HHsearch alignment for GI: 254780255 and conserved domain: COG0092

>COG0092 RpsC Ribosomal protein S3 [Translation, ribosomal structure and biogenesis].
Probab=100.00  E-value=0  Score=482.24  Aligned_cols=201  Identities=57%  Similarity=0.921  Sum_probs=195.4

Q ss_pred             EEEECCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCEEEEEECCCCCCCCCCCHHHHHHHHHH
Q ss_conf             50320621567027312579999899999999987742264221553258851899997374100135653489989876
Q gi|254780255|r   12 LGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERTHKNCRIIVYSARPGLIIGKKGTDIEKIRKKL   91 (227)
Q Consensus        12 Lg~~k~w~S~Wfa~~k~Y~~~L~eD~~IR~fi~k~l~~agis~i~I~Rt~~~i~I~I~~~kP~~iiGkkg~~i~~l~~~L   91 (227)
T Consensus         1 ~gi~~~w~srwfa~~~~~~~~l~ed~kIre~l~k~l~~Ag~s~veIeR~~~~~~V~I~aarPg~VIGk~G~~I~~L~~~l   80 (233)
T COG0092           1 LGITKDWKSRWFANKKEYAKLLVEDLKIREFLEKELSNAGISGVEIERTPKGTRVTIHAARPGLVIGKKGSNIEKLRKEL   80 (233)
T ss_pred             CCCCCCCHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCEEEEEEECCCCCEECCCCCCHHHHHHHH
T ss_conf             97654301232015341057778899999999999875784548999669843999995798315757971099999999


Q ss_pred             HCCCCC-EEEEEEEEECCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCEEEEEEE
Q ss_conf             403587-0578799813755337787999999987596368999999998532388559999703678642221578752
Q gi|254780255|r   92 SNMTNS-EIHLSVNEVPKPEINATLIAQSIAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLE  170 (227)
Q Consensus        92 ~~~~~~-~v~i~v~ei~~p~~~A~~iA~~Ia~~Lekr~~fRr~~k~~i~~~~k~g~kGikI~isGRl~G~e~Ar~e~~~~  170 (227)
T Consensus        81 ~k~~g~~~v~I~i~EV~~peL~A~lvA~~IA~qLErrv~FRRA~k~ai~~~M~aGAkGiki~vSGRL~GaeiAR~E~y~e  160 (233)
T COG0092          81 EKLFGKENVQINIEEVKKPELDAQLVAESIAQQLERRVSFRRAMKRAIQRAMRAGAKGIKIQVSGRLGGAEIARTEKYRE  160 (233)
T ss_pred             HHHHCCCCCEEEEEECCCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCEEEEEEECCCCHHHHHHHHHHHC
T ss_conf             99849997449999767878498999999999997440899999999999997368655999932220488876778746


Q ss_pred             CCCCCCCEEEECEEEEEEEEECCCEEEEEEEEEECCCCCCCC
Q ss_conf             553245200003056899995382667999973288537721
Q gi|254780255|r  171 GRVPLQTLRAHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSD  212 (227)
Q Consensus       171 G~vpl~t~~a~idy~~~~a~T~~G~~GvKVwi~~~~~~~~~~  212 (227)
T Consensus       161 G~vplhtlrAdIDyg~a~A~ttyGiiGVKVwI~~ge~l~~~~  202 (233)
T COG0092         161 GRVPLHTLRADIDYGTAEAHTTYGVIGVKVWIYKGEVLPDKV  202 (233)
T ss_pred             CEEECCCCCCEEEEEEEEEEECCCEEEEEEEEECCCCCCCCC
T ss_conf             634745661000343688860374688999995687178755