HHSEARCH alignment of GI: 254780255 and SCOP domain: d2qalc2

Alignment
>d2qalc2 d.53.1.1 (C:106-206) Ribosomal protein S3 C-terminal domain {Escherichia coli [TaxId: 562]}
Probab=100.00  E-value=9.3e-43  Score=264.30  Aligned_cols=101  Identities=63%  Similarity=0.954  Sum_probs=99.2

Q ss_pred             CCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCEEEEEEECCCCCCCEEEECEEEE
Q ss_conf             37553377879999999875963689999999985323885599997036786422215787525532452000030568
Q gi|254780255|r  107 PKPEINATLIAQSIAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRAHIDYGT  186 (227)
Q Consensus       107 ~~p~~~A~~iA~~Ia~~Lekr~~fRr~~k~~i~~~~k~g~kGikI~isGRl~G~e~Ar~e~~~~G~vpl~t~~a~idy~~  186 (227)
                      ++|++||+++|++||+|||+|++|||+++++++++|++||+||+|+|||||||+||||+|++++|++||||++++|||++
T Consensus         1 k~P~l~A~~vA~~IA~~LErr~~fRr~~~~~i~~~m~~ga~GikI~isGRl~gae~Ar~e~~~~G~ipl~t~~~~Idy~~   80 (101)
T d2qalc2           1 RKPELDAKLVADSITSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRADIDYNT   80 (101)
T ss_dssp             SCGGGCHHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHSSCSEEEEEECSCGGGCSSCCCCCCEEECCCTTCGGGCEEEEE
T ss_pred             CCCCCCHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCHHEEEEEEECCCCCHHHHEEEEEEEECCCCCCCCEEEEEEE
T ss_conf             99886789999999999975508999999999987453420599998146660432116888894421456002677889


Q ss_pred             EEEEECCCEEEEEEEEEECCC
Q ss_conf             999953826679999732885
Q gi|254780255|r  187 AVAETAYGSCGIKVYVSLRDE  207 (227)
Q Consensus       187 ~~a~T~~G~~GvKVwi~~~~~  207 (227)
                      ++|+|+||++|||||||++|+
T Consensus        81 ~~a~t~~Gv~GVKVwI~~~ev  101 (101)
T d2qalc2          81 SEAHTTYGVIGVKVWIFKGEI  101 (101)
T ss_dssp             CCCCBTTBCCCEEEEEECCCC
T ss_pred             EEEECCCEEEEEEEEEECCCC
T ss_conf             999958600899999987989


SCOP domain information

class: Alpha and beta proteins (a+b)
fold: Ribosomal protein S3 C-terminal domain
superfamily: Ribosomal protein S3 C-terminal domain
family: Ribosomal protein S3 C-terminal domain
domain: Ribosomal protein S3 C-terminal domain
species: Escherichia coli [TaxId: 562]