HHsearch alignment for GI: 254780255 and conserved domain: CHL00048

>CHL00048 rps3 ribosomal protein S3.
Probab=100.00  E-value=0  Score=540.79  Aligned_cols=207  Identities=43%  Similarity=0.702  Sum_probs=200.3

Q ss_pred             CCCCCCCCEEEEEEECCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHH--------CCCCCEEEEECCCCCEEEEEECC
Q ss_conf             9864578526650320621567027312579999899999999987742--------26422155325885189999737
Q gi|254780255|r    1 MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQ--------AGVAKILIERTHKNCRIIVYSAR   72 (227)
Q Consensus         1 MGQKvnP~g~RLg~~k~w~S~Wfa~~k~Y~~~L~eD~~IR~fi~k~l~~--------agis~i~I~Rt~~~i~I~I~~~k   72 (227)
T Consensus         1 MGQKvnP~gfRLgi~k~w~S~Wfa~~k~Y~~~l~eD~~IR~~i~~~l~~~~~~~~~~a~Is~I~I~R~~~~i~v~I~tar   80 (218)
T CHL00048          1 MGQKINPLGFRLGITQKHHSLWFAQPKNYSEGLQEDKKIRDCIKNYVQKNIRISSGVEGIARIEIQKKIDLIQVIIYTGF   80 (218)
T ss_pred             CCCCCCCEEEEECCCCCCEEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEEEEECCEEEEEEEECC
T ss_conf             97988976043113679800778874465899999999999999998764311124465669999982577999999657


Q ss_pred             CCCCCCCCCHHHHHHHHHHHCCC---CCEEEEEEEEECCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCEE
Q ss_conf             41001356534899898764035---870578799813755337787999999987596368999999998532388559
Q gi|254780255|r   73 PGLIIGKKGTDIEKIRKKLSNMT---NSEIHLSVNEVPKPEINATLIAQSIAQQLERRVVFRRAMKRAVQSAMRFGADGV  149 (227)
Q Consensus        73 P~~iiGkkg~~i~~l~~~L~~~~---~~~v~i~v~ei~~p~~~A~~iA~~Ia~~Lekr~~fRr~~k~~i~~~~k~g~kGi  149 (227)
T Consensus        81 pg~iigk~g~~i~~L~~~L~k~~~~~~~~v~inv~evk~P~~~A~liA~~Ia~qLEkR~sfRra~k~~i~~~~k~g~kGi  160 (218)
T CHL00048         81 PKLLIENKGRGIEELQINLQKELNSVNRKLNINITKVKNPYGEPNILAEYIAGQLENRVSFRKAMKKAIELAEKADIKGI  160 (218)
T ss_pred             CCCEECCCHHHHHHHHHHHHHHHCCCCEEEEEEEEEECCCCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             51141565245999999999972877717999999953855021668999999987332299999999999997499629


Q ss_pred             EEEEECCCCCCCCCEEEEEEECCCCCCCEEEECEEEEEEEEECCCEEEEEEEEEECCC
Q ss_conf             9997036786422215787525532452000030568999953826679999732885
Q gi|254780255|r  150 KVIASGRLNGAELSRTECYLEGRVPLQTLRAHIDYGTAVAETAYGSCGIKVYVSLRDE  207 (227)
Q Consensus       150 kI~isGRl~G~e~Ar~e~~~~G~vpl~t~~a~idy~~~~a~T~~G~~GvKVwi~~~~~  207 (227)
T Consensus       161 KI~vsGRLnGaeiAR~e~~~~G~vpL~Tlra~IdY~~~~a~T~yG~~GvKVWi~~ge~  218 (218)
T CHL00048        161 KIQISGRLNGAEIARVEWIREGRVPLQTLRAKIDYCSYTARTIYGVLGIKVWIFKDEE  218 (218)
T ss_pred             EEEEEECCCCHHHHHEEEEEECCEECCEEEECCEEEEEEEECCCCEEEEEEEEECCCC
T ss_conf             9999605672323120204506235420132560788899868850899999976999