 gi|83725124|gb|EAP72275.1| LSU ribosomal protein L16P [Ralstonia solanacearum UW551]
 gi|187727247|gb|ACD28412.1| ribosomal protein L16 [Ralstonia pickettii 12J]
 gi|206587058|emb|CAQ17642.1| 50s ribosomal subunit protein l16 [Ralstonia solanacearum MolK2]
 gi|240866552|gb|ACS64213.1| ribosomal protein L16 [Ralstonia pickettii 12D]
 gi|299065422|emb|CBJ36591.1| 50S ribosomal subunit protein L16 [Ralstonia solanacearum CMR15]
 gi|299070449|emb|CBJ41744.1| 50S ribosomal subunit protein L16 [Ralstonia solanacearum CFBP2957]
 gi|299077227|emb|CBJ49853.1| 50S ribosomal subunit protein L16 [Ralstonia solanacearum PSI07]
 gi|308918265|gb|EFP63942.1| ribosomal protein L16 [Ralstonia sp. 5_7_47FAA]
          Length = 138

 Score =  184 bits (469), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 72/136 (52%), Positives = 98/136 (72%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK  KY K+ KGR  G+A  G+ + FG F LKA    R+ + +IE+ARRA++R +KR
Sbjct: 1   MLQPKRRKYRKEQKGRNTGIATRGNAVSFGEFGLKAMGRGRLTARQIESARRAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI +FPD P++ KP EVRMG GKGN E +V  ++PG++L+E+DGV EE+AR AFRL
Sbjct: 61  GGRIWIRIFPDKPISKKPAEVRMGNGKGNPEYYVAEIQPGKMLYEMDGVGEELAREAFRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + T F+ R V
Sbjct: 121 AAAKLPIATSFVVRQV 136


>gi|34558020|ref|NP_907835.1| 50S ribosomal protein L16 [Wolinella succinogenes DSM 1740]
 gi|81653419|sp|Q7M8E1|RL16_WOLSU RecName: Full=50S ribosomal protein L16
 gi|34483738|emb|CAE10735.1| 50S RIBOSOMAL PROTEIN L16 [Wolinella succinogenes]
          Length = 141

 Score =  184 bits (469), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 70/137 (51%), Positives = 96/137 (70%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ KQ KGR +G +  G+ + FG+  +KA E  RI S +IEAAR A++R +KR
Sbjct: 1   MLMPKRTKFRKQMKGRNRGKSFRGNSLAFGDIGIKATEHGRIDSRQIEAARIAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
           AG++WI VFPD P+TAKP E RMGKGKG+V+KWV  ++PGRI++E+ G+ EE+AR A  L
Sbjct: 61  AGKIWIRVFPDKPLTAKPLETRMGKGKGSVDKWVMNIQPGRIVYEMAGIEEELAREALAL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
             +KL   TK +    E
Sbjct: 121 AQSKLPFKTKIVTSESE 137


>gi|152989979|ref|YP_001355701.1| 50S ribosomal protein L16 [Nitratiruptor sp. SB155-2]
 gi|166199693|sp|A6Q1I5|RL16_NITSB RecName: Full=50S ribosomal protein L16
 gi|151421840|dbj|BAF69344.1| 50S ribosomal protein L16 [Nitratiruptor sp. SB155-2]
          Length = 141

 Score =  184 bits (469), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 72/137 (52%), Positives = 92/137 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY KQ KGR +G A  G+ + FG   +KA E  RI S +IEAAR A++R +KR
Sbjct: 1   MLMPKKTKYRKQQKGRNRGKAYNGNSLAFGTIGIKALEHGRIDSRQIEAARVAMTRKVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD P+T KP E RMGKGKG+VEKWV  +KPGRI++E+ GV E +AR A  L
Sbjct: 61  TGKIWIRVFPDKPLTKKPLETRMGKGKGSVEKWVMNIKPGRIIYEMAGVEESLAREALDL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
              KL   TK + +  E
Sbjct: 121 ARYKLPFKTKIVTQESE 137


>gi|251787978|ref|YP_003002699.1| 50S ribosomal protein L16 [Dickeya zeae Ech1591]
 gi|271502239|ref|YP_003335265.1| 50S ribosomal protein L16 [Dickeya dadantii Ech586]
 gi|307132832|ref|YP_003884848.1| 50S ribosomal subunit protein L16 [Dickeya dadantii 3937]
 gi|247536599|gb|ACT05220.1| ribosomal protein L16 [Dickeya zeae Ech1591]
 gi|270345794|gb|ACZ78559.1| ribosomal protein L16 [Dickeya dadantii Ech586]
 gi|306530361|gb|ADN00292.1| 50S ribosomal subunit protein L16 [Dickeya dadantii 3937]
          Length = 136

