HHsearch alignment for GI: 254780255 and conserved domain: pfam00189

>pfam00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain. This family contains a central domain pfam00013, hence the amino and carboxyl terminal domains are stored separately. This is a minimal carboxyl-terminal domain. Some are much longer.
Probab=99.98  E-value=6.3e-33  Score=210.16  Aligned_cols=84  Identities=61%  Similarity=0.924  Sum_probs=81.7

Q ss_pred             HHHHHHHCCCHHHHHHHHHHHHH-HHCCCCEEEEEEECCCCCCCCCEEEEEEECCCCCCCEEEECEEEEEEEEECCCEEE
Q ss_conf             99999875963689999999985-32388559999703678642221578752553245200003056899995382667
Q gi|254780255|r  119 SIAQQLERRVVFRRAMKRAVQSA-MRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRAHIDYGTAVAETAYGSCG  197 (227)
Q Consensus       119 ~Ia~~Lekr~~fRr~~k~~i~~~-~k~g~kGikI~isGRl~G~e~Ar~e~~~~G~vpl~t~~a~idy~~~~a~T~~G~~G  197 (227)
T Consensus         1 ~ia~~Le~~~~frr~~~~~i~~i~~~~~~~GikI~isGRl~G~erAr~e~~~~G~i~l~t~~~~Idy~~~~a~Tk~G~~G   80 (85)
T pfam00189         1 RIAQQLERRISFRRAIKQAIRRIMKKAGAKGIKIQISGRLNGAERARTEKYKEGRVPLHTLRADIDYAFAEAKTKYGVIG   80 (85)
T ss_pred             CHHHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHEEEECCCCCCEEEEEEEEEEEEEEEECCCEEE
T ss_conf             95798753448999999999999987499769999757887677623521654726883523057899999992796089


Q ss_pred             EEEEE
Q ss_conf             99997
Q gi|254780255|r  198 IKVYV  202 (227)
Q Consensus       198 vKVwi  202 (227)
T Consensus        81 VKVWI   85 (85)
T pfam00189        81 VKVWI   85 (85)
T ss_pred             EEEEC
T ss_conf             99989