Query         gi|254780255|ref|YP_003064668.1| 30S ribosomal protein S3 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 227
No_of_seqs    132 out of 1311
Neff          6.6 
Searched_HMMs 13730
Date          Tue May 24 08:06:01 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780255.hhm -d /home/congqian_1/database/scop/scop70_1_75.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 d2qalc2 d.53.1.1 (C:106-206) R 100.0 9.3E-43       0  264.3   8.3  101  107-207     1-101 (101)
  2 d2uubc2 d.53.1.1 (C:107-207) R 100.0   3E-40 2.1E-44  249.9  12.8  101  107-207     1-101 (101)
  3 d2uubc1 d.52.3.1 (C:2-106) Rib 100.0 4.6E-39 3.4E-43  243.0   3.0  105    2-106     1-105 (105)
  4 d2qalc1 d.52.3.1 (C:1-105) Rib 100.0 6.9E-39   5E-43  242.0   3.3  105    2-106     1-105 (105)
  5 d1wh9a_ d.52.3.1 (A:) Ribosoma  99.6 1.8E-16 1.3E-20  112.5   7.2   79   36-114     9-90  (92)
  6 d1egaa2 d.52.3.1 (A:183-295) G  90.8    0.44 3.2E-05   23.6   7.7   79   38-116    15-110 (113)
  7 d1wf3a2 d.52.3.1 (A:181-298) G  88.1    0.72 5.2E-05   22.3   7.5   81   38-118    16-113 (118)
  8 d1hh2p3 d.52.3.1 (P:277-344) T  77.8     1.9 0.00014   20.0   4.8   53   40-93      4-57  (68)
  9 d2asba3 d.52.3.1 (A:263-329) T  68.5     3.3 0.00024   18.5   4.9   52   40-92      3-55  (67)
 10 d1tuaa1 d.51.1.1 (A:1-84) Hypo  62.3     3.9 0.00028   18.1   3.6   71   64-134     5-79  (84)
 11 d1zzka1 d.51.1.1 (A:11-85) HnR  57.0     3.9 0.00028   18.1   2.9   29   64-92      6-34  (75)
 12 d1dtja_ d.51.1.1 (A:) Neuro-on  53.7     3.2 0.00023   18.6   2.0   29   64-92      5-33  (74)
 13 d2axya1 d.51.1.1 (A:11-81) Pol  50.0     2.7 0.00019   19.1   1.1   29   64-92      6-34  (71)
 14 d1j4wa2 d.51.1.1 (A:104-174) F  49.9     3.7 0.00027   18.2   1.9   29   64-92      3-31  (71)
 15 d1j4wa1 d.51.1.1 (A:1-74) Far   49.1     2.8  0.0002   18.9   1.1   29   64-92      5-33  (74)
 16 d1we8a_ d.51.1.1 (A:) Tudor an  47.6     3.6 0.00026   18.3   1.5   33   60-92     13-45  (104)
 17 d1wvna1 d.51.1.1 (A:5-74) Poly  47.3     4.3 0.00031   17.8   1.9   29   64-92      4-32  (70)
 18 d1viga_ d.51.1.1 (A:) Vigilin   39.6     4.9 0.00035   17.5   1.1   30   63-92      6-35  (71)
 19 d2ctea1 d.51.1.1 (A:8-88) Vigi  38.0     4.4 0.00032   17.8   0.7   30   64-93     12-41  (81)
 20 d2ctla1 d.51.1.1 (A:8-91) Vigi  36.6     5.6 0.00041   17.2   1.1   29   64-92     12-40  (84)
 21 d1x4ma1 d.51.1.1 (A:8-88) Far   35.2     5.2 0.00038   17.4   0.7   29   64-92     10-38  (81)
 22 d1x4na1 d.51.1.1 (A:8-86) Far   33.7     7.3 0.00053   16.5   1.3   29   64-92     10-38  (79)
 23 d1e3ha4 d.52.3.1 (A:579-632) P  33.0     4.9 0.00036   17.5   0.3   32   61-92      2-33  (54)
 24 d2ctja1 d.51.1.1 (A:8-89) Vigi  31.3     6.2 0.00045   16.9   0.6   28   64-91     12-39  (82)
 25 d2je6i3 d.51.1.1 (I:153-221) E  31.0     5.9 0.00043   17.1   0.5   30   63-92      2-31  (69)
 26 d2cpqa1 d.51.1.1 (A:212-289) F  28.2     4.8 0.00035   17.6  -0.4   28   65-92     11-38  (78)
 27 d2ba0a3 d.51.1.1 (A:136-219) E  28.2     8.4 0.00061   16.2   0.8   60   64-127     3-64  (84)
 28 d2ctka1 d.51.1.1 (A:8-98) Vigi  26.9     6.3 0.00046   16.9   0.0   30   63-92     11-40  (91)
 29 d2ctfa1 d.51.1.1 (A:7-96) Vigi  25.4     9.4 0.00069   15.9   0.7   33   59-91     16-50  (90)
 30 d2ctma1 d.51.1.1 (A:8-88) Vigi  25.3     9.6  0.0007   15.8   0.7   29   64-92     12-40  (81)

No 1  
>d2qalc2 d.53.1.1 (C:106-206) Ribosomal protein S3 C-terminal domain {Escherichia coli [TaxId: 562]}
Probab=100.00  E-value=9.3e-43  Score=264.30  Aligned_cols=101  Identities=63%  Similarity=0.954  Sum_probs=99.2