 Score =  184 bits (469), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 75/136 (55%), Positives = 100/136 (73%), Gaps = 1/136 (0%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGR +G+A  G+ + FG F LKA    R+ + +IEAARRA++R +KR
Sbjct: 1   MLQPKRTKFRKVHKGRNRGLA-AGTDVSFGTFGLKAVGRGRLTARQIEAARRAMTRAVKR 59

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD P+T KP EVRMGKGKGNVE WV  ++PG++L+E+DGV EE+AR AF L
Sbjct: 60  QGKIWIRVFPDKPITEKPLEVRMGKGKGNVEYWVALIQPGKVLYEMDGVPEELAREAFEL 119

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + T F+ + V
Sbjct: 120 AAAKLPIKTTFVTKTV 135


>gi|308235489|ref|ZP_07666226.1| 50S ribosomal protein L16 [Gardnerella vaginalis ATCC 14018]
 gi|311115160|ref|YP_003986381.1| 50S ribosomal protein L16 [Gardnerella vaginalis ATCC 14019]
 gi|310946654|gb|ADP39358.1| 50S ribosomal protein L16 [Gardnerella vaginalis ATCC 14019]
          Length = 139

 Score =  184 bits (469), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 65/135 (48%), Positives = 86/135 (63%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY KQ +    G++KGG+ I FG+F ++A     I + +IEAAR A++R +KR
Sbjct: 1   MLIPKRTKYRKQHRPTRSGMSKGGTAIAFGDFGIQALAPAYITNRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI VFPD P+T  P   RMG GKG  E W+  + PGR++FEI GVSE+VAR A R 
Sbjct: 61  GGRVWITVFPDRPLTKHPLGARMGSGKGAPEFWIANIHPGRVMFEIGGVSEDVAREALRR 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  + I R 
Sbjct: 121 AIDKLPMKCRVIARE 135


>gi|189501647|ref|YP_001957364.1| 50S ribosomal protein L16 [Candidatus Amoebophilus asiaticus 5a2]
 gi|226710671|sp|B3EUL6|RL16_AMOA5 RecName: Full=50S ribosomal protein L16
 gi|189497088|gb|ACE05635.1| ribosomal protein L16 [Candidatus Amoebophilus asiaticus 5a2]
          Length = 140

 Score =  184 bits (469), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 75/133 (56%), Positives = 93/133 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TKY K  KGR+KG+A  GS + FG F +KA EA  + + +IEAAR A++R MKR
Sbjct: 1   MLQPKRTKYRKVQKGRVKGLAHRGSSLAFGTFGIKALEAIWLTARQIEAARIAMTRAMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI VFPD P+T KP EVRMGKGKG+ E W   VKPG+ILFEI+GV   +AR A RL
Sbjct: 61  QGQVWIRVFPDKPITKKPAEVRMGKGKGSPEYWAAVVKPGKILFEIEGVDINLAREATRL 120

Query: 122 GAAKLSVVTKFIQ 134
              KL +  KF+ 
Sbjct: 121 AIHKLPIKAKFVV 133


>gi|163791673|ref|ZP_02186068.1| 50S ribosomal protein L16 [Carnobacterium sp. AT7]
 gi|159873052|gb|EDP67161.1| 50S ribosomal protein L16 [Carnobacterium sp. AT7]
          Length = 144

 Score =  184 bits (469), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 68/134 (50%), Positives = 93/134 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ ++F+G+++G AKGG  + FG + L+A E+  I + +IEAAR A++R MKR
Sbjct: 1   MLVPKRVKFRREFRGKMRGEAKGGKEVTFGEWGLQAVESKWITNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP    T+K   VRMG GKG  E WV  VK G+I+FE+DGVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPHKSYTSKAIGVRMGSGKGAPEGWVAPVKRGKIMFEVDGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQR 135
            + KL V TK ++R
Sbjct: 121 ASHKLPVKTKIVKR 134


>gi|50955559|ref|YP_062847.1| 50S ribosomal protein L16 [Leifsonia xyli subsp. xyli str. CTCB07]
 gi|81612626|sp|Q6AD02|RL16_LEIXX RecName: Full=50S ribosomal protein L16
 gi|50952041|gb|AAT89742.1| 50S ribosomal protein L16 [Leifsonia xyli subsp. xyli str. CTCB07]
          Length = 139

