BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780255|ref|YP_003064668.1| 30S ribosomal protein S3
[Candidatus Liberibacter asiaticus str. psy62]
         (227 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done



>gi|86357311|ref|YP_469203.1| 30S ribosomal protein S3 [Rhizobium etli CFN 42]
 gi|190891361|ref|YP_001977903.1| 30S ribosomal protein S3 [Rhizobium etli CIAT 652]
 gi|123765804|sp|Q2K9L0|RS3_RHIEC RecName: Full=30S ribosomal protein S3
 gi|226697748|sp|B3PWS7|RS3_RHIE6 RecName: Full=30S ribosomal protein S3
 gi|86281413|gb|ABC90476.1| 30S ribosomal protein S3 [Rhizobium etli CFN 42]
 gi|190696640|gb|ACE90725.1| 30S ribosomal protein S3 [Rhizobium etli CIAT 652]
 gi|327191391|gb|EGE58417.1| ribosomal protein S3 [Rhizobium etli CNPAF512]
          Length = 244

 Score =  292 bits (748), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 151/227 (66%), Positives = 189/227 (83%), Gaps = 3/227 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI FRLG+N TW+SRWFA  +EYG LLHEDLK+R+++   LKQAG++K++IER 
Sbjct: 1   MGQKINPIGFRLGINRTWDSRWFADNAEYGQLLHEDLKMRKFVMSELKQAGISKVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ ++SARPGLIIG+KG DI+K+RKKLS+MTNSE HL++ EV KPE++ATL+AQSI
Sbjct: 61  HKKCRVTIHSARPGLIIGRKGADIDKLRKKLSDMTNSETHLNIVEVRKPEVDATLVAQSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA+G+K+  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAEGIKITCAGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDYGTA AETA+G CGIKV++  + E+ + D    A+E R +E D+
Sbjct: 181 DIDYGTAEAETAFGICGIKVWIF-KGEILEHDPM--ASERRALEGDA 224


>gi|209548941|ref|YP_002280858.1| 30S ribosomal protein S3 [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|226697749|sp|B5ZYU1|RS3_RHILW RecName: Full=30S ribosomal protein S3
 gi|209534697|gb|ACI54632.1| ribosomal protein S3 [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 243

 Score =  292 bits (747), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 151/227 (66%), Positives = 189/227 (83%), Gaps = 3/227 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI FRLG+N TW+SRWFA  +EYG LLHEDLK+R+++   LKQAG++K++IER 
Sbjct: 1   MGQKINPIGFRLGINRTWDSRWFADNAEYGQLLHEDLKMRKFVMSELKQAGISKVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ ++SARPGLIIG+KG DI+K+RKKLS+MTNSE HL++ EV KPE++ATL+AQSI
Sbjct: 61  HKKCRVTIHSARPGLIIGRKGADIDKLRKKLSDMTNSETHLNIVEVRKPEVDATLVAQSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA+G+K+  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAEGIKITCAGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDYGTA AETA+G CGIKV++  + E+ + D    A+E R +E D+
Sbjct: 181 DIDYGTAEAETAFGICGIKVWIF-KGEILEHDPM--ASERRAMEGDA 224


>gi|227821762|ref|YP_002825732.1| 30S ribosomal protein S3 [Sinorhizobium fredii NGR234]
 gi|254764541|sp|C3MAY6|RS3_RHISN RecName: Full=30S ribosomal protein S3
 gi|227340761|gb|ACP24979.1| 30S ribosomal protein S3 [Sinorhizobium fredii NGR234]
          Length = 237

 Score =  292 bits (747), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 155/227 (68%), Positives = 185/227 (81%), Gaps = 3/227 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI FRLG+N TW+SRWFA  +EYG LLHEDLKIR YL   LK AG+AK++IER 
Sbjct: 1   MGQKINPIGFRLGINRTWDSRWFADNAEYGQLLHEDLKIRAYLMEELKAAGIAKVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ ++SARPGLIIGKKG DIEK+RKKLS MTNSE HL++ EV KPE++ATL+AQSI
Sbjct: 61  HKKCRVTIHSARPGLIIGKKGADIEKLRKKLSEMTNSETHLNIVEVRKPEVDATLVAQSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA+G+K+  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAEGIKITCAGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDYGTA AETA+G CG+KV++  + E+ + D    A+E R  E D+
Sbjct: 181 DIDYGTAEAETAFGICGVKVWIF-KGEILEHDPM--ASERRATESDN 224


>gi|150396213|ref|YP_001326680.1| 30S ribosomal protein S3 [Sinorhizobium medicae WSM419]
 gi|189045338|sp|A6U865|RS3_SINMW RecName: Full=30S ribosomal protein S3
 gi|150027728|gb|ABR59845.1| ribosomal protein S3 [Sinorhizobium medicae WSM419]
          Length = 237

 Score =  291 bits (746), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 155/227 (68%), Positives = 185/227 (81%), Gaps = 3/227 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI FRLG+N TW+SRWFA  +EYG LLHEDLKIR YL   LK AG+AK++IER 
Sbjct: 1   MGQKINPIGFRLGINRTWDSRWFADNAEYGQLLHEDLKIRAYLMEELKAAGIAKVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ ++SARPGLIIGKKG DIEK+RKKLS MTNSE HL++ EV KPE++ATL+AQSI
Sbjct: 61  HKKCRVTIHSARPGLIIGKKGADIEKLRKKLSEMTNSETHLNIVEVRKPEVDATLVAQSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA+G+K+  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAEGIKITCAGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDYGTA AETA+G CG+KV++  + E+ + D    A+E R  E D+
Sbjct: 181 DIDYGTAEAETAFGICGVKVWIF-KGEILEHDPM--ASERRATESDN 224


>gi|15965115|ref|NP_385468.1| 30S ribosomal protein S3 [Sinorhizobium meliloti 1021]
 gi|307314365|ref|ZP_07593971.1| ribosomal protein S3 [Sinorhizobium meliloti BL225C]
 gi|307322077|ref|ZP_07601453.1| ribosomal protein S3 [Sinorhizobium meliloti AK83]
 gi|27734523|sp|Q92QG4|RS3_RHIME RecName: Full=30S ribosomal protein S3
 gi|15074295|emb|CAC45941.1| Probable 30S ribosomal protein S3 [Sinorhizobium meliloti 1021]
 gi|306892259|gb|EFN23069.1| ribosomal protein S3 [Sinorhizobium meliloti AK83]
 gi|306899063|gb|EFN29705.1| ribosomal protein S3 [Sinorhizobium meliloti BL225C]
          Length = 237

 Score =  291 bits (745), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 155/227 (68%), Positives = 185/227 (81%), Gaps = 3/227 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI FRLG+N TW+SRWFA  +EYG LLHEDLKIR YL   LK AG+AK++IER 
Sbjct: 1   MGQKINPIGFRLGINRTWDSRWFADNAEYGQLLHEDLKIRAYLMEELKSAGIAKVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ ++SARPGLIIGKKG DIEK+RKKLS MTNSE HL++ EV KPE++ATL+AQSI
Sbjct: 61  HKKCRVTIHSARPGLIIGKKGADIEKLRKKLSEMTNSETHLNIVEVRKPEVDATLVAQSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA+G+K+  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAEGIKITCAGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDYGTA AETA+G CG+KV++  + E+ + D    A+E R  E D+
Sbjct: 181 DIDYGTAEAETAFGICGVKVWIF-KGEILEHDPM--ASERRATESDN 224


>gi|116251546|ref|YP_767384.1| 30S ribosomal protein S3 [Rhizobium leguminosarum bv. viciae 3841]
 gi|241204171|ref|YP_002975267.1| 30S ribosomal protein S3 [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|123261672|sp|Q1MID5|RS3_RHIL3 RecName: Full=30S ribosomal protein S3
 gi|115256194|emb|CAK07275.1| putative 30S ribosomal protein S3 [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|240858061|gb|ACS55728.1| ribosomal protein S3 [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 243