Q ss_pred             CCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCEEEEEEECCCCCCCEEEECEEEE
Q ss_conf             37553377879999999875963689999999985323885599997036786422215787525532452000030568
Q gi|254780255|r  107 PKPEINATLIAQSIAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRAHIDYGT  186 (227)
Q Consensus       107 ~~p~~~A~~iA~~Ia~~Lekr~~fRr~~k~~i~~~~k~g~kGikI~isGRl~G~e~Ar~e~~~~G~vpl~t~~a~idy~~  186 (227)
                      ++|++||+++|++||+|||+|++|||+++++++++|++||+||+|+|||||||+||||+|++++|++||||++++|||++
T Consensus         1 k~P~l~A~~vA~~IA~~LErr~~fRr~~~~~i~~~m~~ga~GikI~isGRl~gae~Ar~e~~~~G~ipl~t~~~~Idy~~   80 (101)
T d2qalc2           1 RKPELDAKLVADSITSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRADIDYNT   80 (101)
T ss_dssp             SCGGGCHHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHSSCSEEEEEECSCGGGCSSCCCCCCEEECCCTTCGGGCEEEEE
T ss_pred             CCCCCCHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCHHEEEEEEECCCCCHHHHEEEEEEEECCCCCCCCEEEEEEE
T ss_conf             99886789999999999975508999999999987453420599998146660432116888894421456002677889


Q ss_pred             EEEEECCCEEEEEEEEEECCC
Q ss_conf             999953826679999732885
Q gi|254780255|r  187 AVAETAYGSCGIKVYVSLRDE  207 (227)
Q Consensus       187 ~~a~T~~G~~GvKVwi~~~~~  207 (227)
                      ++|+|+||++|||||||++|+
T Consensus        81 ~~a~t~~Gv~GVKVwI~~~ev  101 (101)
T d2qalc2          81 SEAHTTYGVIGVKVWIFKGEI  101 (101)
T ss_dssp             CCCCBTTBCCCEEEEEECCCC
T ss_pred             EEEECCCEEEEEEEEEECCCC
T ss_conf             999958600899999987989


No 2  
>d2uubc2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus [TaxId: 274]}
Probab=100.00  E-value=3e-40  Score=249.87  Aligned_cols=101  Identities=54%  Similarity=0.846  Sum_probs=99.0

Q ss_pred             CCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCEEEEEEECCCCCCCEEEECEEEE
Q ss_conf             37553377879999999875963689999999985323885599997036786422215787525532452000030568
Q gi|254780255|r  107 PKPEINATLIAQSIAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRAHIDYGT  186 (227)
Q Consensus       107 ~~p~~~A~~iA~~Ia~~Lekr~~fRr~~k~~i~~~~k~g~kGikI~isGRl~G~e~Ar~e~~~~G~vpl~t~~a~idy~~  186 (227)
                      ++|++||+++|++||+|||+|++|||+++++++++|++||+|++|+|||||+|++|||+|++.+|.+||||++++|||++
T Consensus         1 ~nP~l~A~~vA~~Ia~~Ler~~~fRra~~~~l~~~m~~ga~GikI~isGrl~g~~~ar~~~~~~G~~~~~t~~~~Idy~~   80 (101)
T d2uubc2           1 QNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGF   80 (101)
T ss_dssp             SSTTSCHHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHTTCSEEEEEEEESGGGCSSCEEEEEEEECCCTTCTTSCEEEEE
T ss_pred             CCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCEEEEEEEEEEECCCCEECCEEEEE
T ss_conf             99765799999999999974435899999999976563952799999236677643269999961303855103256899


Q ss_pred             EEEEECCCEEEEEEEEEECCC
Q ss_conf             999953826679999732885
Q gi|254780255|r  187 AVAETAYGSCGIKVYVSLRDE  207 (227)
Q Consensus       187 ~~a~T~~G~~GvKVwi~~~~~  207 (227)
                      ++|.|+||+|||||||+.+|+
T Consensus        81 ~~a~tk~GviGVKVwI~~~ev  101 (101)
T d2uubc2          81 ALARTTYGVLGVKAYIFLGEV  101 (101)
T ss_dssp             EEEECSSCEEEEEEEEECCCC
T ss_pred             EEEECCCCCEEEEEEEECCCC
T ss_conf             999908834899999987989


No 3  
>d2uubc1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus [TaxId: 274]}
Probab=100.00  E-value=4.6e-39  Score=242.95  Aligned_cols=105  Identities=43%  Similarity=0.776  Sum_probs=103.2

Q ss_pred             CCCCCCCEEEEEEECCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCEEEEEECCCCCCCCCCC
Q ss_conf             86457852665032062156702731257999989999999998774226422155325885189999737410013565
Q gi|254780255|r    2 GQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERTHKNCRIIVYSARPGLIIGKKG   81 (227)
Q Consensus         2 GQKvnP~g~RLg~~k~w~S~Wfa~~k~Y~~~L~eD~~IR~fi~k~l~~agis~i~I~Rt~~~i~I~I~~~kP~~iiGkkg   81 (227)
                      ||||||+|||||++++|+|.|||++++|+++|+||++||+||+++|.+|||++|+|+|+++.+.|+|||++||++||++|
T Consensus         1 GQKv~P~gfRlGi~k~w~S~W~a~~~~y~~~l~eD~~IR~~i~k~~~~agIs~IeIeR~~~~i~I~I~tarPG~iIGkkG   80 (105)
T d2uubc1           1 GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGG   80 (105)
T ss_dssp             CCCCCTTTTTTTTTSCCSCBCCCCTTTTTHHHHHHHHHHHHHHHSTTTTTEEEECCEESSSCEECCEEESCHHHHHCSTT
T ss_pred             CCCCCCCCEEECCCCCCCCEECCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCEEEEEEECCCCEEECCCC
T ss_conf             98749832621556898756848803459999999999999986132267354899973686899999789860874773


Q ss_pred             HHHHHHHHHHHCCCCCEEEEEEEEE
Q ss_conf             3489989876403587057879981
Q gi|254780255|r   82 TDIEKIRKKLSNMTNSEIHLSVNEV  106 (227)
Q Consensus        82 ~~i~~l~~~L~~~~~~~v~i~v~ei  106 (227)
                      +++++|++.|+++++++++++|.||
T Consensus        81 ~~i~~L~~~l~k~~~k~v~inI~EV  105 (105)
T d2uubc1          81 ERIRVLREELAKLTGKNVALNVQEV  105 (105)
T ss_dssp             SHHHHHHHHHHHHSSCCCCCCCCBC
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEEEC
T ss_conf             5499999999998699855999989