 Score =  184 bits (469), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 59/135 (43%), Positives = 86/135 (63%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  K+ KQ      G A GG+++ FG F ++A     + + +IE+AR A++R +KR
Sbjct: 1   MLIPRRVKHRKQHHPGRSGQATGGTKVSFGEFGIQALTPAYVTNRQIESARIAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI ++PD P+T KP E RMG GKG+ E WV  VKPGR+LFE+ GVSE++AR A   
Sbjct: 61  GGKVWINIYPDRPLTKKPAETRMGSGKGSPEWWVANVKPGRVLFEVSGVSEDLAREAMSR 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  + I+R 
Sbjct: 121 AIHKLPLKARIIKRE 135


>gi|42518436|ref|NP_964366.1| 50S ribosomal protein L16 [Lactobacillus johnsonii NCC 533]
 gi|227888846|ref|ZP_04006651.1| 50S ribosomal protein L16 [Lactobacillus johnsonii ATCC 33200]
 gi|268318858|ref|YP_003292514.1| ribosomal protein L16 [Lactobacillus johnsonii FI9785]
 gi|81668272|sp|Q74L82|RL16_LACJO RecName: Full=50S ribosomal protein L16
 gi|41582721|gb|AAS08332.1| 50S ribosomal protein L16 [Lactobacillus johnsonii NCC 533]
 gi|227850683|gb|EEJ60769.1| 50S ribosomal protein L16 [Lactobacillus johnsonii ATCC 33200]
 gi|262397233|emb|CAX66247.1| ribosomal protein L16 [Lactobacillus johnsonii FI9785]
 gi|329666699|gb|AEB92647.1| 50S ribosomal protein L16 [Lactobacillus johnsonii DPC 6026]
          Length = 145

 Score =  184 bits (469), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 68/137 (49%), Positives = 94/137 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ ++F+G+++G AKGG  I FG + L+A E++ I + +IEAAR A++R MKR
Sbjct: 1   MLVPKRVKHRREFRGKMRGEAKGGKTIAFGEYGLEAVESHWITNRQIEAARIAMTRFMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP    TAK   VRMG GKG    WV  VK G+I+FEI GVSE+VAR A RL
Sbjct: 61  GGKVWIRIFPQKSYTAKGVGVRMGSGKGAPAGWVAVVKRGKIMFEIGGVSEDVAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            + KL + TKF+++  E
Sbjct: 121 ASNKLPIKTKFVKKSSE 137


>gi|329298526|ref|ZP_08255862.1| 50S ribosomal protein L16 [Plautia stali symbiont]
          Length = 136

 Score =  184 bits (469), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 75/136 (55%), Positives = 102/136 (75%), Gaps = 1/136 (0%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TK+ K  KGR +G+A+ G+ + FG F LKA    R+ + +IEAARRA++R +KR
Sbjct: 1   MLQPKRTKFRKVHKGRNRGLAQ-GTDVSFGTFGLKAIGRGRLTARQIEAARRAMTRAVKR 59

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++WI VFPD P+T KP EVRMGKGKGNVE WV  ++PG++L+E+DGV EE+AR AF+L
Sbjct: 60  QGKIWIRVFPDKPITEKPLEVRMGKGKGNVEYWVALIQPGKVLYEMDGVPEELAREAFKL 119

Query: 122 GAAKLSVVTKFIQRVV 137
            AAKL + T F+ + V
Sbjct: 120 AAAKLPIKTTFVTKTV 135


>gi|227894527|ref|ZP_04012332.1| ribosomal protein L16 [Lactobacillus ultunensis DSM 16047]
 gi|227863686|gb|EEJ71107.1| ribosomal protein L16 [Lactobacillus ultunensis DSM 16047]
          Length = 146

 Score =  184 bits (469), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 67/138 (48%), Positives = 90/138 (65%)

Query: 1   MLRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMK 60
           M   PK  K+ ++F+G+++G AKGG  I FG++ L+A E++ I + +IEAAR A++R MK
Sbjct: 1   MPLVPKRVKHRREFRGKMRGAAKGGKYIAFGDYGLEALESHWITNRQIEAARVAMTRYMK 60

Query: 61  RAGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFR 120
           R G+VWI +FP    TAK   VRMG GKG    WV  VK  +I+FEI GV E  AR A R
Sbjct: 61  RGGKVWIRIFPQKSYTAKGVGVRMGSGKGAPAGWVAVVKREKIMFEIGGVDEATAREALR 120

Query: 121 LGAAKLSVVTKFIQRVVE 138
           L + KL + TKF+ R  E
Sbjct: 121 LASTKLPIKTKFVTRSSE 138


>gi|300728436|ref|ZP_07061798.1| ribosomal protein L16 [Prevotella bryantii B14]
 gi|299774355|gb|EFI70985.1| ribosomal protein L16 [Prevotella bryantii B14]
          Length = 142

