HHsearch results for GI: 254780255 and protein with PDBid: 3i1m_C

>3i1m_C 30S ribosomal protein S3; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1vs7_C* 3e1a_O 3e1c_O 1vs5_C 3i1o_C 3i1q_C 3i1s_C 3i1z_C 3i21_C 3kc4_C 2qal_C* 1p6g_C 1p87_C 2aw7_C 2avy_C 2i2u_C 2i2p_C* 2qan_C* 2qb9_C* 2qbb_C* ...
Probab=100.00  E-value=0  Score=534.70  Aligned_cols=214  Identities=51%  Similarity=0.860  Sum_probs=207.9

Q ss_pred             CCCCCCCCEEEEEEECCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCEEEEEECCCCCCCCCC
Q ss_conf             98645785266503206215670273125799998999999999877422642215532588518999973741001356
Q gi|254780255|r    1 MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERTHKNCRIIVYSARPGLIIGKK   80 (227)
Q Consensus         1 MGQKvnP~g~RLg~~k~w~S~Wfa~~k~Y~~~L~eD~~IR~fi~k~l~~agis~i~I~Rt~~~i~I~I~~~kP~~iiGkk   80 (227)
                      |||||||+|||||++++|+|.|||++++|+++|+||++||+||.+++.++|+++++|+|+++.+.|.||+++|+.++|++
T Consensus         1 MGQKvnP~gfRlgi~k~w~S~Wfa~~k~Y~~~L~eD~~IR~fi~k~~~~agis~i~I~rt~~~~~I~I~~~~Pg~iig~k   80 (233)
T 3i1m_C            1 MGQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLTKELAKASVSRIVIERPAKSIRVTIHTARPGIVIGKK   80 (233)
T ss_dssp             -CCCCCTTTTTTTSSCCCSBCCCCCHHHHHHHHHHHHHHHHHHHHHTGGGTEEEEEBCCCSSCBCCEEEESCHHHHHCST
T ss_pred             CCCCCCCCCCCCCCCCCCCCEECCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCEEEEEEECCCCEEECCC
T ss_conf             97987980311132479741787893334799889999999999987761443010574366469999934886487265


Q ss_pred             CHHHHHHHHHHHCCCCCEEEEEEEEECCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCC
Q ss_conf             53489989876403587057879981375533778799999998759636899999999853238855999970367864
Q gi|254780255|r   81 GTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSIAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGA  160 (227)
Q Consensus        81 g~~i~~l~~~L~~~~~~~v~i~v~ei~~p~~~A~~iA~~Ia~~Lekr~~fRr~~k~~i~~~~k~g~kGikI~isGRl~G~  160 (227)
                      |.++++|+..|++.++.+++|++.++++|+++|.++|++||++||+|++||++++++++++|++||+||||+||||||||
T Consensus        81 g~~i~~l~~~l~~~~~~~~~i~V~evk~p~l~A~~iA~~Ia~~Lekr~~fRr~~~~~~~~~~~~gakGikI~isGRL~Ga  160 (233)
T 3i1m_C           81 GEDVEKLRKVVADIAGVPAQINIAEVRKPELDAKLVADSITSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGA  160 (233)
T ss_dssp             THHHHHHHHHHHHHHTSCBCCEEEECSSGGGCHHHHHHHHHHHHHHTCCHHHHHHHHHHHHHTTCCSEEEEEEESSTTSC
T ss_pred             CHHHHHHHHHHHHHHCCCEEEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCHH
T ss_conf             35689999999984287316999994480034689999999999851357789999999998769967899981454402


Q ss_pred             CCCEEEEEEECCCCCCCEEEECEEEEEEEEECCCEEEEEEEEEECCCCCCCCCCC
Q ss_conf             2221578752553245200003056899995382667999973288537721134
Q gi|254780255|r  161 ELSRTECYLEGRVPLQTLRAHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTI  215 (227)
Q Consensus       161 e~Ar~e~~~~G~vpl~t~~a~idy~~~~a~T~~G~~GvKVwi~~~~~~~~~~~~~  215 (227)
                      ||||+|||++|+|||||++|+|||++++|+|+||+||||||||.+|+++ ++...
T Consensus       161 e~Ar~e~~~~G~vpl~tl~a~Idy~~~~a~T~yGv~GVKVwI~~~~~~~-~~~~~  214 (233)
T 3i1m_C          161 EIARTEWYREGRVPLHTLRADIDYNTSEAHTTYGVIGVKVWIFKGEILG-GMAAV  214 (233)
T ss_dssp             SSCCCCBCCEECCCTTCSSSEEEEEEECCEETTEECEEEEEEEEECC--------
T ss_pred             HHHEEEEEECCCCCCCCCCCCEEEEEEEEECCCEEEEEEEEEECCCCCC-CCCCC
T ss_conf             3111323536632356755406999999984886289999997786568-74344