No 4  
>d2qalc1 d.52.3.1 (C:1-105) Ribosomal protein S3 N-terminal domain {Escherichia coli [TaxId: 562]}
Probab=100.00  E-value=6.9e-39  Score=241.97  Aligned_cols=105  Identities=43%  Similarity=0.807  Sum_probs=103.4

Q ss_pred             CCCCCCCEEEEEEECCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCEEEEEECCCCCCCCCCC
Q ss_conf             86457852665032062156702731257999989999999998774226422155325885189999737410013565
Q gi|254780255|r    2 GQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERTHKNCRIIVYSARPGLIIGKKG   81 (227)
Q Consensus         2 GQKvnP~g~RLg~~k~w~S~Wfa~~k~Y~~~L~eD~~IR~fi~k~l~~agis~i~I~Rt~~~i~I~I~~~kP~~iiGkkg   81 (227)
                      ||||||+|||||++++|+|.|||++++|+.+|+||++||+||++++.+|||++|+|+|+.+.+.|+|||++||++||++|
T Consensus         1 GQKv~P~GfRlGi~~~~~S~Wfa~~~~Y~~~l~eD~~IR~~i~k~~~~a~Is~IeIeR~~~~i~V~I~tarPGviIG~~G   80 (105)
T d2qalc1           1 GQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLTKELAKASVSRIVIERPAKSIRVTIHTARPGIVIGKKG   80 (105)
T ss_dssp             CCCCCHHHHTTTTTSCCSCCCCCCHHHHHHHHHHHHHHHHHHHHTTSTTCEEEEECCCCSSCBCCEEEESCHHHHHCTTS
T ss_pred             CCCCCCCCEEECCCCCCCCEECCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCEEEEEEECCCCCEECCCC
T ss_conf             99769831640445898777868951048999999999999999987566212799854785799999679761753673


Q ss_pred             HHHHHHHHHHHCCCCCEEEEEEEEE
Q ss_conf             3489989876403587057879981
Q gi|254780255|r   82 TDIEKIRKKLSNMTNSEIHLSVNEV  106 (227)
Q Consensus        82 ~~i~~l~~~L~~~~~~~v~i~v~ei  106 (227)
                      +++++|++.|+++++++++++|.||
T Consensus        81 ~~i~~L~~~l~k~~~~~v~inI~EV  105 (105)
T d2qalc1          81 EDVEKLRKVVADIAGVPAQINIAEV  105 (105)
T ss_dssp             HHHHHHHHHHHHHHTSCBCCEEECC
T ss_pred             CCHHHHHHHHHHHHCCCCEEEEEEC
T ss_conf             1099999999998699716988979


No 5  
>d1wh9a_ d.52.3.1 (A:) Ribosomal protein S3 N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
Probab=99.64  E-value=1.8e-16  Score=112.47  Aligned_cols=79  Identities=18%  Similarity=0.345  Sum_probs=74.2

Q ss_pred             HHHHHHHHHHHHHHCCCCCEEEEECCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHCCCC---CEEEEEEEEECCCCCC
Q ss_conf             9999999998774226422155325885189999737410013565348998987640358---7057879981375533
Q gi|254780255|r   36 DLKIREYLQCHLKQAGVAKILIERTHKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTN---SEIHLSVNEVPKPEIN  112 (227)
Q Consensus        36 D~~IR~fi~k~l~~agis~i~I~Rt~~~i~I~I~~~kP~~iiGkkg~~i~~l~~~L~~~~~---~~v~i~v~ei~~p~~~  112 (227)
                      +-+||+||.+.|.+|||++|+|+|+++.+.|+||+++||++||++|.++++|+..|++.++   .+++|++.+|.+-.|+
T Consensus         9 ~a~Ire~l~k~l~~Agis~ieI~Rt~~~i~I~I~tarPGivIGrkG~~I~~L~~~l~k~~~~~~~~i~lnae~Ia~r~l~   88 (92)
T d1wh9a_           9 KAELNEFLTRELAEDGYSGVEVRVTPTRTEIIILATRTQNVLGEKGRRIRELTAVVQKRFGFPEGSVELYAEKVATRGSG   88 (92)
T ss_dssp             HHHHHHHHHHHTTTTTEEEEEEEECSSCEEEEEEESCHHHHHCGGGHHHHHHHHHHHHHHCCCTTSEEEEEEECCCSCCC
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEEECCCEEEEEEEECCCCEEECCCCHHHHHHHHHHHHHHCCCCCCEEEEEEEECCCCCC
T ss_conf             99999999998876873559999879908999996898605222754399999999999789997289998700026888


Q ss_pred             HH
Q ss_conf             77
Q gi|254780255|r  113 AT  114 (227)
Q Consensus       113 A~  114 (227)
                      |.
T Consensus        89 ~~   90 (92)
T d1wh9a_          89 PS   90 (92)
T ss_dssp             SC
T ss_pred             CC
T ss_conf             55


No 6  
>d1egaa2 d.52.3.1 (A:183-295) GTPase Era C-terminal domain {Escherichia coli [TaxId: 562]}
Probab=90.83  E-value=0.44  Score=23.57  Aligned_cols=79  Identities=25%  Similarity=0.356  Sum_probs=50.4