 Score =  184 bits (469), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 71/135 (52%), Positives = 92/135 (68%), Gaps = 1/135 (0%)

Query: 2   LRQPKNTKYPKQFKGR-IKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMK 60
           + QPK  KY +   GR  KG A  G+++ FG+F +K  EA  I S +IEAAR A++R M 
Sbjct: 1   MLQPKRVKYRRPQDGRGNKGNAHRGTQLAFGSFGIKTLEAKWIDSRQIEAARVALNRYMN 60

Query: 61  RAGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFR 120
           R G+VWI +FPD P+T KP +VRMGKGKG+   WV  V PGRILFE++GVS ++A+   R
Sbjct: 61  RQGQVWIRIFPDKPITRKPADVRMGKGKGDPAGWVAPVTPGRILFEVEGVSFDIAKEGLR 120

Query: 121 LGAAKLSVVTKFIQR 135
           L A KL V TKF+ R
Sbjct: 121 LAAQKLPVKTKFVVR 135


>gi|104773549|ref|YP_618529.1| 50S ribosomal protein L16 [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC 11842]
 gi|116513546|ref|YP_812452.1| 50S ribosomal protein L16 [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC BAA-365]
 gi|300812337|ref|ZP_07092772.1| ribosomal protein L16 [Lactobacillus delbrueckii subsp. bulgaricus
           PB2003/044-T3-4]
 gi|115502756|sp|Q1GBL1|RL16_LACDA RecName: Full=50S ribosomal protein L16
 gi|122275684|sp|Q04C08|RL16_LACDB RecName: Full=50S ribosomal protein L16
 gi|103422630|emb|CAI97238.1| 50S ribosomal protein L16 [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC 11842]
 gi|116092861|gb|ABJ58014.1| LSU ribosomal protein L16P [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC BAA-365]
 gi|300496642|gb|EFK31729.1| ribosomal protein L16 [Lactobacillus delbrueckii subsp. bulgaricus
           PB2003/044-T3-4]
 gi|325125182|gb|ADY84512.1| 50S ribosomal protein L16 [Lactobacillus delbrueckii subsp.
           bulgaricus 2038]
 gi|325684727|gb|EGD26881.1| 50S ribosomal protein L16 [Lactobacillus delbrueckii subsp. lactis
           DSM 20072]
          Length = 147

 Score =  184 bits (469), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 67/136 (49%), Positives = 91/136 (66%)

Query: 1   MLRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMK 60
           M   PK  K+ ++F+G+++G AKGG  + FG + L+A E++ I + +IEAAR A++R MK
Sbjct: 1   MPLVPKRVKHRREFRGKMRGAAKGGKTVAFGEYGLEALESHWITNRQIEAARVAMTRYMK 60

Query: 61  RAGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFR 120
           R G+VWI +FP    TAK   VRMG GKG    WV  VK  +I+FEI GVSEE AR A R
Sbjct: 61  RGGKVWIRIFPQKSYTAKGVGVRMGSGKGAPAGWVAVVKREKIMFEIGGVSEETAREAMR 120

Query: 121 LGAAKLSVVTKFIQRV 136
           L A+KL +  KF++R 
Sbjct: 121 LAASKLPIKCKFVKRE 136


>gi|132713|sp|P06510|RK16_SPIOG RecName: Full=50S ribosomal protein L16, chloroplastic
 gi|763083|emb|CAA27449.1| unnamed protein product [Landoltia punctata]
          Length = 135

 Score =  184 bits (469), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 69/132 (52%), Positives = 92/132 (69%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK T++ KQ +GR+KG +  G+ I FG +AL+A E   I + +IEA RRAISR  +R
Sbjct: 1   MLSPKRTRFRKQHRGRMKGKSYRGNHISFGRYALQAVEPAWITARQIEAGRRAISRYARR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD  VT +P E RMG GKG+ E WV  VKPGRIL+EI GVSE VAR A  L
Sbjct: 61  GGKIWVRLFPDKRVTLRPAETRMGSGKGSPEYWVSVVKPGRILYEIGGVSETVARTAMLL 120

Query: 122 GAAKLSVVTKFI 133
            A+K+ + T+FI
Sbjct: 121 AASKMPIRTQFI 132


>gi|319443058|ref|ZP_07992214.1| 50S ribosomal protein L16 [Corynebacterium variabile DSM 44702]
          Length = 138

