HHsearch alignment for GI: 254780255 and conserved domain: cd02414

>cd02414 jag_KH jag_K homology RNA-binding domain. The KH domain is found in proteins homologous to the Bacillus subtilis protein Jag, which is associated with SpoIIIJ and is necessary for the third stage of sporulation. The KH motif is a beta-alpha-alpha-beta-beta unit that folds into an alpha-beta structure with a three stranded beta-sheet interupted by two contiguous helices. In general, KH binds single-stranded RNA or DNA. It is found in a wide variety of proteins including ribosomal proteins, transcription factors and post-transcriptional modifiers of mRNA.
Probab=95.89  E-value=0.012  Score=35.20  Aligned_cols=57  Identities=23%  Similarity=0.440  Sum_probs=48.8

Q ss_pred             HHHHHHHHHHCCC-CCEEEEECCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHCCCC
Q ss_conf             9999987742264-22155325885189999737410013565348998987640358
Q gi|254780255|r   40 REYLQCHLKQAGV-AKILIERTHKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTN   96 (227)
Q Consensus        40 R~fi~k~l~~agi-s~i~I~Rt~~~i~I~I~~~kP~~iiGkkg~~i~~l~~~L~~~~~   96 (227)
T Consensus         1 k~~L~~ll~~mg~~~~v~~~~~~~~~~~~i~g~~~~~LIGk~G~tL~AlQ~L~~~~~~   58 (77)
T cd02414           1 KEFLEEVLELMGIEADVDVEEEGDTVEVNISGDDIGLLIGKRGKTLDALQYLANLVLN   58 (77)
T ss_pred             CHHHHHHHHHCCCCEEEEEEEECCEEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             9589999998599479999997998999994498774166898647999999999997