 Score =  291 bits (745), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 151/227 (66%), Positives = 188/227 (82%), Gaps = 3/227 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI FRLG+N TW+SRWFA  +EYG LLHEDLK+R+++   LKQAG++K++IER 
Sbjct: 1   MGQKINPIGFRLGINRTWDSRWFADNAEYGQLLHEDLKMRKFVMSELKQAGISKVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ ++SARPGLIIG+KG DI+K+RKKLS MTNSE HL++ EV KPE++ATL+AQSI
Sbjct: 61  HKKCRVTIHSARPGLIIGRKGADIDKLRKKLSEMTNSETHLNIVEVRKPEVDATLVAQSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA+G+K+  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAEGIKITCAGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDYGTA AETA+G CGIKV++  + E+ + D    A+E R +E D+
Sbjct: 181 DIDYGTAEAETAFGICGIKVWIF-KGEILEHDPM--ASERRAMEGDA 224


>gi|222085681|ref|YP_002544211.1| ribosomal protein S3 [Agrobacterium radiobacter K84]
 gi|254764507|sp|B9JDT4|RS3_AGRRK RecName: Full=30S ribosomal protein S3
 gi|221723129|gb|ACM26285.1| ribosomal protein S3 [Agrobacterium radiobacter K84]
          Length = 241

 Score =  291 bits (745), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 152/227 (66%), Positives = 187/227 (82%), Gaps = 3/227 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI FRLG+N TW+SRWFA  +EYG LLHEDLK+R+++   LKQAG++K++IER 
Sbjct: 1   MGQKINPIGFRLGINRTWDSRWFADNAEYGQLLHEDLKMRKFVMDELKQAGISKVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ ++SARPGLIIGKKG DI+K+RKKLS+MTNSE HL++ EV KPEI+A L+AQSI
Sbjct: 61  HKKCRVTIHSARPGLIIGKKGADIDKLRKKLSDMTNSETHLNIVEVRKPEIDAVLVAQSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA+G+K+   GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAEGIKITCGGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDYGTA AETA+G CGIKV++  + E+ + D    A+E R +E D+
Sbjct: 181 DIDYGTAEAETAFGICGIKVWIF-KGEILEHDPM--ASERRALEGDA 224


>gi|15889236|ref|NP_354917.1| 30S ribosomal protein S3 [Agrobacterium tumefaciens str. C58]
 gi|27734508|sp|Q8UE24|RS3_AGRT5 RecName: Full=30S ribosomal protein S3
 gi|15157063|gb|AAK87702.1| 30S ribosomal protein S3 [Agrobacterium tumefaciens str. C58]
          Length = 243

 Score =  289 bits (740), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 157/227 (69%), Positives = 186/227 (81%), Gaps = 3/227 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI FRLG+N TW+SRW+A  +EYG LLHEDLKIR YL   LKQAG+AK++IER 
Sbjct: 1   MGQKINPIGFRLGINRTWDSRWYADTAEYGKLLHEDLKIRAYLIKELKQAGIAKVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ ++SARPGLIIGKKG DIEK+RKKLS MTNSE HL++ EV KPEI+ATL+AQSI
Sbjct: 61  HKKCRVTIHSARPGLIIGKKGADIEKLRKKLSEMTNSETHLNIVEVRKPEIDATLVAQSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA+G+K+   GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAEGIKITCGGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDYGTA AETA+G CGIKV++  + E+ + D    A+E R +E D+
Sbjct: 181 DIDYGTAEAETAFGICGIKVWIF-KGEILEHDPM--ASERRGLEGDA 224


>gi|119383517|ref|YP_914573.1| 30S ribosomal protein S3 [Paracoccus denitrificans PD1222]
 gi|152060888|sp|A1B033|RS3_PARDP RecName: Full=30S ribosomal protein S3
 gi|119373284|gb|ABL68877.1| SSU ribosomal protein S3P [Paracoccus denitrificans PD1222]
          Length = 240

 Score =  289 bits (739), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 134/225 (59%), Positives = 172/225 (76%), Gaps = 4/225 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI  RL VN TW+SRW+A   +YG LL EDLKIR++++   KQAGV++++IER 
Sbjct: 1   MGQKVNPIGMRLQVNRTWDSRWYADDKDYGNLLLEDLKIRDFIKKEAKQAGVSRVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ +Y+ARPG+IIGKKG DIE +RKKL+N T SE+HL++ EV KPE++A L+A+SI
Sbjct: 61  HKKCRVTIYAARPGVIIGKKGADIETLRKKLANFTGSELHLNIVEVRKPELDAQLVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQ+AMR GA G++V  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVSFRRAMKRAVQNAMRMGALGIRVNVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDY  + A T YG  G+KV++  + E+ + D   P A  R   +
Sbjct: 181 DIDYALSEASTPYGIIGVKVWIF-KGEIMEHD---PQARDRRATE 221


>gi|163760805|ref|ZP_02167884.1| 30S ribosomal protein S3 [Hoeflea phototrophica DFL-43]
 gi|162281849|gb|EDQ32141.1| 30S ribosomal protein S3 [Hoeflea phototrophica DFL-43]
          Length = 234

 Score =  288 bits (737), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 149/227 (65%), Positives = 184/227 (81%), Gaps = 3/227 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI FRLG+N TW+SRWFA  +EYG LLHEDLKIR+YL   LKQAG++K++IER 
Sbjct: 1   MGQKINPIGFRLGINRTWDSRWFADNAEYGKLLHEDLKIRKYLLAELKQAGISKVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ +++ARPGLIIGKKG DIEK+R+KL  MT SE HL++ EV KPE++ATL+AQSI
Sbjct: 61  HKKCRVTIHAARPGLIIGKKGADIEKLRRKLGEMTQSETHLNIVEVRKPEVDATLVAQSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERR+ FRRAMKR+VQSAMR GA+G+K+   GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRIAFRRAMKRSVQSAMRLGAEGIKITCGGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDYGTA A+TAYG CG+KV++  + E+ + D    A+E R  E D+
Sbjct: 181 DIDYGTAEAKTAYGICGVKVWIF-KGEILEHDPM--ASERRATEGDA 224


>gi|254470501|ref|ZP_05083905.1| ribosomal protein S3 [Pseudovibrio sp. JE062]
 gi|211960812|gb|EEA96008.1| ribosomal protein S3 [Pseudovibrio sp. JE062]
          Length = 238

 Score =  288 bits (737), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 143/226 (63%), Positives = 175/226 (77%), Gaps = 4/226 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI  RLG+N TW+SRWFA  +EYG LLHED +IREYL   LKQA V+K++IER 
Sbjct: 1   MGQKINPIGLRLGINRTWDSRWFASKNEYGDLLHEDFRIREYLLKELKQAAVSKVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ ++S RPG++IGKKG DIE++RKKLS MTNSE+HL++ EV KPE +A L+A SI
Sbjct: 61  HKKCRVTIHSGRPGVVIGKKGADIERLRKKLSAMTNSEVHLNIVEVRKPETDAALVAASI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA G+++   GRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAQGIRINCGGRLGGAEIARIEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            IDYGTA A TAYG+CG+KV++  + E+ + D   P A  R   + 
Sbjct: 181 DIDYGTATAHTAYGACGVKVWIF-KGEILEHD---PMASERRATEG 222


>gi|325293330|ref|YP_004279194.1| 30S ribosomal protein S3 [Agrobacterium sp. H13-3]
 gi|325061183|gb|ADY64874.1| 30S ribosomal protein S3 [Agrobacterium sp. H13-3]
          Length = 243

 Score =  288 bits (736), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 156/227 (68%), Positives = 186/227 (81%), Gaps = 3/227 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI FRLG+N TW+SRW+A  +EYG LLHEDLKIR YL   LKQAG+AK++IER 
Sbjct: 1   MGQKINPIGFRLGINRTWDSRWYADTAEYGKLLHEDLKIRAYLIKELKQAGIAKVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ ++SARPGLIIGKKG DIEK+RKKLS MTNSE HL++ EV KPEI+ATL+AQSI
Sbjct: 61  HKKCRVTIHSARPGLIIGKKGADIEKLRKKLSEMTNSETHLNIVEVRKPEIDATLVAQSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKR+VQSAMR GA+G+K+   GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRSVQSAMRLGAEGIKITCGGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDYGTA AETA+G CGIKV++  + E+ + D    A+E R +E D+
Sbjct: 181 DIDYGTAEAETAFGICGIKVWIF-KGEILEHDPM--ASERRGLEGDA 224


>gi|319783326|ref|YP_004142802.1| ribosomal protein S3 [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317169214|gb|ADV12752.1| ribosomal protein S3 [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 241