 Score =  184 bits (469), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 65/135 (48%), Positives = 89/135 (65%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ +Q +    GV+KGG+R+ FG++ L+A E   I + +IEAAR AI+R +KR
Sbjct: 1   MLIPKRVKFRRQHRPHRSGVSKGGNRVTFGDYGLQALEPTYITNRQIEAARIAINRHVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T KP  VRMG GKG VEKWV  VKPGRILFE+   +EE+A  A R 
Sbjct: 61  GGKVWINIFPDRPLTQKPLGVRMGSGKGPVEKWVANVKPGRILFEMSYPNEEIALEALRR 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL    + +++ 
Sbjct: 121 AGNKLPCKVRIVKKE 135


>gi|23466137|ref|NP_696740.1| 50S ribosomal protein L16 [Bifidobacterium longum NCC2705]
 gi|189440576|ref|YP_001955657.1| 50S ribosomal protein L16 [Bifidobacterium longum DJO10A]
 gi|227546483|ref|ZP_03976532.1| 50S ribosomal protein L16 [Bifidobacterium longum subsp. infantis
           ATCC 55813]
 gi|239621017|ref|ZP_04664048.1| 50S ribosomal protein L16 [Bifidobacterium longum subsp. infantis
           CCUG 52486]
 gi|312133881|ref|YP_004001220.1| rplp [Bifidobacterium longum subsp. longum BBMN68]
 gi|317483443|ref|ZP_07942433.1| ribosomal protein L16 [Bifidobacterium sp. 12_1_47BFAA]
 gi|322689922|ref|YP_004209656.1| 50S ribosomal protein L16 [Bifidobacterium longum subsp. infantis
           157F]
 gi|322691863|ref|YP_004221433.1| 50S ribosomal protein L16 [Bifidobacterium longum subsp. longum JCM
           1217]
 gi|81753583|sp|Q8G411|RL16_BIFLO RecName: Full=50S ribosomal protein L16
 gi|226710681|sp|B3DQC1|RL16_BIFLD RecName: Full=50S ribosomal protein L16
 gi|23326873|gb|AAN25376.1| 50S ribosomal protein L16 [Bifidobacterium longum NCC2705]
 gi|189429011|gb|ACD99159.1| Ribosomal protein L16/L10E [Bifidobacterium longum DJO10A]
 gi|227213032|gb|EEI80911.1| 50S ribosomal protein L16 [Bifidobacterium longum subsp. infantis
           ATCC 55813]
 gi|239516118|gb|EEQ55985.1| 50S ribosomal protein L16 [Bifidobacterium longum subsp. infantis
           CCUG 52486]
 gi|311773175|gb|ADQ02663.1| RplP [Bifidobacterium longum subsp. longum BBMN68]
 gi|316915129|gb|EFV36561.1| ribosomal protein L16 [Bifidobacterium sp. 12_1_47BFAA]
 gi|320456719|dbj|BAJ67341.1| 50S ribosomal protein L16 [Bifidobacterium longum subsp. longum JCM
           1217]
 gi|320461258|dbj|BAJ71878.1| 50S ribosomal protein L16 [Bifidobacterium longum subsp. infantis
           157F]
          Length = 139

 Score =  184 bits (469), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 62/135 (45%), Positives = 88/135 (65%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY KQ +    G++KGG+ I FG+FA+++     + + +IEAAR A++R +KR
Sbjct: 1   MLIPKRTKYRKQHRPVRSGMSKGGNEINFGDFAIQSLAPAYVTNRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPD P+T  P   RMG GKG  E W+  V+PGR++FEI GVSE++A+ A R 
Sbjct: 61  GGRVWITIFPDRPLTKHPLGARMGSGKGAPEFWIANVRPGRVMFEIGGVSEDIAKEALRR 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  + I R 
Sbjct: 121 AIDKLPMKCRIIARE 135


>gi|15827995|ref|NP_302258.1| 50S ribosomal protein L16 [Mycobacterium leprae TN]
 gi|221230472|ref|YP_002503888.1| 50S ribosomal protein L16 [Mycobacterium leprae Br4923]
 gi|3122692|sp|O32988|RL16_MYCLE RecName: Full=50S ribosomal protein L16
 gi|254799213|sp|B8ZSB2|RL16_MYCLB RecName: Full=50S ribosomal protein L16
 gi|2344839|emb|CAB11441.1| ribosomal protein L16 [Mycobacterium leprae]
 gi|13093548|emb|CAC30810.1| 50S ribosomal protein L16 [Mycobacterium leprae]
 gi|219933579|emb|CAR71952.1| 50S ribosomal protein L16 [Mycobacterium leprae Br4923]
          Length = 138

