BLAST/PSIBLAST alignment of GI: 254780255 and GI: 116251546 at iteration 1
>gi|116251546|ref|YP_767384.1| 30S ribosomal protein S3 [Rhizobium leguminosarum bv. viciae 3841] Length = 243
>gi|241204171|ref|YP_002975267.1| 30S ribosomal protein S3 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 243
>gi|123261672|sp|Q1MID5|RS3_RHIL3 RecName: Full=30S ribosomal protein S3 Length = 243
>gi|115256194|emb|CAK07275.1| putative 30S ribosomal protein S3 [Rhizobium leguminosarum bv. viciae 3841] Length = 243
>gi|240858061|gb|ACS55728.1| ribosomal protein S3 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 243
 Score =  319 bits (818), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 151/227 (66%), Positives = 188/227 (82%), Gaps = 3/227 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI FRLG+N TW+SRWFA  +EYG LLHEDLK+R+++   LKQAG++K++IER 
Sbjct: 1   MGQKINPIGFRLGINRTWDSRWFADNAEYGQLLHEDLKMRKFVMSELKQAGISKVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ ++SARPGLIIG+KG DI+K+RKKLS MTNSE HL++ EV KPE++ATL+AQSI
Sbjct: 61  HKKCRVTIHSARPGLIIGRKGADIDKLRKKLSEMTNSETHLNIVEVRKPEVDATLVAQSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA+G+K+  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAEGIKITCAGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDYGTA AETA+G CGIKV++  + E+ + D    A+E R +E D+
Sbjct: 181 DIDYGTAEAETAFGICGIKVWI-FKGEILEHDPM--ASERRAMEGDA 224