BLAST/PSIBLAST alignment of GI: 254780255 and GI: 15889236 at iteration 1
>gi|15889236|ref|NP_354917.1| 30S ribosomal protein S3 [Agrobacterium tumefaciens str. C58] Length = 243
>gi|27734508|sp|Q8UE24|RS3_AGRT5 RecName: Full=30S ribosomal protein S3 Length = 243
>gi|15157063|gb|AAK87702.1| 30S ribosomal protein S3 [Agrobacterium tumefaciens str. C58] Length = 243
 Score =  320 bits (820), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 157/227 (69%), Positives = 186/227 (81%), Gaps = 3/227 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI FRLG+N TW+SRW+A  +EYG LLHEDLKIR YL   LKQAG+AK++IER 
Sbjct: 1   MGQKINPIGFRLGINRTWDSRWYADTAEYGKLLHEDLKIRAYLIKELKQAGIAKVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ ++SARPGLIIGKKG DIEK+RKKLS MTNSE HL++ EV KPEI+ATL+AQSI
Sbjct: 61  HKKCRVTIHSARPGLIIGKKGADIEKLRKKLSEMTNSETHLNIVEVRKPEIDATLVAQSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA+G+K+   GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAEGIKITCGGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDYGTA AETA+G CGIKV++  + E+ + D    A+E R +E D+
Sbjct: 181 DIDYGTAEAETAFGICGIKVWI-FKGEILEHDPM--ASERRGLEGDA 224