 Score =  184 bits (469), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 58/135 (42%), Positives = 87/135 (64%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  K+ KQ   R +G+A GG+++ FG++ ++A E   + + +IE+AR AI+R +KR
Sbjct: 1   MLIPRKVKHRKQHHPRQRGIASGGTKVNFGDYGIQALEHAYVTNRQIESARIAINRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T KP E RMG GKG+ E WV  VKPGR+LFE+   +E+ AR A   
Sbjct: 61  GGKVWINIFPDRPLTKKPAETRMGSGKGSPEWWVVNVKPGRVLFELSYPNEQTARAALTR 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  + + R 
Sbjct: 121 AIHKLPIKARIVTRE 135


>gi|297571928|ref|YP_003697702.1| ribosomal protein L16 [Arcanobacterium haemolyticum DSM 20595]
 gi|296932275|gb|ADH93083.1| ribosomal protein L16 [Arcanobacterium haemolyticum DSM 20595]
          Length = 138

 Score =  184 bits (469), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 64/135 (47%), Positives = 90/135 (66%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+ TKY KQ +    G++KGG++I FG F ++A E   I + +IEAAR A++R +KR
Sbjct: 1   MLIPRRTKYRKQHRPTRSGMSKGGNQIAFGEFGIQALEPAYITNRQIEAARIAMTRHVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FPD P+T K   +RMG GKG VE WV  VKPGR++FE+ GV E++AR A   
Sbjct: 61  GGKVWINIFPDRPLTKKALGLRMGSGKGPVETWVANVKPGRVMFELAGVPEQLAREAMLR 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL + T+F+ R 
Sbjct: 121 AMHKLPMKTRFVTRE 135


>gi|24380362|ref|NP_722317.1| 50S ribosomal protein L16 [Streptococcus mutans UA159]
 gi|290581282|ref|YP_003485674.1| 50S ribosomal protein L16 [Streptococcus mutans NN2025]
 gi|81588221|sp|Q8DS20|RL16_STRMU RecName: Full=50S ribosomal protein L16
 gi|24378381|gb|AAN59623.1|AE015024_15 50S ribosomal protein L16 [Streptococcus mutans UA159]
 gi|254998181|dbj|BAH88782.1| 50S ribosomal protein L16 [Streptococcus mutans NN2025]
          Length = 137

 Score =  184 bits (469), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 68/137 (49%), Positives = 92/137 (67%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ ++F+G+++G AKGG  + FG + L+A  ++ I + +IEAAR A++R MKR
Sbjct: 1   MLVPKRVKHRREFRGKMRGEAKGGKEVAFGEYGLQATTSHWITNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP    TAK   VRMG GKG  E WV  VK G+I+FEI  V EEVAR A RL
Sbjct: 61  GGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVAPVKRGKIMFEIADVPEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            + KL V TKF++R  E
Sbjct: 121 ASHKLPVKTKFVKREAE 137


>gi|197131826|gb|ACH47431.1| ribosomal protein L16 [Pelargonium cotyledonis]
          Length = 135

 Score =  184 bits (469), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 69/133 (51%), Positives = 98/133 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ KQ +GR+KG + GGSRI FG +AL+A E   + S +IEA RRA++R ++R
Sbjct: 1   MLSPKKTKFRKQHRGRMKGRSSGGSRISFGKYALQALEPAWVTSRQIEAGRRAMTRNVRR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++W+ +FPD PVT KPT+ RMG GKG+ E WV  VKPGRIL+E+ GV+E +AR+A  +
Sbjct: 61  GGKIWVRIFPDKPVTVKPTQTRMGSGKGSPEYWVAVVKPGRILYEMGGVAENIARKAIEI 120

Query: 122 GAAKLSVVTKFIQ 134
            A+K+ + T+FI 
Sbjct: 121 AASKMPIRTQFIS 133


>gi|171741266|ref|ZP_02917073.1| hypothetical protein BIFDEN_00341 [Bifidobacterium dentium ATCC
           27678]
 gi|283455373|ref|YP_003359937.1| 50S ribosomal protein L16 [Bifidobacterium dentium Bd1]
 gi|306823561|ref|ZP_07456936.1| 50S ribosomal protein L16 [Bifidobacterium dentium ATCC 27679]
 gi|309802942|ref|ZP_07697043.1| ribosomal protein L16 [Bifidobacterium dentium JCVIHMP022]
 gi|171276880|gb|EDT44541.1| hypothetical protein BIFDEN_00341 [Bifidobacterium dentium ATCC
           27678]
 gi|283102007|gb|ADB09113.1| rplP 50S ribosomal protein L16 [Bifidobacterium dentium Bd1]
 gi|304553268|gb|EFM41180.1| 50S ribosomal protein L16 [Bifidobacterium dentium ATCC 27679]
 gi|308220409|gb|EFO76720.1| ribosomal protein L16 [Bifidobacterium dentium JCVIHMP022]
          Length = 139

