PSIBLAST alignment of GI: 254780255 and protein with PDB id: 1pns

>gi|34811531|pdb|1PNS|C Chain C, Crystal Structure Of A Streptomycin Dependent Ribosome From E. Coli, 30s Subunit Of 70s Ribosome. This File, 1pns, Contains The 30s Subunit, Two Trnas, And One Mrna Molecule. The 50s Ribosomal Subunit Is In File 1pnu. Length = 206
>gi|34811587|pdb|1PNX|C Chain C, Crystal Structure Of The Wild Type Ribosome From E. Coli, 30s Subunit Of 70s Ribosome. This File, 1pnx, Contains Only Molecules Of The 30s Ribosomal Subunit. The 50s Subunit Is In The Pdb File 1pny. Length = 206
 Score =  251 bits (640), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 100/206 (48%), Positives = 138/206 (66%)

Query: 2   GQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERTH 61
           G KI+PI FRLG+   W SRW+A   +Y  LL ED +IR  L+  L  AG+A++ IER  
Sbjct: 1   GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAA 60

Query: 62  KNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSIA 121
            N  + V+ A+PG++IG+ G  I  +R++L+ +T   + L+V EV  P ++A L+AQ +A
Sbjct: 61  DNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVA 120

Query: 122 QQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRAH 181
           +Q+ERR   RRA+K+AVQ  M  GA G KVI SGR+ GAE +RTE   +GRVPL TLRA+
Sbjct: 121 EQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRAN 180

Query: 182 IDYGTAVAETAYGSCGIKVYVSLRDE 207
           IDYG A+A T YG  G+K Y+ L + 
Sbjct: 181 IDYGFALARTTYGVLGVKAYIFLGEV 206