Q ss_pred             HHHHHHHHHHHHC-C-CCCEEEEE---CCC-C--CEEEEEECCC---CCCCCCCCHHHHHHH----HHHHCCCCCEEEEE
Q ss_conf             9999999877422-6-42215532---588-5--1899997374---100135653489989----87640358705787
Q gi|254780255|r   38 KIREYLQCHLKQA-G-VAKILIER---THK-N--CRIIVYSARP---GLIIGKKGTDIEKIR----KKLSNMTNSEIHLS  102 (227)
Q Consensus        38 ~IR~fi~k~l~~a-g-is~i~I~R---t~~-~--i~I~I~~~kP---~~iiGkkg~~i~~l~----~~L~~~~~~~v~i~  102 (227)
                      .||+-+..++.+. - -..++|+.   ..+ .  +...|++.++   +++||++|+.|+++.    ..|+++|+.++.+.
T Consensus        15 iIRE~il~~l~~EiPY~~~v~i~~~~~~~~~~~~I~a~I~V~~~sqk~IiIGk~G~~ik~I~~~ar~~le~~~~~kV~L~   94 (113)
T d1egaa2          15 IIREKLMRFLGAELPYSVTVEIERFVSNERGGYDINGLILVEREGQKKMVIGNKGAKIKTIGIEARKDMQEMFEAPVHLE   94 (113)
T ss_dssp             HHHHHHHHHHGGGCCTTEEEEEEEEECCSSCSEEEEEEEEESSHHHHHHHHCGGGHHHHHHHHHHHHHHHHHTTSCEEEE
T ss_pred             HHHHHHHHHCCCCCCEEEEEEEEEEEECCCCEEEEEEEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCEEEE
T ss_conf             99999998552003717999988876146626789999997770145663403524899999999999999969986999


Q ss_pred             --EEEECCCCCCHHHH
Q ss_conf             --99813755337787
Q gi|254780255|r  103 --VNEVPKPEINATLI  116 (227)
Q Consensus       103 --v~ei~~p~~~A~~i  116 (227)
                        |.--+++..++.++
T Consensus        95 L~VKV~~~W~~~~~~l  110 (113)
T d1egaa2          95 LWVKVKSGWADDERAL  110 (113)
T ss_dssp             EEEEETTCCCHHHHHH
T ss_pred             EEEEECCCCCCCHHHH
T ss_conf             9999889966688988


No 7  
>d1wf3a2 d.52.3.1 (A:181-298) GTPase Era C-terminal domain {Thermus thermophilus [TaxId: 274]}
Probab=88.06  E-value=0.72  Score=22.34  Aligned_cols=81  Identities=21%  Similarity=0.352  Sum_probs=51.1

Q ss_pred             HHHHHHHHHHHH-----CCCCCEEEEECCCC---CEEEEEECCC---CCCCCCCCHHHHHHH----HHHHCCCCCEEEE-
Q ss_conf             999999987742-----26422155325885---1899997374---100135653489989----8764035870578-
Q gi|254780255|r   38 KIREYLQCHLKQ-----AGVAKILIERTHKN---CRIIVYSARP---GLIIGKKGTDIEKIR----KKLSNMTNSEIHL-  101 (227)
Q Consensus        38 ~IR~fi~k~l~~-----agis~i~I~Rt~~~---i~I~I~~~kP---~~iiGkkg~~i~~l~----~~L~~~~~~~v~i-  101 (227)
                      .||+-+..++.+     ..+.-.+.+...++   +...|++.++   +++||++|+.|+++.    +.|+++|+.++.+ 
T Consensus        16 iIREkil~~l~~EiPY~~~v~ie~~~e~~~~~l~I~~~I~V~~~sqK~IiIGk~G~~ik~Ig~~aR~~le~~~~~kV~L~   95 (118)
T d1wf3a2          16 ILREEAMKRLWHEVPYAVATKVEEVAERENGVLYIKAILYVERPSQKAIVIGEGGRKIKEIGQATRKQLEALLGKKVYLD   95 (118)
T ss_dssp             HHHHHHHHTCCTTHHHHCEEEEEEEEEETTTEEEEEEEEEESSHHHHHHHHCGGGHHHHHHHHHHHHHHHHHHTSEEEEE
T ss_pred             HHHHHHHHHCCCCCCCEEEEEEEEEEECCCCEEEEEEEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCEEEE
T ss_conf             99999998645226954799988865248850899999994760235450234750499999999999999969983899


Q ss_pred             -EEEEECCCCCCHHHHHH
Q ss_conf             -79981375533778799
Q gi|254780255|r  102 -SVNEVPKPEINATLIAQ  118 (227)
Q Consensus       102 -~v~ei~~p~~~A~~iA~  118 (227)
                       .|.--+++--++.++.+
T Consensus        96 L~VKV~k~W~~~~~~l~~  113 (118)
T d1wf3a2          96 LEVKVYPDWRKDPEALRE  113 (118)
T ss_dssp             EEEEECTTGGGCHHHHHH
T ss_pred             EEEEECCCCCCCHHHHHH
T ss_conf             999988896668899997


No 8  
>d1hh2p3 d.52.3.1 (P:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima [TaxId: 2336]}
Probab=77.83  E-value=1.9  Score=19.96  Aligned_cols=53  Identities=26%  Similarity=0.400  Sum_probs=37.1

Q ss_pred             HHHHHHHHHHCCCCCEEEE-ECCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHC
Q ss_conf             9999987742264221553-25885189999737410013565348998987640
Q gi|254780255|r   40 REYLQCHLKQAGVAKILIE-RTHKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSN   93 (227)
Q Consensus        40 R~fi~k~l~~agis~i~I~-Rt~~~i~I~I~~~kP~~iiGkkg~~i~~l~~~L~~   93 (227)
                      .+|+.+-|..+.+..++|. ...+...+.+--..-...|||+|.+++- ...|..
T Consensus         4 ~~fI~nAL~PA~v~~V~i~de~~~~~~v~V~~~qls~AIGk~G~NvrL-as~Ltg   57 (68)
T d1hh2p3           4 KQLIANALAPATVIEVEILDKENKAARVLVPPTQLSLAIGKGGQNARL-AAKLTG   57 (68)
T ss_dssp             HHHHHHHTCSSCCSEEEEEETTTTEEEEEECTTSHHHHHCGGGHHHHH-HHHHHS
T ss_pred             HHHHHHHCCCCEEEEEEEECCCCCEEEEEECCCCCCCCCCCCCCHHHH-HHHHHC
T ss_conf             999998289773359999728888899998831224320678661999-999879


No 9  
>d2asba3 d.52.3.1 (A:263-329) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]}
Probab=68.52  E-value=3.3  Score=18.52  Aligned_cols=52  Identities=23%  Similarity=0.457  Sum_probs=35.8