 Score =  287 bits (734), Expect = 9e-76,   Method: Composition-based stats.
 Identities = 146/227 (64%), Positives = 181/227 (79%), Gaps = 3/227 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI  RLG+N TW+SRWFA   EYG LLHED+KIR+YL+  LKQA ++K++IER 
Sbjct: 1   MGQKVNPIGLRLGINRTWDSRWFANTGEYGKLLHEDIKIRKYLEKELKQAAISKVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ +++ARPGLIIGKKG DIEK+RKKL  MT SE HL++ EV KPEI+ATL+AQSI
Sbjct: 61  HKKCRVTIHAARPGLIIGKKGADIEKLRKKLMEMTKSETHLNIVEVRKPEIDATLVAQSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERR+ FRRAMKRAVQSAMR GA+G+++  +GRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRIAFRRAMKRAVQSAMRLGAEGIRINCAGRLGGAEIARMEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            +DYGTA A TAYG CG+KV+V  + E+ + D    A+E R  E D+
Sbjct: 181 DVDYGTAEAHTAYGICGVKVWVF-KGEILEHDPM--ASERRASESDA 224


>gi|298291444|ref|YP_003693383.1| ribosomal protein S3 [Starkeya novella DSM 506]
 gi|296927955|gb|ADH88764.1| ribosomal protein S3 [Starkeya novella DSM 506]
          Length = 235

 Score =  286 bits (732), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 138/226 (61%), Positives = 178/226 (78%), Gaps = 3/226 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP+  RLG+N TW+SRWFA   EYG LLHED+KIRE L   LKQA V+KI+IER 
Sbjct: 1   MGQKVNPVGLRLGINRTWDSRWFAGKGEYGQLLHEDIKIREMLLKLLKQAAVSKIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ ++SARPG++IGKKG DI+K+RKK++ MTNSE+ +++ E+ KPEI+A L+A+SI
Sbjct: 61  HKKCRVTIHSARPGVVIGKKGADIDKLRKKVAEMTNSEVFINIVEIRKPEIDARLVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA+G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAEGIRINCSGRLGGAEIARLEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            +DYGTA A T YG+CG+KV++  + E+ + D    A + R  E +
Sbjct: 181 DVDYGTATAFTTYGTCGVKVWIF-KGEILEHDPM--AQDKRQAEGE 223


>gi|154245629|ref|YP_001416587.1| ribosomal protein S3 [Xanthobacter autotrophicus Py2]
 gi|226697776|sp|A7IFY7|RS3_XANP2 RecName: Full=30S ribosomal protein S3
 gi|154159714|gb|ABS66930.1| ribosomal protein S3 [Xanthobacter autotrophicus Py2]
          Length = 252

 Score =  286 bits (732), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 138/227 (60%), Positives = 179/227 (78%), Gaps = 3/227 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP+  RLG+N TW+SRWFA   EYG LLHED+KIRE L   LKQA V+K++IER 
Sbjct: 1   MGQKVNPVGLRLGINRTWDSRWFANKGEYGKLLHEDIKIREMLFKQLKQAAVSKVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ +YS RPG++IGKKG DI+K+RKK+S MT+SE+ +++ E+ KPEI+A L+A+SI
Sbjct: 61  HKKCRVTIYSGRPGVVIGKKGADIDKLRKKVSEMTSSEVFINIVEIRKPEIDARLVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA+G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAEGIRINCSGRLGGAEIARLEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            +DYGTA A T YG+CG+KV+V  + E+ + D    A + R  E+++
Sbjct: 181 DVDYGTATAFTTYGTCGVKVWVF-KGEILEHDPM--AQDKRQAEQEA 224


>gi|304321446|ref|YP_003855089.1| 30S ribosomal protein S3 [Parvularcula bermudensis HTCC2503]
 gi|303300348|gb|ADM09947.1| 30S ribosomal protein S3 [Parvularcula bermudensis HTCC2503]
          Length = 241

 Score =  286 bits (732), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 135/227 (59%), Positives = 176/227 (77%), Gaps = 3/227 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI  RLG+N TW+SRWFA    YG LLHEDL+IR +LQ  LK AGV++I+IER 
Sbjct: 1   MGQKVSPIGLRLGINRTWDSRWFASKGNYGDLLHEDLRIRNFLQKRLKNAGVSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ +Y+ARPG++IGKKG DIEK+R++L  M++SE  L++ E+ KPE++ATL+A++I
Sbjct: 61  HKKCRVTIYTARPGVVIGKKGADIEKLRQELQKMSSSETVLNIVEIRKPEVDATLVAENI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERR  FRRAMKRA+Q+AMR GA G++V  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRASFRRAMKRAMQTAMRMGALGIRVNCSGRLGGAEIARMEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDYG A A T YG+ GIKV++  + E+ D D    A+E R+VE  +
Sbjct: 181 DIDYGIATARTTYGAIGIKVWIF-KGEILDHDPM--ASERRLVESQT 224


>gi|144900890|emb|CAM77754.1| 30S ribosomal protein S3 [Magnetospirillum gryphiswaldense MSR-1]
          Length = 228

 Score =  286 bits (731), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 134/227 (59%), Positives = 173/227 (76%), Gaps = 5/227 (2%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI  RLG+N TW+SRWFA G +Y  +LHEDLK+R+YL+  L QAGV++++IER 
Sbjct: 1   MGQKVNPIGLRLGINRTWDSRWFADG-DYAKMLHEDLKLRDYLRKKLAQAGVSRVIIERP 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K  RI +++ARPG++IGKKG DIE +RK LS MT  E+HL++ E+ KPE++A L+A+SI
Sbjct: 60  AKKARITIHTARPGVVIGKKGADIEVLRKTLSKMTGGEVHLNIVEIRKPELDAQLVAESI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 120 AQQLERRVSFRRAMKRAVQSAMRLGAQGIRINCSGRLGGAEIARMEWYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDYG   A+T YG+CGIKV+V  + E+   D   P A+ +    +S
Sbjct: 180 DIDYGIGTAKTTYGTCGIKVWVF-KGEILAHD---PMAQDKRAAGES 222


>gi|254780255|ref|YP_003064668.1| 30S ribosomal protein S3 [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254039932|gb|ACT56728.1| 30S ribosomal protein S3 [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 227

 Score =  286 bits (731), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 227/227 (100%), Positives = 227/227 (100%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT
Sbjct: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI
Sbjct: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA
Sbjct: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
           HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS
Sbjct: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227


>gi|39936307|ref|NP_948583.1| 30S ribosomal protein S3 [Rhodopseudomonas palustris CGA009]
 gi|316933533|ref|YP_004108515.1| 30S ribosomal protein S3 [Rhodopseudomonas palustris DX-1]
 gi|61215590|sp|Q6N4U0|RS3_RHOPA RecName: Full=30S ribosomal protein S3; AltName: Full=RRP-S3
 gi|39650162|emb|CAE28685.1| 30S ribosomal protein S3 [Rhodopseudomonas palustris CGA009]
 gi|315601247|gb|ADU43782.1| ribosomal protein S3 [Rhodopseudomonas palustris DX-1]
          Length = 235

 Score =  286 bits (731), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 135/226 (59%), Positives = 181/226 (80%), Gaps = 4/226 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI  RLG+N TW+SRWFA  +EYG LLHED+KIRE L   LKQA VA+I+IER 
Sbjct: 1   MGQKINPIGLRLGINRTWDSRWFAGKNEYGKLLHEDVKIREILHKELKQAAVARIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ ++SARPG++IGKKG DI+K+RKK++++T+S++ +++ E+ KPE++ATL+A+SI
Sbjct: 61  HKKCRVTIHSARPGVVIGKKGADIDKLRKKVADITSSDVVINIVEIRKPELDATLVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA+G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAEGIRINCSGRLGGAEIARMEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            IDYG A A T +G+CG+KV++  + E+ + D   P A+ + + + 
Sbjct: 181 DIDYGVATAFTTFGTCGVKVWIF-KGEILEHD---PMAQDKRMAEG 222


>gi|192292031|ref|YP_001992636.1| 30S ribosomal protein S3 [Rhodopseudomonas palustris TIE-1]
 gi|226697751|sp|B3QBX4|RS3_RHOPT RecName: Full=30S ribosomal protein S3
 gi|192285780|gb|ACF02161.1| ribosomal protein S3 [Rhodopseudomonas palustris TIE-1]
          Length = 235

