HHsearch alignment of GI: 254780255 and MMDB domain: 3bbn_C_1-121

>3bbn_C (C:1-121) Ribosomal protein S3; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea}
Probab=100.00  E-value=1e-38  Score=243.20  Aligned_cols=110  Identities=30%  Similarity=0.567  Sum_probs=105.1

Q ss_pred             CCCCCCCCEEEEEEECCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHH--------HCCCCCEEEEECCCCCEEEEEECC
Q ss_conf             986457852665032062156702731257999989999999998774--------226422155325885189999737
Q gi|254780255|r    1 MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLK--------QAGVAKILIERTHKNCRIIVYSAR   72 (227)
Q Consensus         1 MGQKvnP~g~RLg~~k~w~S~Wfa~~k~Y~~~L~eD~~IR~fi~k~l~--------~agis~i~I~Rt~~~i~I~I~~~k   72 (227)
                      |||||||+|||||++++|+|.|||++++|+++|+||++||+||.++|.        .||+++|+|+|+++.+.|+||+++
T Consensus         1 MGqKvnP~gfRlgi~~~~~S~W~a~~~~y~~~l~ED~~IR~~i~k~l~~~~~~~~~~agi~~I~I~R~~~~i~I~I~~ar   80 (121)
T 3bbn_C            1 MGQKINPLGFRLGTTQSHYSLWFSQPKNYAEGLQEDQKIRDCIKNYVQKNTKTSSGVEGIARIEIQKRIDLIQVIIHMGF   80 (121)
T ss_dssp             CCCCCCTTTSSTTTTSCCSBCCCCCTTSSHHHHHHHHHHHHHHHSCCSSSSCCTTTTTCEEEEEBCBSSSCBCCEEEESC
T ss_pred             CCCCCCCCCEECCCCCCCCEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCCEEEEECC
T ss_conf             97988980240144688423795781143698875799999999887888776665402002431135566523788513


Q ss_pred             CCCCCCCCCHHHHHHHHHHHCCCC---CEEEEEEEEECCCC
Q ss_conf             410013565348998987640358---70578799813755
Q gi|254780255|r   73 PGLIIGKKGTDIEKIRKKLSNMTN---SEIHLSVNEVPKPE  110 (227)
Q Consensus        73 P~~iiGkkg~~i~~l~~~L~~~~~---~~v~i~v~ei~~p~  110 (227)
                      ||++||++|+.+++|++.|++.++   .++.|+|.||++|+
T Consensus        81 pg~vIG~~G~~i~~L~~~L~k~~~~~~~~v~I~v~eV~~Py  121 (121)
T 3bbn_C           81 PKLLIENRPQGVEDLKINVQKELNCVNRKLNIAITRIAKPY  121 (121)
T ss_dssp             TTTTSCSSSCTTHHHHHHHHHHSCSSCCCCCCCEEECSCTT
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEEEECCHH
T ss_conf             32110123404899999999873214760589987522615