Q ss_pred             HHHHHHHHHHCCCCCEEE-EECCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             999998774226422155-32588518999973741001356534899898764
Q gi|254780255|r   40 REYLQCHLKQAGVAKILI-ERTHKNCRIIVYSARPGLIIGKKGTDIEKIRKKLS   92 (227)
Q Consensus        40 R~fi~k~l~~agis~i~I-~Rt~~~i~I~I~~~kP~~iiGkkg~~i~~l~~~L~   92 (227)
                      .+|+.+-+..+.+..+.| ....+...+.+--..-...||++|.+++ |...|.
T Consensus         3 ~~fi~nAL~Pa~v~~V~i~de~~~~~~v~V~~~qls~AIGk~G~Nvr-Las~Lt   55 (67)
T d2asba3           3 ARFVANALSPAKVVSVSVIDQTARAARVVVPDFQLSLAIGKEGQNAR-LAARLT   55 (67)
T ss_dssp             HHHHHHHTTTSCCSEEEEEETTTTEEEEEECGGGHHHHHCGGGHHHH-HHHHHH
T ss_pred             HHHHHHHCCCCEEEEEEEECCCCCEEEEEECCCCCCCHHCCCCEEHH-HHHHHH
T ss_conf             89999818977345999964888579999895420111067865399-999977


No 10 
>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]}
Probab=62.25  E-value=3.9  Score=18.11  Aligned_cols=71  Identities=14%  Similarity=0.159  Sum_probs=44.8

Q ss_pred             CEEEEEECCCCCCCCCCCHHHHHHHHHHHCCCC---CEEEEEEEEEC-CCCCCHHHHHHHHHHHHHCCCHHHHHH
Q ss_conf             189999737410013565348998987640358---70578799813-755337787999999987596368999
Q gi|254780255|r   64 CRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTN---SEIHLSVNEVP-KPEINATLIAQSIAQQLERRVVFRRAM  134 (227)
Q Consensus        64 i~I~I~~~kP~~iiGkkg~~i~~l~~~L~~~~~---~~v~i~v~ei~-~p~~~A~~iA~~Ia~~Lekr~~fRr~~  134 (227)
                      +.|.|-..+-|.+||++|+.+++|++.-.-...   ..-.+.+.... .....|...|..+...++++.+--.++
T Consensus         5 i~i~ip~~~ig~vIG~gG~~Ik~i~~~tg~~I~Id~d~g~v~i~~~~~~~~~~a~~~a~~iI~aI~rGf~Pe~a~   79 (84)
T d1tuaa1           5 IYVKVKPERLGAVIGPRGEVKAEIMRRTGTVITVDTENSMVIVEPEAEGIPPVNLMKAAEVVKAISLGFPPEKAF   79 (84)
T ss_dssp             EEEECCGGGHHHHHCGGGHHHHHHHHHHTEEEEEETTTTEEEEEESSTTSCHHHHHHHHHHHHHHHHTCCHHHHG
T ss_pred             EEEEECHHHCCEEECCCCHHHHHHHHHHCCEEEEECCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCCHHHHH
T ss_conf             899949788073336995539999999898899976997188743785325999999999999984789827888


No 11 
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]}
Probab=57.05  E-value=3.9  Score=18.13  Aligned_cols=29  Identities=31%  Similarity=0.511  Sum_probs=24.3

Q ss_pred             CEEEEEECCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             18999973741001356534899898764
Q gi|254780255|r   64 CRIIVYSARPGLIIGKKGTDIEKIRKKLS   92 (227)
Q Consensus        64 i~I~I~~~kP~~iiGkkg~~i~~l~~~L~   92 (227)
                      ..|.|-...-|.|||++|..|+++++.-.
T Consensus         6 ~~i~VP~~~vg~iIG~~G~~I~~I~~~sg   34 (75)
T d1zzka1           6 TQVTIPKDLAGSIIGKGGQRIKQIRHESG   34 (75)
T ss_dssp             EEEEEETTTGGGGTCGGGHHHHHHHHHHC
T ss_pred             EEEEECHHHCCEEECCCCCHHHHHHHHCC
T ss_conf             99999967537469989842899985439


No 12 
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]}
Probab=53.66  E-value=3.2  Score=18.63  Aligned_cols=29  Identities=21%  Similarity=0.312  Sum_probs=24.2

Q ss_pred             CEEEEEECCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             18999973741001356534899898764
Q gi|254780255|r   64 CRIIVYSARPGLIIGKKGTDIEKIRKKLS   92 (227)
Q Consensus        64 i~I~I~~~kP~~iiGkkg~~i~~l~~~L~   92 (227)
                      +++.+-...-|.+||++|..++++++.-.
T Consensus         5 i~i~VP~~~vg~iIGk~G~~Ik~I~~~sg   33 (74)
T d1dtja_           5 VEMAVPENLVGAILGKGGKTLVEYQELTG   33 (74)
T ss_dssp             EEEEEETTTHHHHHCSTTHHHHHHHHHHC
T ss_pred             EEEEECHHHCCEEECCCCHHHHHHHHHCC
T ss_conf             99992978736368989735899997719


No 13 
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]}
Probab=50.04  E-value=2.7  Score=19.06  Aligned_cols=29  Identities=34%  Similarity=0.634  Sum_probs=24.6

Q ss_pred             CEEEEEECCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             18999973741001356534899898764
Q gi|254780255|r   64 CRIIVYSARPGLIIGKKGTDIEKIRKKLS   92 (227)
Q Consensus        64 i~I~I~~~kP~~iiGkkg~~i~~l~~~L~   92 (227)
                      +++.+....-|.+||++|..+++|++.-.
T Consensus         6 ~~i~vp~~~~g~IIGk~G~~I~~I~~~tg   34 (71)
T d2axya1           6 IRLLMHGKEVGSIIGKKGESVKKMREESG   34 (71)
T ss_dssp             EEEEEEHHHHHHHHCGGGHHHHHHHHHHC
T ss_pred             EEEEECHHHCCEEECCCCHHHHHHHHHHC
T ss_conf             99998778828689999804999999869