 Score =  285 bits (730), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 135/226 (59%), Positives = 181/226 (80%), Gaps = 4/226 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI  RLG+N TW+SRWFA  +EYG LLHED+KIRE L   LKQA VA+I+IER 
Sbjct: 1   MGQKINPIGLRLGINRTWDSRWFAGKNEYGKLLHEDVKIREILHKELKQAAVARIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ ++SARPG++IGKKG DI+K+RKK++++T+S++ +++ E+ KPE++ATL+A+SI
Sbjct: 61  HKKCRVTIHSARPGVVIGKKGADIDKLRKKVADITSSDVVINIVEIRKPELDATLVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA+G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAEGIRINCSGRLGGAEIARMEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            IDYG A A T +G+CG+KV++  + E+ + D   P A+ + + + 
Sbjct: 181 DIDYGVATAFTTFGTCGVKVWIF-KGEILEHD---PMAQDKRMAES 222


>gi|23502104|ref|NP_698231.1| 30S ribosomal protein S3 [Brucella suis 1330]
 gi|62290138|ref|YP_221931.1| 30S ribosomal protein S3 [Brucella abortus bv. 1 str. 9-941]
 gi|82700061|ref|YP_414635.1| 30S ribosomal protein S3 [Brucella melitensis biovar Abortus 2308]
 gi|148559744|ref|YP_001259147.1| 30S ribosomal protein S3 [Brucella ovis ATCC 25840]
 gi|189024376|ref|YP_001935144.1| Ribosomal protein S3 [Brucella abortus S19]
 gi|225627697|ref|ZP_03785734.1| ribosomal protein S3 [Brucella ceti str. Cudo]
 gi|237815646|ref|ZP_04594643.1| ribosomal protein S3 [Brucella abortus str. 2308 A]
 gi|254689447|ref|ZP_05152701.1| 30S ribosomal protein S3 [Brucella abortus bv. 6 str. 870]
 gi|254693932|ref|ZP_05155760.1| 30S ribosomal protein S3 [Brucella abortus bv. 3 str. Tulya]
 gi|254697582|ref|ZP_05159410.1| 30S ribosomal protein S3 [Brucella abortus bv. 2 str. 86/8/59]
 gi|254701968|ref|ZP_05163796.1| 30S ribosomal protein S3 [Brucella suis bv. 5 str. 513]
 gi|254710298|ref|ZP_05172109.1| 30S ribosomal protein S3 [Brucella pinnipedialis B2/94]
 gi|254714295|ref|ZP_05176106.1| 30S ribosomal protein S3 [Brucella ceti M644/93/1]
 gi|254717732|ref|ZP_05179543.1| 30S ribosomal protein S3 [Brucella ceti M13/05/1]
 gi|254719285|ref|ZP_05181096.1| 30S ribosomal protein S3 [Brucella sp. 83/13]
 gi|254730476|ref|ZP_05189054.1| 30S ribosomal protein S3 [Brucella abortus bv. 4 str. 292]
 gi|256031792|ref|ZP_05445406.1| 30S ribosomal protein S3 [Brucella pinnipedialis M292/94/1]
 gi|256061307|ref|ZP_05451457.1| 30S ribosomal protein S3 [Brucella neotomae 5K33]
 gi|256159962|ref|ZP_05457680.1| 30S ribosomal protein S3 [Brucella ceti M490/95/1]
 gi|256255193|ref|ZP_05460729.1| 30S ribosomal protein S3 [Brucella ceti B1/94]
 gi|256257693|ref|ZP_05463229.1| 30S ribosomal protein S3 [Brucella abortus bv. 9 str. C68]
 gi|256369651|ref|YP_003107161.1| 30S ribosomal protein S3 [Brucella microti CCM 4915]
 gi|260168926|ref|ZP_05755737.1| 30S ribosomal protein S3 [Brucella sp. F5/99]
 gi|260546686|ref|ZP_05822425.1| ribosomal protein S3 [Brucella abortus NCTC 8038]
 gi|260754970|ref|ZP_05867318.1| 30S ribosomal protein S3 [Brucella abortus bv. 6 str. 870]
 gi|260758186|ref|ZP_05870534.1| 30S ribosomal protein S3 [Brucella abortus bv. 4 str. 292]
 gi|260762012|ref|ZP_05874355.1| 30S ribosomal protein S3 [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883979|ref|ZP_05895593.1| 30S ribosomal protein S3 [Brucella abortus bv. 9 str. C68]
 gi|261214224|ref|ZP_05928505.1| 30S ribosomal protein S3 [Brucella abortus bv. 3 str. Tulya]
 gi|261219575|ref|ZP_05933856.1| 30S ribosomal protein S3 [Brucella ceti M13/05/1]
 gi|261222389|ref|ZP_05936670.1| 30S ribosomal protein S3 [Brucella ceti B1/94]
 gi|261317861|ref|ZP_05957058.1| 30S ribosomal protein S3 [Brucella pinnipedialis B2/94]
 gi|261322070|ref|ZP_05961267.1| 30S ribosomal protein S3 [Brucella ceti M644/93/1]
 gi|261325314|ref|ZP_05964511.1| 30S ribosomal protein S3 [Brucella neotomae 5K33]
 gi|261752536|ref|ZP_05996245.1| 30S ribosomal protein S3 [Brucella suis bv. 5 str. 513]
 gi|261758419|ref|ZP_06002128.1| ribosomal protein S3 [Brucella sp. F5/99]
 gi|265984285|ref|ZP_06097020.1| 30S ribosomal protein S3 [Brucella sp. 83/13]
 gi|265988890|ref|ZP_06101447.1| 30S ribosomal protein S3 [Brucella pinnipedialis M292/94/1]
 gi|265998354|ref|ZP_06110911.1| 30S ribosomal protein S3 [Brucella ceti M490/95/1]
 gi|297248533|ref|ZP_06932251.1| 30S ribosomal protein S3 [Brucella abortus bv. 5 str. B3196]
 gi|306838037|ref|ZP_07470895.1| ribosomal protein S3 [Brucella sp. NF 2653]
 gi|306840307|ref|ZP_07473079.1| ribosomal protein S3 [Brucella sp. BO2]
 gi|306844131|ref|ZP_07476725.1| ribosomal protein S3 [Brucella sp. BO1]
 gi|27734491|sp|P59180|RS3_BRUSU RecName: Full=30S ribosomal protein S3
 gi|75505262|sp|Q57CR4|RS3_BRUAB RecName: Full=30S ribosomal protein S3
 gi|91207642|sp|Q2YRA1|RS3_BRUA2 RecName: Full=30S ribosomal protein S3
 gi|189044955|sp|A5VR00|RS3_BRUO2 RecName: Full=30S ribosomal protein S3
 gi|226697671|sp|B2S673|RS3_BRUA1 RecName: Full=30S ribosomal protein S3
 gi|23348064|gb|AAN30146.1| ribosomal protein S3 [Brucella suis 1330]
 gi|62196270|gb|AAX74570.1| RpsC, ribosomal protein S3 [Brucella abortus bv. 1 str. 9-941]
 gi|82616162|emb|CAJ11205.1| Ribosomal protein S3:Type 2 KH domain:KH domain:Bacterial ribosomal
           protein S3 [Brucella melitensis biovar Abortus 2308]
 gi|148371001|gb|ABQ60980.1| ribosomal protein S3 [Brucella ovis ATCC 25840]
 gi|189019948|gb|ACD72670.1| Ribosomal protein S3 [Brucella abortus S19]
 gi|225617702|gb|EEH14747.1| ribosomal protein S3 [Brucella ceti str. Cudo]
 gi|237788944|gb|EEP63155.1| ribosomal protein S3 [Brucella abortus str. 2308 A]
 gi|255999813|gb|ACU48212.1| 30S ribosomal protein S3 [Brucella microti CCM 4915]
 gi|260095736|gb|EEW79613.1| ribosomal protein S3 [Brucella abortus NCTC 8038]
 gi|260668504|gb|EEX55444.1| 30S ribosomal protein S3 [Brucella abortus bv. 4 str. 292]
 gi|260672444|gb|EEX59265.1| 30S ribosomal protein S3 [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675078|gb|EEX61899.1| 30S ribosomal protein S3 [Brucella abortus bv. 6 str. 870]
 gi|260873507|gb|EEX80576.1| 30S ribosomal protein S3 [Brucella abortus bv. 9 str. C68]
 gi|260915831|gb|EEX82692.1| 30S ribosomal protein S3 [Brucella abortus bv. 3 str. Tulya]
 gi|260920973|gb|EEX87626.1| 30S ribosomal protein S3 [Brucella ceti B1/94]
 gi|260924664|gb|EEX91232.1| 30S ribosomal protein S3 [Brucella ceti M13/05/1]
 gi|261294760|gb|EEX98256.1| 30S ribosomal protein S3 [Brucella ceti M644/93/1]
 gi|261297084|gb|EEY00581.1| 30S ribosomal protein S3 [Brucella pinnipedialis B2/94]
 gi|261301294|gb|EEY04791.1| 30S ribosomal protein S3 [Brucella neotomae 5K33]
 gi|261738403|gb|EEY26399.1| ribosomal protein S3 [Brucella sp. F5/99]
 gi|261742289|gb|EEY30215.1| 30S ribosomal protein S3 [Brucella suis bv. 5 str. 513]
 gi|262552822|gb|EEZ08812.1| 30S ribosomal protein S3 [Brucella ceti M490/95/1]
 gi|264661087|gb|EEZ31348.1| 30S ribosomal protein S3 [Brucella pinnipedialis M292/94/1]
 gi|264662877|gb|EEZ33138.1| 30S ribosomal protein S3 [Brucella sp. 83/13]
 gi|297175702|gb|EFH35049.1| 30S ribosomal protein S3 [Brucella abortus bv. 5 str. B3196]
 gi|306275574|gb|EFM57306.1| ribosomal protein S3 [Brucella sp. BO1]
 gi|306289706|gb|EFM60895.1| ribosomal protein S3 [Brucella sp. BO2]
 gi|306406961|gb|EFM63182.1| ribosomal protein S3 [Brucella sp. NF 2653]
          Length = 236