 Score =  184 bits (468), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 66/135 (48%), Positives = 89/135 (65%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TKY KQ +   +G++KGG+ I FG+F ++A     + + +IEAAR A++R +KR
Sbjct: 1   MLIPKRTKYRKQHRPVRRGMSKGGNEIAFGDFGIQALAPAYVTNRQIEAARIAMTRYIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GRVWI +FPD P+T KP   RMG GKG  E W+  V+PGR++FEI GVSEEVAR A R 
Sbjct: 61  GGRVWITIFPDRPLTKKPLGTRMGSGKGTPEFWIANVRPGRVMFEIGGVSEEVAREALRR 120

Query: 122 GAAKLSVVTKFIQRV 136
              KL +  + I R 
Sbjct: 121 AIDKLPMKCRVIARE 135


>gi|15837761|ref|NP_298449.1| 50S ribosomal protein L16 [Xylella fastidiosa 9a5c]
 gi|28198360|ref|NP_778674.1| 50S ribosomal protein L16 [Xylella fastidiosa Temecula1]
 gi|71276490|ref|ZP_00652765.1| Ribosomal protein L16 [Xylella fastidiosa Dixon]
 gi|71900599|ref|ZP_00682726.1| Ribosomal protein L16 [Xylella fastidiosa Ann-1]
 gi|71902240|ref|ZP_00684247.1| Ribosomal protein L16 [Xylella fastidiosa Ann-1]
 gi|170729707|ref|YP_001775140.1| 50S ribosomal protein L16 [Xylella fastidiosa M12]
 gi|182681001|ref|YP_001829161.1| 50S ribosomal protein L16 [Xylella fastidiosa M23]
 gi|81585790|sp|Q87E75|RL16_XYLFT RecName: Full=50S ribosomal protein L16
 gi|81623762|sp|Q9PE69|RL16_XYLFA RecName: Full=50S ribosomal protein L16
 gi|226712379|sp|B2I8H6|RL16_XYLF2 RecName: Full=50S ribosomal protein L16
 gi|226712380|sp|B0U5K6|RL16_XYLFM RecName: Full=50S ribosomal protein L16
 gi|9106123|gb|AAF83969.1|AE003950_19 50S ribosomal protein L16 [Xylella fastidiosa 9a5c]
 gi|28056430|gb|AAO28323.1| 50S ribosomal protein L16 [Xylella fastidiosa Temecula1]
 gi|71162667|gb|EAO12394.1| Ribosomal protein L16 [Xylella fastidiosa Dixon]
 gi|71728014|gb|EAO30228.1| Ribosomal protein L16 [Xylella fastidiosa Ann-1]
 gi|71729656|gb|EAO31760.1| Ribosomal protein L16 [Xylella fastidiosa Ann-1]
 gi|167964500|gb|ACA11510.1| 50S ribosomal protein L16 [Xylella fastidiosa M12]
 gi|182631111|gb|ACB91887.1| ribosomal protein L16 [Xylella fastidiosa M23]
 gi|307579470|gb|ADN63439.1| 50S ribosomal protein L16 [Xylella fastidiosa subsp. fastidiosa
           GB514]
          Length = 137

 Score =  184 bits (468), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 74/136 (54%), Positives = 100/136 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK TKY K  KGR  G++   + + FG + L+A    ++ + +IEAARR+ISR +KR
Sbjct: 1   MLQPKRTKYRKMHKGRNCGLSWNANVVSFGQYGLRATAHGQLTARQIEAARRSISRYVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G++ I VFPD P+T KP EVRMG GKGNVE WV +++PGR+++EI+GVSE+VAR AFRL
Sbjct: 61  GGKLLIRVFPDKPITKKPIEVRMGSGKGNVEYWVAQIQPGRMIYEIEGVSEDVAREAFRL 120

Query: 122 GAAKLSVVTKFIQRVV 137
            A+KLSV T F+ R V
Sbjct: 121 AASKLSVTTAFVVRTV 136


>gi|145588249|ref|YP_001154846.1| 50S ribosomal protein L16 [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
 gi|171462886|ref|YP_001796999.1| ribosomal protein L16 [Polynucleobacter necessarius subsp.
           necessarius STIR1]
 gi|189041473|sp|A4SUW8|RL16_POLSQ RecName: Full=50S ribosomal protein L16
 gi|226712334|sp|B1XSQ8|RL16_POLNS RecName: Full=50S ribosomal protein L16
 gi|145046655|gb|ABP33282.1| LSU ribosomal protein L16P [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
 gi|171192424|gb|ACB43385.1| ribosomal protein L16 [Polynucleobacter necessarius subsp.
           necessarius STIR1]
          Length = 137

