HHsearch results for GI: 254780255 and protein with PDBid: 1wh9_A

>1wh9_A 40S ribosomal protein S3; KH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, ribosome; NMR {Homo sapiens} SCOP: d.52.3.1
Probab=99.64  E-value=2.9e-16  Score=112.66  Aligned_cols=78  Identities=18%  Similarity=0.347  Sum_probs=72.6

Q ss_pred             HHHHHHHHHHHHHCCCCCEEEEECCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHCCCC---CEEEEEEEEECCCCCCH
Q ss_conf             999999998774226422155325885189999737410013565348998987640358---70578799813755337
Q gi|254780255|r   37 LKIREYLQCHLKQAGVAKILIERTHKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTN---SEIHLSVNEVPKPEINA  113 (227)
Q Consensus        37 ~~IR~fi~k~l~~agis~i~I~Rt~~~i~I~I~~~kP~~iiGkkg~~i~~l~~~L~~~~~---~~v~i~v~ei~~p~~~A  113 (227)
                      -+||+||.+.|.+|||++|+|+|+++.+.|+||+++||+|||++|.++++|++.|++.|+   .++.|++.+|.+-.++|
T Consensus        10 aeIre~l~k~l~~AGis~IeIeR~~~~i~I~I~tarPG~vIGrkG~~I~~L~~~L~k~~~~~~~~i~l~ae~Ia~r~l~p   89 (92)
T 1wh9_A           10 AELNEFLTRELAEDGYSGVEVRVTPTRTEIIILATRTQNVLGEKGRRIRELTAVVQKRFGFPEGSVELYAEKVATRGSGP   89 (92)
T ss_dssp             HHHHHHHHHHTTTTTEEEEEEEECSSCEEEEEEESCHHHHHCGGGHHHHHHHHHHHHHHCCCTTSEEEEEEECCCSCCCS
T ss_pred             HHHHHHHHHHHHHCCCCEEEEEECCCCEEEEEEECCCCCEECCCCHHHHHHHHHHHHHHCCCCCCEEEEEHHHHHCCCCC
T ss_conf             99999999988768736599998799179999978976242347553999999999997899982899851543257885


Q ss_pred             H
Q ss_conf             7
Q gi|254780255|r  114 T  114 (227)
Q Consensus       114 ~  114 (227)
                      .
T Consensus        90 ~   90 (92)
T 1wh9_A           90 S   90 (92)
T ss_dssp             C
T ss_pred             C
T ss_conf             4