 Score =  285 bits (729), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 150/227 (66%), Positives = 183/227 (80%), Gaps = 3/227 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI  RLG+N TW+SRW+A   EYG LLHED+KIRE+L   LKQA ++KI+IER 
Sbjct: 1   MGQKINPIGLRLGINRTWDSRWYANTGEYGKLLHEDVKIREFLTEELKQAAISKIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ ++SARPG+IIGKKG DIEK+RKKLS MTN++  L++ EV KPE++ATLIAQSI
Sbjct: 61  HKKCRVTIHSARPGIIIGKKGADIEKLRKKLSEMTNADTSLNIVEVRKPEVDATLIAQSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA+G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAEGIRINCSGRLGGAEIARMEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDYGTA A+TAYG CG+KV+V  + E+ + D    A+E R VE D+
Sbjct: 181 DIDYGTAEAKTAYGICGVKVWVF-KGEILEHDPM--ASERRAVEGDN 224


>gi|158424172|ref|YP_001525464.1| ribosomal protein S3 [Azorhizobium caulinodans ORS 571]
 gi|189044949|sp|A8IAR2|RS3_AZOC5 RecName: Full=30S ribosomal protein S3
 gi|158331061|dbj|BAF88546.1| ribosomal protein S3 [Azorhizobium caulinodans ORS 571]
          Length = 248

 Score =  285 bits (729), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 134/226 (59%), Positives = 178/226 (78%), Gaps = 3/226 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP+  RLG+N TW+SRWFA   +YG LLHED+KIR+ L   LKQA V+K++IER 
Sbjct: 1   MGQKVNPVGLRLGINRTWDSRWFANKGDYGTLLHEDIKIRQMLLKQLKQAAVSKVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ +YSARPG++IGKKG DI+K+RKK+++MT SE+ +++ E+ KPEI+A L+A+SI
Sbjct: 61  HKKCRVTIYSARPGVVIGKKGADIDKLRKKVADMTKSEVFINIVEIRKPEIDARLVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA+G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAEGIRINCSGRLGGAEIARLEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            +DYGTA A T YG+CG+KV++  + E+ + D    A + R+  + 
Sbjct: 181 DVDYGTATAFTTYGTCGVKVWIF-KGEILEHDPM--AVDKRMTAES 223


>gi|17987046|ref|NP_539680.1| 30S ribosomal protein S3 [Brucella melitensis bv. 1 str. 16M]
 gi|225852724|ref|YP_002732957.1| 30S ribosomal protein S3 [Brucella melitensis ATCC 23457]
 gi|256044877|ref|ZP_05447781.1| 30S ribosomal protein S3 [Brucella melitensis bv. 1 str. Rev.1]
 gi|256113781|ref|ZP_05454585.1| 30S ribosomal protein S3 [Brucella melitensis bv. 3 str. Ether]
 gi|256263786|ref|ZP_05466318.1| 30S ribosomal protein S3 [Brucella melitensis bv. 2 str. 63/9]
 gi|260565521|ref|ZP_05836005.1| 30S ribosomal protein S3 [Brucella melitensis bv. 1 str. 16M]
 gi|265991304|ref|ZP_06103861.1| 30S ribosomal protein S3 [Brucella melitensis bv. 1 str. Rev.1]
 gi|265995141|ref|ZP_06107698.1| 30S ribosomal protein S3 [Brucella melitensis bv. 3 str. Ether]
 gi|27734517|sp|Q8YHN4|RS3_BRUME RecName: Full=30S ribosomal protein S3
 gi|254764516|sp|C0RJJ5|RS3_BRUMB RecName: Full=30S ribosomal protein S3
 gi|17982702|gb|AAL51944.1| ssu ribosomal protein s3p [Brucella melitensis bv. 1 str. 16M]
 gi|225641089|gb|ACO01003.1| ribosomal protein S3 [Brucella melitensis ATCC 23457]
 gi|260151589|gb|EEW86683.1| 30S ribosomal protein S3 [Brucella melitensis bv. 1 str. 16M]
 gi|262766254|gb|EEZ12043.1| 30S ribosomal protein S3 [Brucella melitensis bv. 3 str. Ether]
 gi|263002088|gb|EEZ14663.1| 30S ribosomal protein S3 [Brucella melitensis bv. 1 str. Rev.1]
 gi|263093914|gb|EEZ17848.1| 30S ribosomal protein S3 [Brucella melitensis bv. 2 str. 63/9]
 gi|326409249|gb|ADZ66314.1| 30S ribosomal protein S3 [Brucella melitensis M28]
 gi|326538957|gb|ADZ87172.1| ribosomal protein S3 [Brucella melitensis M5-90]
          Length = 236

 Score =  285 bits (729), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 151/227 (66%), Positives = 183/227 (80%), Gaps = 3/227 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI  RLGVN TW+SRW+A   EYG LLHED+KIRE+L   LKQA ++KI+IER 
Sbjct: 1   MGQKINPIGLRLGVNRTWDSRWYANTGEYGKLLHEDVKIREFLTEELKQAAISKIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ ++SARPG+IIGKKG DIEK+RKKLS MTN++  L++ EV KPE++ATLIAQSI
Sbjct: 61  HKKCRVTIHSARPGIIIGKKGADIEKLRKKLSEMTNADTSLNIVEVRKPEVDATLIAQSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA+G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAEGIRINCSGRLGGAEIARMEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDYGTA A+TAYG CG+KV+V  + E+ + D    A+E R VE D+
Sbjct: 181 DIDYGTAEAKTAYGICGVKVWVF-KGEILEHDPM--ASERRAVEGDN 224


>gi|110634024|ref|YP_674232.1| 30S ribosomal protein S3 [Mesorhizobium sp. BNC1]
 gi|123162296|sp|Q11HQ8|RS3_MESSB RecName: Full=30S ribosomal protein S3
 gi|110285008|gb|ABG63067.1| SSU ribosomal protein S3P [Chelativorans sp. BNC1]
          Length = 235

 Score =  285 bits (729), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 147/224 (65%), Positives = 182/224 (81%), Gaps = 3/224 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI  RLG+N TW+SRWFA  +EYG LLHEDLKIR Y++  LKQA ++K++IER 
Sbjct: 1   MGQKVNPIGLRLGINRTWDSRWFANTNEYGQLLHEDLKIRTYIENELKQAAISKVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ ++SARPGLIIGKKG DIEK+R+K++ MTN+E HL++ EV KPEI+A LIAQSI
Sbjct: 61  HKKCRVTIHSARPGLIIGKKGADIEKLRRKITQMTNAETHLNIVEVRKPEIDARLIAQSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA+G+++  +GRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAEGIRINCTGRLGGAEIARIEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVE 224
            IDYGTA A+TAYG CG+KV+V  + E+ + D    A+E R VE
Sbjct: 181 DIDYGTAEAKTAYGVCGVKVWVF-KGEILEHDPM--ASERRAVE 221


