>cd02412 30S_S3_KH K homology RNA-binding (KH) domain of the prokaryotic 30S small ribosomal subunit protein S3. S3 is part of the head region of the 30S ribosomal subunit and is believed to interact with mRNA as it threads its way from the latch into the channel. The KH motif is a beta-alpha-alpha-beta-beta unit that folds into an alpha-beta structure with a three stranded beta-sheet interupted by two contiguous helices. In general, KH binds single-stranded RNA or DNA. It is found in a wide variety of proteins including ribosomal proteins, transcription factors and post-transcriptional modifiers of mRNA.

Probab=100.00 E-value=2.5e-39 Score=247.12 Aligned_cols=108 Identities=48% Similarity=0.932 Sum_probs=106.1 Q ss_pred CCCCCCCEEEEEEECCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCEEEEEECCCCCCCCCCC Q ss_conf 86457852665032062156702731257999989999999998774226422155325885189999737410013565 Q gi|254780255|r 2 GQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERTHKNCRIIVYSARPGLIIGKKG 81 (227) Q Consensus 2 GQKvnP~g~RLg~~k~w~S~Wfa~~k~Y~~~L~eD~~IR~fi~k~l~~agis~i~I~Rt~~~i~I~I~~~kP~~iiGkkg 81 (227) T Consensus 1 GQKv~P~gfRlGi~~~w~S~Wfa~~~~y~~~l~eD~~IR~~i~~~~~~agIs~I~IeR~~~~i~V~I~tarPG~vIGk~G 80 (109) T cd02412 1 GQKVNPLGFRLGITKDWDSRWYADKKDYAELLHEDLKIRKFIKKKLKKAGISRIEIERKADRVEVTIHTARPGIIIGKKG 80 (109) T ss_pred CCCCCCCCEEECCCCCCCCEECCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCEEEEEEEECCCCEEECCCC T ss_conf 98649843320436899566758824548999999999999999997689436999985773899999469955986785 Q ss_pred HHHHHHHHHHHCCCC-CEEEEEEEEECCC Q ss_conf 348998987640358-7057879981375 Q gi|254780255|r 82 TDIEKIRKKLSNMTN-SEIHLSVNEVPKP 109 (227) Q Consensus 82 ~~i~~l~~~L~~~~~-~~v~i~v~ei~~p 109 (227) T Consensus 81 ~~Ie~L~~~L~k~~~~k~v~InI~EVk~P 109 (109) T cd02412 81 AGIEKLRKELQKLLGNKKVRINIVEVKKP 109 (109) T ss_pred CCHHHHHHHHHHHHCCCCEEEEEEEECCC T ss_conf 24899999999982898538999982598

HHsearch alignment for GI: 254780255 and conserved domain: cd02412