No 14 
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]}
Probab=49.92  E-value=3.7  Score=18.23  Aligned_cols=29  Identities=38%  Similarity=0.619  Sum_probs=23.8

Q ss_pred             CEEEEEECCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             18999973741001356534899898764
Q gi|254780255|r   64 CRIIVYSARPGLIIGKKGTDIEKIRKKLS   92 (227)
Q Consensus        64 i~I~I~~~kP~~iiGkkg~~i~~l~~~L~   92 (227)
                      ..+.|-...-|.|||++|..|+++++.-.
T Consensus         3 ~~~~IP~~~vg~IIGk~G~~Ik~I~~~sg   31 (71)
T d1j4wa2           3 FNFIVPTGKTGLIIGKGGETIKSISQQSG   31 (71)
T ss_dssp             EEEEEETTTHHHHHCGGGHHHHHHHHHHC
T ss_pred             EEEEECHHHCCEEECCCCCCHHHHHHHCC
T ss_conf             99997867504579989839689774338


No 15 
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]}
Probab=49.14  E-value=2.8  Score=18.93  Aligned_cols=29  Identities=24%  Similarity=0.446  Sum_probs=23.6

Q ss_pred             CEEEEEECCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             18999973741001356534899898764
Q gi|254780255|r   64 CRIIVYSARPGLIIGKKGTDIEKIRKKLS   92 (227)
Q Consensus        64 i~I~I~~~kP~~iiGkkg~~i~~l~~~L~   92 (227)
                      +.+.+-...-|+|||++|..|+++++.-.
T Consensus         5 ~~i~VP~~~vg~iIGk~G~~I~~I~~~tg   33 (74)
T d1j4wa1           5 IDVPIPRFAVGIVIGRNGEMIKKIQNDAG   33 (74)
T ss_dssp             EEEEEEHHHHHHHHCGGGHHHHHHHHHHC
T ss_pred             EEEEECHHHCCEEECCCCCHHHHHHHHCC
T ss_conf             99992778778538989867899987709


No 16 
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]}
Probab=47.61  E-value=3.6  Score=18.33  Aligned_cols=33  Identities=30%  Similarity=0.289  Sum_probs=26.4

Q ss_pred             CCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             588518999973741001356534899898764
Q gi|254780255|r   60 THKNCRIIVYSARPGLIIGKKGTDIEKIRKKLS   92 (227)
Q Consensus        60 t~~~i~I~I~~~kP~~iiGkkg~~i~~l~~~L~   92 (227)
                      ++....+.|-...-+.|||++|.+|++|++.-.
T Consensus        13 ~~v~~~i~IP~~~vg~vIGk~G~~Ik~I~~~tg   45 (104)
T d1we8a_          13 TPVFEQLSVPQRSVGRIIGRGGETIRSICKASG   45 (104)
T ss_dssp             CEEEEEEEEETTTHHHHHTTTSHHHHHHHHHHC
T ss_pred             CCEEEEEEECHHHHCCEECCCCCCHHHHHHHCC
T ss_conf             988999998978733138989963189999759


No 17 
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]}
Probab=47.30  E-value=4.3  Score=17.84  Aligned_cols=29  Identities=28%  Similarity=0.502  Sum_probs=23.9

Q ss_pred             CEEEEEECCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             18999973741001356534899898764
Q gi|254780255|r   64 CRIIVYSARPGLIIGKKGTDIEKIRKKLS   92 (227)
Q Consensus        64 i~I~I~~~kP~~iiGkkg~~i~~l~~~L~   92 (227)
                      ..+.|-...-|.+||++|..|+++++.-.
T Consensus         4 ~~i~VP~~~vg~iIGk~G~~I~~I~~~tg   32 (70)
T d1wvna1           4 HELTIPNNLIGCIIGRQGANINEIRQMSG   32 (70)
T ss_dssp             EEEEEEGGGHHHHHCGGGHHHHHHHHHHC
T ss_pred             EEEEECHHHCCEEECCCCHHHHHHHHHCC
T ss_conf             99998767526469999828999999829


No 18 
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]}
Probab=39.60  E-value=4.9  Score=17.55  Aligned_cols=30  Identities=23%  Similarity=0.392  Sum_probs=23.4

Q ss_pred             CCEEEEEECCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             518999973741001356534899898764
Q gi|254780255|r   63 NCRIIVYSARPGLIIGKKGTDIEKIRKKLS   92 (227)
Q Consensus        63 ~i~I~I~~~kP~~iiGkkg~~i~~l~~~L~   92 (227)
                      .+.|.+-...-+.+||++|..++++++...
T Consensus         6 ~~ei~V~~~~~~~iIG~~G~~i~~I~~~tg   35 (71)
T d1viga_           6 YVEINIDHKFHRHLIGKSGANINRIKDQYK   35 (71)
T ss_dssp             EEEEEECSSHHHHHTCSSCCHHHHHHHHTC
T ss_pred             EEEEEECHHHHCCCCCCCCCHHHHHHHHHC
T ss_conf             999999988716027988920999999709


No 19 
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]}
Probab=38.03  E-value=4.4  Score=17.82  Aligned_cols=30  Identities=17%  Similarity=0.418  Sum_probs=24.5

Q ss_pred             CEEEEEECCCCCCCCCCCHHHHHHHHHHHC
Q ss_conf             189999737410013565348998987640
Q gi|254780255|r   64 CRIIVYSARPGLIIGKKGTDIEKIRKKLSN   93 (227)
Q Consensus        64 i~I~I~~~kP~~iiGkkg~~i~~l~~~L~~   93 (227)
                      ..|.|-...-++|||++|..+++|.+...-
T Consensus        12 ~~i~Ip~~~~~~iIG~~G~~i~~I~~~tg~   41 (81)
T d2ctea1          12 ATVAIPKEHHRFVIGKNGEKLQDLELKTAT   41 (81)
T ss_dssp             EEEECCTTTHHHHHCSSSCHHHHHHHHTTC
T ss_pred             EEEEECHHHHHHCCCCCCHHHHHHHHHHCC
T ss_conf             999999798736159797219999998498