>gi|153009292|ref|YP_001370507.1| 30S ribosomal protein S3 [Ochrobactrum anthropi ATCC 49188]
 gi|239832116|ref|ZP_04680445.1| ribosomal protein S3 [Ochrobactrum intermedium LMG 3301]
 gi|189045024|sp|A6X0C4|RS3_OCHA4 RecName: Full=30S ribosomal protein S3
 gi|151561180|gb|ABS14678.1| ribosomal protein S3 [Ochrobactrum anthropi ATCC 49188]
 gi|239824383|gb|EEQ95951.1| ribosomal protein S3 [Ochrobactrum intermedium LMG 3301]
          Length = 236

 Score =  285 bits (729), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 151/227 (66%), Positives = 183/227 (80%), Gaps = 3/227 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI  RLG+N TW+SRW+A   EYG LLHED+KIRE+L   LKQA ++KI+IER 
Sbjct: 1   MGQKINPIGLRLGINRTWDSRWYANTGEYGKLLHEDVKIREFLTEELKQAAISKIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ ++SARPG+IIGKKG DIEK+RKKLS MTN++  L++ EV KPEI+ATLIAQSI
Sbjct: 61  HKKCRVTIHSARPGIIIGKKGADIEKLRKKLSEMTNADTSLNIVEVRKPEIDATLIAQSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA+G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAEGIRINCSGRLGGAEIARMEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDYGTA A+TAYG CG+KV+V  + E+ + D    A+E R VE D+
Sbjct: 181 DIDYGTAEAKTAYGICGVKVWVF-KGEILEHDPM--ASERRAVEGDN 224


>gi|146340063|ref|YP_001205111.1| 30S ribosomal protein S3 [Bradyrhizobium sp. ORS278]
 gi|152060849|sp|A4YSJ8|RS3_BRASO RecName: Full=30S ribosomal protein S3
 gi|146192869|emb|CAL76874.1| 30S ribosomal subunit protein S3 [Bradyrhizobium sp. ORS278]
          Length = 236

 Score =  285 bits (729), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 134/226 (59%), Positives = 181/226 (80%), Gaps = 4/226 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI  RLG+N TW+SRWFA  +EYG LLHED+KIRE L   LKQA VA+I+IER 
Sbjct: 1   MGQKINPIGLRLGINRTWDSRWFAGKAEYGKLLHEDVKIREILHKELKQAAVARIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ ++SARPG++IGKKG DI+K+RK+++++T+S++ +++ E+ KPE++ATL+A+SI
Sbjct: 61  HKKCRVTIHSARPGVVIGKKGADIDKLRKRVADITSSDVVINIVEIRKPELDATLVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA+G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAEGIRINCSGRLGGAEIARMEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            IDYG A A T +G+CG+KV++  + E+ + D   P A+ + + + 
Sbjct: 181 DIDYGVATAFTTFGTCGVKVWIF-KGEILEHD---PMAQDKRMNEG 222


>gi|258542033|ref|YP_003187466.1| 30S ribosomal protein S3 [Acetobacter pasteurianus IFO 3283-01]
 gi|329114212|ref|ZP_08242974.1| 30S ribosomal protein S3 [Acetobacter pomorum DM001]
 gi|256633111|dbj|BAH99086.1| SSU ribosomal protein S3P [Acetobacter pasteurianus IFO 3283-01]
 gi|256636168|dbj|BAI02137.1| SSU ribosomal protein S3P [Acetobacter pasteurianus IFO 3283-03]
 gi|256639223|dbj|BAI05185.1| SSU ribosomal protein S3P [Acetobacter pasteurianus IFO 3283-07]
 gi|256642277|dbj|BAI08232.1| SSU ribosomal protein S3P [Acetobacter pasteurianus IFO 3283-22]
 gi|256645332|dbj|BAI11280.1| SSU ribosomal protein S3P [Acetobacter pasteurianus IFO 3283-26]
 gi|256648387|dbj|BAI14328.1| SSU ribosomal protein S3P [Acetobacter pasteurianus IFO 3283-32]
 gi|256651440|dbj|BAI17374.1| SSU ribosomal protein S3P [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256654431|dbj|BAI20358.1| SSU ribosomal protein S3P [Acetobacter pasteurianus IFO 3283-12]
 gi|326696288|gb|EGE47967.1| 30S ribosomal protein S3 [Acetobacter pomorum DM001]
          Length = 225

 Score =  284 bits (728), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 127/227 (55%), Positives = 172/227 (75%), Gaps = 5/227 (2%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K+NPI  RLG+N TW+SRW+A   +Y  LLHEDLK+R +L+  L  AGV++++IER 
Sbjct: 1   MGHKVNPIGLRLGINRTWDSRWYADS-DYSKLLHEDLKLRAFLRRKLVGAGVSRVVIERP 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K  R+ +Y+ARPG++IGKKG DI+ +RK+L+ M  +E+ L++ E+ KPEI+ATL+A++I
Sbjct: 60  AKKPRVTIYAARPGVVIGKKGQDIDALRKELTRMAGTEVALNIVEIRKPEIDATLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 120 AQQLERRVAFRRAMKRAVQSAMRLGAQGIRINCSGRLGGAEIARIEWYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDYGTA A+T YG+CG+KV++  + E+   D   P A+ R   + +
Sbjct: 180 DIDYGTATAKTTYGTCGVKVWIF-KGEILAHD---PMAQDRRAAEQA 222


>gi|84685423|ref|ZP_01013321.1| 30S ribosomal protein S3 [Maritimibacter alkaliphilus HTCC2654]
 gi|84666580|gb|EAQ13052.1| 30S ribosomal protein S3 [Rhodobacterales bacterium HTCC2654]
          Length = 235

 Score =  284 bits (727), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 133/225 (59%), Positives = 175/225 (77%), Gaps = 4/225 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI  RL VN TW+SRW+A  +EYG LL EDLKIRE+++   KQAGV++++IER 
Sbjct: 1   MGQKVNPIGMRLQVNRTWDSRWYADTNEYGDLLLEDLKIREFIKEECKQAGVSRVIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ +++ARPG+IIGKKG DIE +RKKL+ MT+SE+HL++ EV KPE++A L+A+SI
Sbjct: 61  HKKCRVTIHTARPGVIIGKKGADIEVLRKKLAKMTDSELHLNIVEVRKPELDAQLVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRA Q++MR GA G++V  +GRL GAE++RTE   EGRVPL TLRA
Sbjct: 121 AQQLERRVSFRRAMKRAAQNSMRMGALGIRVNCAGRLGGAEIARTEWLREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDY  A A+T YG  GIKV++  + E+ + D   P+A  R  ++
Sbjct: 181 DIDYALAEAKTPYGIIGIKVWIF-KGEIMEHD---PSARDRKQQE 221


>gi|294852564|ref|ZP_06793237.1| 30S ribosomal protein S3 [Brucella sp. NVSL 07-0026]
 gi|294821153|gb|EFG38152.1| 30S ribosomal protein S3 [Brucella sp. NVSL 07-0026]
          Length = 236

 Score =  284 bits (727), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 151/227 (66%), Positives = 184/227 (81%), Gaps = 3/227 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI  RLG+N TW+SRW+A   EYG LLHED+KIRE+L   LKQA ++KI+IER 
Sbjct: 1   MGQKINPIGLRLGINRTWDSRWYANTGEYGKLLHEDVKIREFLTEELKQAAISKIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ ++SARPG+IIGKKG DIEK+RKKLS MTN++  L++ EV KPE++ATLIAQSI
Sbjct: 61  HKKCRVTIHSARPGIIIGKKGADIEKLRKKLSEMTNADTSLNIVEVRKPEVDATLIAQSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA+G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAEGIRINCSGRLGGAEIARMEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDYGTA A+TAYG CG+KV+V  + E+ + DS   A+E R VE D+
Sbjct: 181 DIDYGTAEAKTAYGICGVKVWVF-KGEILEHDSM--ASERRAVEGDN 224


