RPSBLAST alignment of GI: 254780254 and protein with PDBid: 2ftc

>2ftc_I Mitochondrial ribosomal protein L16, 39S ribosomal protein L13, mitochondrial; mitochondrial ribosome, large ribosomal subunit, ribosomal RNA; 12.10A {Bos taurus} PDB: 3iy9_I Length = 118
 Score =  128 bits (322), Expect = 6e-31
 Identities = 37/117 (31%), Positives = 52/117 (44%), Gaps = 3/117 (2%)

Query: 18  IKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGM--KRAGRVWICVFPDVPV 75
           I+G +   +    GNFA+ A     +     E  R  I+R M  K    +W    P  P+
Sbjct: 2   IRGPSTEATEFTEGNFAILALGGGYLHWGHFEMMRLTINRSMDPKNMFAIWRVPAPFKPI 61

Query: 76  TAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSE-EVARRAFRLGAAKLSVVTK 131
           T K    RMG GKG ++ +V  VK GR++ E+ G  E E  +      A KL    K
Sbjct: 62  TRKSVGHRMGGGKGAIDHYVTPVKAGRLVVEMGGRCEFEEVQGFLDQVAHKLPFAAK 118