No 20 
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]}
Probab=36.61  E-value=5.6  Score=17.18  Aligned_cols=29  Identities=31%  Similarity=0.362  Sum_probs=23.7

Q ss_pred             CEEEEEECCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             18999973741001356534899898764
Q gi|254780255|r   64 CRIIVYSARPGLIIGKKGTDIEKIRKKLS   92 (227)
Q Consensus        64 i~I~I~~~kP~~iiGkkg~~i~~l~~~L~   92 (227)
                      +.+.+-...-+.|||++|..|++|.+.-.
T Consensus        12 ~~i~Vp~~~~~~iIG~~G~~i~~I~~~t~   40 (84)
T d2ctla1          12 LSVTVDPKYHPKIIGRKGAVITQIRLEHD   40 (84)
T ss_dssp             EEEECCTTTHHHHSCSSSCHHHHHHHHHT
T ss_pred             EEEEECHHHHHHHCCCCCHHHHHHHHHHC
T ss_conf             99999989983616989613999999839


No 21 
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]}
Probab=35.24  E-value=5.2  Score=17.39  Aligned_cols=29  Identities=28%  Similarity=0.652  Sum_probs=23.1

Q ss_pred             CEEEEEECCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             18999973741001356534899898764
Q gi|254780255|r   64 CRIIVYSARPGLIIGKKGTDIEKIRKKLS   92 (227)
Q Consensus        64 i~I~I~~~kP~~iiGkkg~~i~~l~~~L~   92 (227)
                      .++.+-...-+.|||++|..|++|++.-.
T Consensus        10 ~~i~Vp~~~~g~iIGk~G~~Ik~I~~~tg   38 (81)
T d1x4ma1          10 QEIMIPASKAGLVIGKGGETIKQLQERAG   38 (81)
T ss_dssp             EEEEECHHHHHHHSCSSSSHHHHHHHHHT
T ss_pred             EEEEECHHHCCEEECCCCCHHHHHHHHHC
T ss_conf             99997878769569989844899999819


No 22 
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]}
Probab=33.69  E-value=7.3  Score=16.53  Aligned_cols=29  Identities=28%  Similarity=0.438  Sum_probs=23.2

Q ss_pred             CEEEEEECCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             18999973741001356534899898764
Q gi|254780255|r   64 CRIIVYSARPGLIIGKKGTDIEKIRKKLS   92 (227)
Q Consensus        64 i~I~I~~~kP~~iiGkkg~~i~~l~~~L~   92 (227)
                      ..|.|-...-+.|||++|..|+++++.-.
T Consensus        10 ~~i~IP~~~~g~iIG~~G~~i~~I~~~tg   38 (79)
T d1x4na1          10 EEYKVPDGMVGFIIGRGGEQISRIQQESG   38 (79)
T ss_dssp             EEEEEEHHHHHHHHCSSSHHHHHHHHHSC
T ss_pred             EEEEECHHHHCCEECCCCHHHHHHHHHHC
T ss_conf             99998967503028979414899999709


No 23 
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]}
Probab=32.99  E-value=4.9  Score=17.51  Aligned_cols=32  Identities=19%  Similarity=0.274  Sum_probs=25.1

Q ss_pred             CCCCEEEEEECCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             88518999973741001356534899898764
Q gi|254780255|r   61 HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLS   92 (227)
Q Consensus        61 ~~~i~I~I~~~kP~~iiGkkg~~i~~l~~~L~   92 (227)
                      |....+.|-..+-+.+||+.|..+++|++.-.
T Consensus         2 P~~~~i~Ip~~kig~vIG~GG~~Ik~I~~~tg   33 (54)
T d1e3ha4           2 PRIITVKIPVDKIGEVIGPKRQMINQIQEDTG   33 (54)
T ss_dssp             CBCC---------------------CHHHHSC
T ss_pred             CEEEEEEECHHHEEEEECCCCHHHHHHHHHHC
T ss_conf             86999996977855788896188999999889


No 24 
>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]}
Probab=31.28  E-value=6.2  Score=16.94  Aligned_cols=28  Identities=21%  Similarity=0.290  Sum_probs=21.4

Q ss_pred             CEEEEEECCCCCCCCCCCHHHHHHHHHH
Q ss_conf             1899997374100135653489989876
Q gi|254780255|r   64 CRIIVYSARPGLIIGKKGTDIEKIRKKL   91 (227)
Q Consensus        64 i~I~I~~~kP~~iiGkkg~~i~~l~~~L   91 (227)
                      ..|.|-...-++|||++|..|++|++.-
T Consensus        12 ~~i~Vp~~~~~~iIGk~G~~I~~I~~~~   39 (82)
T d2ctja1          12 VEVSIPAKLHNSLIGTKGRLIRSIMEEC   39 (82)
T ss_dssp             EEEECCHHHHHHHHCSSSHHHHHHHHHH
T ss_pred             EEEEECHHHHHHCCCCCCCCHHHHHHHC
T ss_conf             9999898988360898973399999981


No 25 
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]}
Probab=31.04  E-value=5.9  Score=17.06  Aligned_cols=30  Identities=20%  Similarity=0.227  Sum_probs=22.4

Q ss_pred             CCEEEEEECCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             518999973741001356534899898764
Q gi|254780255|r   63 NCRIIVYSARPGLIIGKKGTDIEKIRKKLS   92 (227)
Q Consensus        63 ~i~I~I~~~kP~~iiGkkg~~i~~l~~~L~   92 (227)
                      ++.+.|-..+-+.+||++|..++.|++.-.
T Consensus         2 g~vi~Ip~~~ig~iIGkgG~~Ik~i~~~tg   31 (69)
T d2je6i3           2 GIVIDIMPVKVPRVIGKNKSMYETLTSKSG   31 (69)
T ss_dssp             SCEEECCGGGHHHHHCGGGHHHHHHHTTC-
T ss_pred             CEEEEECHHHCCCEECCCHHHHHHHHHHHC
T ss_conf             799997866602017985349999999889