>gi|148256386|ref|YP_001240971.1| 30S ribosomal protein S3 [Bradyrhizobium sp. BTAi1]
 gi|189044953|sp|A5ELM1|RS3_BRASB RecName: Full=30S ribosomal protein S3
 gi|146408559|gb|ABQ37065.1| SSU ribosomal protein S3P [Bradyrhizobium sp. BTAi1]
          Length = 236

 Score =  284 bits (727), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 134/226 (59%), Positives = 181/226 (80%), Gaps = 4/226 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI  RLG+N TW+SRWFA  +EYG LLHED+KIRE L   LKQA VA+I+IER 
Sbjct: 1   MGQKINPIGLRLGINRTWDSRWFAGKAEYGKLLHEDVKIREILHKELKQAAVARIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ ++SARPG++IGKKG DI+K+RK+++++T+S++ +++ E+ KPE++ATL+A+SI
Sbjct: 61  HKKCRVTIHSARPGVVIGKKGADIDKLRKRVADITSSDVVINIVEIRKPELDATLVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA+G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAEGIRINCSGRLGGAEIARMEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            IDYG A A T +G+CG+KV++  + E+ + D   P A+ + + + 
Sbjct: 181 DIDYGVATAFTTFGTCGVKVWIF-KGEILEHD---PMAQDKRMNEG 222


>gi|254706592|ref|ZP_05168420.1| 30S ribosomal protein S3 [Brucella pinnipedialis M163/99/10]
 gi|261314051|ref|ZP_05953248.1| 30S ribosomal protein S3 [Brucella pinnipedialis M163/99/10]
 gi|261303077|gb|EEY06574.1| 30S ribosomal protein S3 [Brucella pinnipedialis M163/99/10]
          Length = 236

 Score =  284 bits (727), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 149/227 (65%), Positives = 182/227 (80%), Gaps = 3/227 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI  RLG+N TW+SRW+A   EYG LLHED+KIRE+L   LKQA ++KI+IER 
Sbjct: 1   MGQKINPIGLRLGINRTWDSRWYANTGEYGKLLHEDVKIREFLTEELKQAAISKIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ ++SARPG+IIGKKG DIEK+RKKLS MTN++  L++ EV KPE++ATLIAQSI
Sbjct: 61  HKKCRVTIHSARPGIIIGKKGADIEKLRKKLSEMTNADTSLNIVEVRKPEVDATLIAQSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA+G+++  SGRL G E++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAEGIRINCSGRLGGTEIARMEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDYGTA A+TAYG CG+KV+V  + E+ + D    A+E R VE D+
Sbjct: 181 DIDYGTAEAKTAYGICGVKVWVF-KGEILEHDPM--ASERRAVEGDN 224


>gi|56695401|ref|YP_165749.1| 30S ribosomal protein S3 [Ruegeria pomeroyi DSS-3]
 gi|62287190|sp|Q5LW56|RS3_SILPO RecName: Full=30S ribosomal protein S3
 gi|56677138|gb|AAV93804.1| ribosomal protein S3 [Ruegeria pomeroyi DSS-3]
          Length = 235

 Score =  284 bits (726), Expect = 7e-75,   Method: Composition-based stats.
 Identities = 134/225 (59%), Positives = 173/225 (76%), Gaps = 4/225 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K+NPI  RL VN TW+SRW+A   +YG LL EDL IRE+++   KQAGVA+++IER 
Sbjct: 1   MGHKVNPIGMRLQVNRTWDSRWYADTKDYGNLLLEDLAIREFIKEECKQAGVARVIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ +++ARPG+IIGKKG DIE +RKKL+NMT+SE+HL++ EV KPE++A L+A+SI
Sbjct: 61  HKKCRVTIHTARPGVIIGKKGADIETLRKKLANMTDSELHLNIVEVRKPEMDAQLVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQ++MR GA G++V  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVSFRRAMKRAVQNSMRMGALGIRVNVAGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDY  A A T YG  GIKV++  + E+ + D   P A  R  ++
Sbjct: 181 DIDYALAEASTPYGIIGIKVWIF-KGEILEHD---PQARDRKAQE 221


>gi|23014082|ref|ZP_00053919.1| COG0092: Ribosomal protein S3 [Magnetospirillum magnetotacticum
           MS-1]
          Length = 227

 Score =  284 bits (726), Expect = 7e-75,   Method: Composition-based stats.
 Identities = 130/227 (57%), Positives = 171/227 (75%), Gaps = 5/227 (2%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI  R+G+N TW+SRWFA    Y  LLH+DLK+R+YL+  L QAGV++++IER 
Sbjct: 1   MGQKVNPIGLRVGINRTWDSRWFAD-ENYAKLLHQDLKLRKYLRDKLAQAGVSRVVIERP 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K  RI +++ARPG++IGKKG DIE +RK+LS MT  E+HL++ E+ KPE++A L+A+SI
Sbjct: 60  AKKARITIHTARPGVVIGKKGADIEVLRKELSKMTGGEVHLNIVEIRKPELDAQLVAESI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 120 AQQLERRVAFRRAMKRAVQSAMRLGAQGIRINCSGRLGGAEIARMEWYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            +DYG   A T YGSCG+KV+V  + E+   D   P A+ +    ++
Sbjct: 180 DVDYGVGTAHTTYGSCGVKVWVF-KGEILAHD---PMAQDKRAAGET 222


>gi|86749421|ref|YP_485917.1| 30S ribosomal protein S3 [Rhodopseudomonas palustris HaA2]
 gi|123408226|sp|Q2IXQ4|RS3_RHOP2 RecName: Full=30S ribosomal protein S3
 gi|86572449|gb|ABD07006.1| SSU ribosomal protein S3P [Rhodopseudomonas palustris HaA2]
          Length = 232

 Score =  284 bits (726), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 137/227 (60%), Positives = 181/227 (79%), Gaps = 3/227 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI  RLG+N TW+SRWFA  +EYG LLHED+KIRE L   LKQA VA+I+IER 
Sbjct: 1   MGQKINPIGLRLGINRTWDSRWFAGKNEYGKLLHEDVKIREILHKELKQAAVARIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ ++SARPG++IGKKG DI+K+RKK++++T S++ +++ E+ KPE++ATL+A+SI
Sbjct: 61  HKKCRVTIHSARPGVVIGKKGADIDKLRKKVADITASDVVINIVEIRKPELDATLVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA+G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAEGIRINCSGRLGGAEIARMEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDYG A A T +G+CG+KV++  + E+ + D    A + R+ E D+
Sbjct: 181 DIDYGVATAFTTFGTCGVKVWIF-KGEILEHDPM--AQDKRMAEGDN 224


>gi|163843493|ref|YP_001627897.1| 30S ribosomal protein S3 [Brucella suis ATCC 23445]
 gi|189044956|sp|B0CH26|RS3_BRUSI RecName: Full=30S ribosomal protein S3
 gi|163674216|gb|ABY38327.1| ribosomal protein S3 [Brucella suis ATCC 23445]
          Length = 236

 Score =  284 bits (726), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 149/227 (65%), Positives = 183/227 (80%), Gaps = 3/227 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI  RLG+N TW+SRW+A   EYG LLHED+KIRE+L   LKQA ++KI+IER 
Sbjct: 1   MGQKINPIGLRLGINRTWDSRWYANTGEYGKLLHEDVKIREFLTEELKQAAISKIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ ++SARPG+IIGKKG DIEK+RKKLS MTN++  L++ EV KPE++ATLIAQ+I
Sbjct: 61  HKKCRVTIHSARPGIIIGKKGADIEKLRKKLSEMTNADTSLNIVEVRKPEVDATLIAQTI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA+G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAEGIRINCSGRLGGAEIARMEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDYGTA A+TAYG CG+KV+V  + E+ + D    A+E R VE D+
Sbjct: 181 DIDYGTAEAKTAYGICGVKVWVF-KGEILEHDPM--ASERRAVEGDN 224


>gi|114704490|ref|ZP_01437398.1| 30S ribosomal protein S3 [Fulvimarina pelagi HTCC2506]
 gi|114539275|gb|EAU42395.1| 30S ribosomal protein S3 [Fulvimarina pelagi HTCC2506]
          Length = 235