 Score =  184 bits (468), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 71/134 (52%), Positives = 98/134 (73%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           + QPK  KY K+ KGR  GVA  GS + FG+F LKA    R+ + +IE+ARRA++R +KR
Sbjct: 1   MLQPKRRKYRKEQKGRNTGVATRGSSVAFGDFGLKAVGRGRLTARQIESARRAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            GR+WI +FPD P++ KP EVRMG GKGN E +V  ++PG++L+E+DGV E++AR AF+L
Sbjct: 61  GGRIWIRIFPDKPISQKPAEVRMGNGKGNPEYYVAEIQPGKVLYEMDGVDEQLAREAFKL 120

Query: 122 GAAKLSVVTKFIQR 135
            AAKL + T F+ R
Sbjct: 121 AAAKLPLQTTFVIR 134


>gi|116628591|ref|YP_821210.1| 50S ribosomal protein L16 [Streptococcus thermophilus LMD-9]
 gi|122266815|sp|Q03IF8|RL16_STRTD RecName: Full=50S ribosomal protein L16
 gi|116101868|gb|ABJ67014.1| LSU ribosomal protein L16P [Streptococcus thermophilus LMD-9]
 gi|312279252|gb|ADQ63909.1| 50S ribosomal protein L16 [Streptococcus thermophilus ND03]
          Length = 137

 Score =  184 bits (468), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 68/137 (49%), Positives = 94/137 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK  K+ ++F+G+++G AKGG  + FG + L+A  ++ I + +IEAAR A++R MKR
Sbjct: 1   MLVPKRVKHRREFRGKMRGEAKGGKEVSFGEYGLQATTSHWITNRQIEAARIAMTRYMKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VWI +FP    TAK   VRMG GKG  E WV  VK G+++FEI GVSEEVAR A RL
Sbjct: 61  GGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVAPVKRGKVMFEIAGVSEEVAREALRL 120

Query: 122 GAAKLSVVTKFIQRVVE 138
            + KL V +KF++R  E
Sbjct: 121 ASHKLPVKSKFVKREAE 137


>gi|302524000|ref|ZP_07276342.1| ribosomal protein L16 [Streptomyces sp. AA4]
 gi|302432895|gb|EFL04711.1| ribosomal protein L16 [Streptomyces sp. AA4]
          Length = 138

 Score =  184 bits (468), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 57/137 (41%), Positives = 87/137 (63%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  P+  K+ KQ   +  G AKGG+++ FG + ++A E + + + +IE+AR A++R +KR
Sbjct: 1   MLIPRRVKHRKQHSPKRHGAAKGGTKVNFGEYGIQALEHSYVTNRQIESARIAMTRHIKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
            G+VW  ++PD P+T KP E RMG GKG+ E W+  VKPGR++FEI   +EE AR A R 
Sbjct: 61  GGKVWTTIYPDRPLTKKPAETRMGSGKGSPEWWIANVKPGRVMFEISFPNEETAREALRR 120

Query: 122 GAAKLSVVTKFIQRVVE 138
              KL +  + + R  E
Sbjct: 121 AIHKLPMKCRIVTREGE 137


>gi|157737010|ref|YP_001489693.1| 50S ribosomal protein L16 [Arcobacter butzleri RM4018]
 gi|315636202|ref|ZP_07891456.1| 50S ribosomal protein L16 [Arcobacter butzleri JV22]
 gi|166983710|sp|A8ESV0|RL16_ARCB4 RecName: Full=50S ribosomal protein L16
 gi|157698864|gb|ABV67024.1| 50S ribosomal protein L16 [Arcobacter butzleri RM4018]
 gi|315479563|gb|EFU70242.1| 50S ribosomal protein L16 [Arcobacter butzleri JV22]
          Length = 141

 Score =  184 bits (468), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 72/137 (52%), Positives = 94/137 (68%)

Query: 2   LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKR 61
           +  PK TK+ K  KGR +G+A  G+ + +G+F +KA E  RI S +IEA+R A++R +KR
Sbjct: 1   MLMPKRTKFRKMMKGRNRGMAHRGNSLAYGDFGIKAVEHGRIDSRQIEASRIAMTRKVKR 60

Query: 62  AGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRL 121
             +VWI VFPD P+TAKP E RMGKGKG+V+KWV  +KPGRI FE+ GV EE+AR A  L
Sbjct: 61  QAKVWIMVFPDKPLTAKPLETRMGKGKGSVDKWVMNIKPGRICFEMAGVGEELAREALAL 120

Query: 122 GAAKLSVVTKFIQRVVE 138