No 26 
>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]}
Probab=28.24  E-value=4.8  Score=17.56  Aligned_cols=28  Identities=32%  Similarity=0.519  Sum_probs=22.0

Q ss_pred             EEEEEECCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             8999973741001356534899898764
Q gi|254780255|r   65 RIIVYSARPGLIIGKKGTDIEKIRKKLS   92 (227)
Q Consensus        65 ~I~I~~~kP~~iiGkkg~~i~~l~~~L~   92 (227)
                      .+.|-...-|.+||++|..|+++++.--
T Consensus        11 ~i~Ip~~~ig~vIG~gG~~I~~I~~~tG   38 (78)
T d2cpqa1          11 EFVVREDLMGLAIGTHGSNIQQARKVPG   38 (78)
T ss_dssp             EEECCHHHHHHHHTTTTHHHHHHHTSTT
T ss_pred             EEEECHHHHHHHCCCCHHHHHHHHHHCC
T ss_conf             9999988877771897089999998519


No 27 
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]}
Probab=28.20  E-value=8.4  Score=16.18  Aligned_cols=60  Identities=22%  Similarity=0.200  Sum_probs=34.2

Q ss_pred             CEEEEEECCCCCCCCCCCHHHHHHHHHHHCCC--CCEEEEEEEEECCCCCCHHHHHHHHHHHHHCC
Q ss_conf             18999973741001356534899898764035--87057879981375533778799999998759
Q gi|254780255|r   64 CRIIVYSARPGLIIGKKGTDIEKIRKKLSNMT--NSEIHLSVNEVPKPEINATLIAQSIAQQLERR  127 (227)
Q Consensus        64 i~I~I~~~kP~~iiGkkg~~i~~l~~~L~~~~--~~~v~i~v~ei~~p~~~A~~iA~~Ia~~Lekr  127 (227)
                      ..|.|-...-+.+||++|..|++|++.-.-..  ..+=.   ..+.-+. .+.--|...-..+...
T Consensus         3 ~vi~Ip~~~ig~IIG~gG~~I~~I~~~tg~~I~i~~~g~---v~I~G~~-e~v~~A~~~I~~i~~e   64 (84)
T d2ba0a3           3 RIVAINPARVPRVIGKKGSMIKLLKSELDVQIVVGQNGL---IWVNGDR-RKVSIAEEAIYLIEQE   64 (84)
T ss_dssp             EEEECCGGGHHHHHCGGGHHHHHHHHHHTCEEEECTTSE---EEEESCH-HHHHHHHHHHHHHHHC
T ss_pred             EEEEECHHHCCEEECCCHHHHHHHHHHHCCEEEECCCCE---EEEEECH-HHHHHHHHHHHHHHHH
T ss_conf             799978665360168967899999999897799889987---9999499-9999999999999983


No 28 
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]}
Probab=26.86  E-value=6.3  Score=16.88  Aligned_cols=30  Identities=23%  Similarity=0.357  Sum_probs=23.6

Q ss_pred             CCEEEEEECCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             518999973741001356534899898764
Q gi|254780255|r   63 NCRIIVYSARPGLIIGKKGTDIEKIRKKLS   92 (227)
Q Consensus        63 ~i~I~I~~~kP~~iiGkkg~~i~~l~~~L~   92 (227)
                      ...|.|-...-+.|||++|..|+++.+.-.
T Consensus        11 t~~i~Vp~~~~~~iIG~~G~~i~~I~~~tg   40 (91)
T d2ctka1          11 TIEVEVPFDLHRYVIGQKGSGIRKMMDEFE   40 (91)
T ss_dssp             EEEEECCHHHHHHHHCSSSHHHHHHHHHTC
T ss_pred             EEEEEECHHHHHHHCCCCCHHHHHHHHHHC
T ss_conf             999998989882716989544999999869


No 29 
>d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]}
Probab=25.44  E-value=9.4  Score=15.89  Aligned_cols=33  Identities=30%  Similarity=0.388  Sum_probs=23.5

Q ss_pred             ECCCCCEEEEE--ECCCCCCCCCCCHHHHHHHHHH
Q ss_conf             25885189999--7374100135653489989876
Q gi|254780255|r   59 RTHKNCRIIVY--SARPGLIIGKKGTDIEKIRKKL   91 (227)
Q Consensus        59 Rt~~~i~I~I~--~~kP~~iiGkkg~~i~~l~~~L   91 (227)
                      +..+.+.+.+.  ....++|||++|+.|++|.+.-
T Consensus        16 ~~~~~~t~~v~VP~~~h~~iIG~~G~~I~~i~~~~   50 (90)
T d2ctfa1          16 KANSFTVSSVAAPSWLHRFIIGKKGQNLAKITQQM   50 (90)
T ss_dssp             CCCCCEEEEEECCSTTHHHHHTTTTCHHHHHHHHC
T ss_pred             HCCCCEEEEEECCHHHHHHCCCCCCHHHHHHHHHC
T ss_conf             75896899998288888456789954599999985


No 30 
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]}
Probab=25.27  E-value=9.6  Score=15.84  Aligned_cols=29  Identities=24%  Similarity=0.319  Sum_probs=22.7

Q ss_pred             CEEEEEECCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             18999973741001356534899898764
Q gi|254780255|r   64 CRIIVYSARPGLIIGKKGTDIEKIRKKLS   92 (227)
Q Consensus        64 i~I~I~~~kP~~iiGkkg~~i~~l~~~L~   92 (227)
                      ..|.|-...-+.|||++|..++++++.-.
T Consensus        12 ~~i~Vp~~~~~~iIG~~G~~i~~I~~~tg   40 (81)
T d2ctma1          12 EDVPLDHRVHARIIGARGKAIRKIMDEFK   40 (81)
T ss_dssp             EEEECCTTTHHHHHCSSSCHHHHHHHHHT
T ss_pred             EEEEECHHHHHHCCCCCCCCHHHHHHHHC
T ss_conf             99999989983436898953999999969


Done!