 Score =  284 bits (726), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 148/223 (66%), Positives = 180/223 (80%), Gaps = 3/223 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP  FRLG+N TW+SRWFA G EYG+LLHEDLKIR +L   LKQA V+KI+IER 
Sbjct: 1   MGQKINPTGFRLGINRTWDSRWFADGREYGSLLHEDLKIRNFLLDELKQAAVSKIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CRI ++SARPG++IGKKG DIEK+RKKLS MT++E H+++ EV KPE +A L+AQSI
Sbjct: 61  HKKCRISIHSARPGIVIGKKGADIEKLRKKLSTMTDAETHINIVEVRKPETDAALVAQSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA+G+++   GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAEGIRINCGGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVV 223
            +DYGTA AETAYG CG+KV++  + E+ + D    A+E R V
Sbjct: 181 DVDYGTAEAETAYGICGVKVWIF-KGEILEHDPM--ASERRQV 220


>gi|161619183|ref|YP_001593070.1| 30S ribosomal protein S3 [Brucella canis ATCC 23365]
 gi|254704512|ref|ZP_05166340.1| 30S ribosomal protein S3 [Brucella suis bv. 3 str. 686]
 gi|260566244|ref|ZP_05836714.1| ribosomal protein S3 [Brucella suis bv. 4 str. 40]
 gi|261755195|ref|ZP_05998904.1| 30S ribosomal protein S3 [Brucella suis bv. 3 str. 686]
 gi|189044954|sp|A9M5P4|RS3_BRUC2 RecName: Full=30S ribosomal protein S3
 gi|161335994|gb|ABX62299.1| ribosomal protein S3 [Brucella canis ATCC 23365]
 gi|260155762|gb|EEW90842.1| ribosomal protein S3 [Brucella suis bv. 4 str. 40]
 gi|261744948|gb|EEY32874.1| 30S ribosomal protein S3 [Brucella suis bv. 3 str. 686]
          Length = 236

 Score =  283 bits (725), Expect = 9e-75,   Method: Composition-based stats.
 Identities = 149/227 (65%), Positives = 182/227 (80%), Gaps = 3/227 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI  RLG+N TW+SRW+A   EYG LLHED+KIRE+L   LKQA ++KI+IER 
Sbjct: 1   MGQKINPIGLRLGINRTWDSRWYANTGEYGKLLHEDVKIREFLTEELKQAAISKIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ ++SARPG+IIGKKG DIEK+RKKLS MTN++  L++ EV KPE++ATLIAQ I
Sbjct: 61  HKKCRVTIHSARPGIIIGKKGADIEKLRKKLSEMTNADTSLNIVEVRKPEVDATLIAQLI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA+G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAEGIRINCSGRLGGAEIARMEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDYGTA A+TAYG CG+KV+V  + E+ + D    A+E R VE D+
Sbjct: 181 DIDYGTAEAKTAYGICGVKVWVF-KGEILEHDPM--ASERRAVEGDN 224


>gi|85715125|ref|ZP_01046109.1| 30S ribosomal protein S3 [Nitrobacter sp. Nb-311A]
 gi|85698040|gb|EAQ35913.1| 30S ribosomal protein S3 [Nitrobacter sp. Nb-311A]
          Length = 231

 Score =  283 bits (725), Expect = 9e-75,   Method: Composition-based stats.
 Identities = 135/226 (59%), Positives = 181/226 (80%), Gaps = 4/226 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI  RLG+N TW+SRW+A  SEYG LLHED+KIRE L   LKQA VA+I+IER 
Sbjct: 1   MGQKINPIGLRLGINRTWDSRWYAGKSEYGRLLHEDVKIRELLHKELKQAAVARIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ ++SARPG++IGKKG DI+K+RK+++++T+S++ L++ E+ KPE++ATL+A+SI
Sbjct: 61  HKKCRVTIHSARPGVVIGKKGADIDKLRKRVADITSSDVVLNIVEIRKPELDATLVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA+G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAEGIRINCSGRLGGAEIARMEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            +DYG A A T +G+CG+KV++  + E+ + D   P A+ + +  D
Sbjct: 181 DVDYGVATAFTTFGTCGVKVWIF-KGEILEHD---PMAQDKRLAGD 222


>gi|90424931|ref|YP_533301.1| 30S ribosomal protein S3 [Rhodopseudomonas palustris BisB18]
 gi|123275055|sp|Q211F4|RS3_RHOPB RecName: Full=30S ribosomal protein S3
 gi|90106945|gb|ABD88982.1| SSU ribosomal protein S3P [Rhodopseudomonas palustris BisB18]
          Length = 232

 Score =  283 bits (725), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 136/227 (59%), Positives = 181/227 (79%), Gaps = 3/227 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI  RLG+N TW+SRW+A  +EYG LLHED+KIRE L   LKQA VA+I+IER 
Sbjct: 1   MGQKINPIGLRLGINRTWDSRWYAGKNEYGKLLHEDVKIREILHKELKQAAVARIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ ++SARPG++IGKKG DI+K+RKK++++T S++ +++ E+ KPE++ATL+A+SI
Sbjct: 61  HKKCRVTIHSARPGVVIGKKGADIDKLRKKVADITASDVVINIVEIRKPELDATLVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA+G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAEGIRINCSGRLGGAEIARMEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDYG A A T +G+CG+KV++  + E+ + D    A + R+ E D+
Sbjct: 181 DIDYGVATAFTTFGTCGVKVWIF-KGEILEHDPM--AQDKRMAEGDN 224


>gi|27380505|ref|NP_772034.1| 30S ribosomal protein S3 [Bradyrhizobium japonicum USDA 110]
 gi|34098364|sp|Q89J90|RS3_BRAJA RecName: Full=30S ribosomal protein S3
 gi|27353669|dbj|BAC50659.1| 30S ribosomal protein S3 [Bradyrhizobium japonicum USDA 110]
          Length = 241

 Score =  283 bits (724), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 134/226 (59%), Positives = 180/226 (79%), Gaps = 4/226 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI  RLG+N TW+SRWFA   EYG LLHED+KIRE L   LKQA VA+I+IER 
Sbjct: 1   MGQKINPIGLRLGINRTWDSRWFAGKQEYGKLLHEDVKIREILHKELKQAAVARIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ ++SARPG++IGKKG DI+K+RK+++++T+S++ +++ E+ KPE++ATL+A+SI
Sbjct: 61  HKKCRVTIHSARPGVVIGKKGADIDKLRKRVADITSSDVVINIVEIRKPELDATLVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA+G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAEGIRINCSGRLGGAEIARMEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            IDYG A A T +G+CG+KV++  + E+ + D   P A+ + + + 
Sbjct: 181 DIDYGVATAFTTFGTCGVKVWIF-KGEILEHD---PMAQDKRMAEG 222


>gi|13470557|ref|NP_102126.1| 30S ribosomal protein S3 [Mesorhizobium loti MAFF303099]
 gi|27734527|sp|Q98N51|RS3_RHILO RecName: Full=30S ribosomal protein S3
 gi|14021299|dbj|BAB47912.1| 30S ribosomal protein S3 [Mesorhizobium loti MAFF303099]
          Length = 241

 Score =  283 bits (724), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 146/224 (65%), Positives = 179/224 (79%), Gaps = 3/224 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI  RLG+N TW+SRWFA   EYG LLHED+KIR+YL+  LKQA ++K++IER 
Sbjct: 1   MGQKVNPIGLRLGINRTWDSRWFANTGEYGKLLHEDIKIRKYLEKELKQAAISKVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ +++ARPGLIIGKKG DIEK+RKKL  MT SE HL++ EV KPEI+ATL+AQSI
Sbjct: 61  HKKCRVTIHAARPGLIIGKKGADIEKLRKKLMEMTKSETHLNIVEVRKPEIDATLVAQSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERR+ FRRAMKRAVQSAMR GA+G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRIAFRRAMKRAVQSAMRLGAEGIRINCSGRLGGAEIARMEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVE 224
            +DYGTA A TAYG CG+KV+V  + E+ + D    A+E R  E
Sbjct: 181 DVDYGTAEANTAYGICGVKVWVF-KGEILEHDPM--ASERRATE 221


>gi|328543364|ref|YP_004303473.1| 30S ribosomal protein S3 [Polymorphum gilvum SL003B-26A1]
 gi|326413109|gb|ADZ70172.1| 30S ribosomal protein S3 [Polymorphum gilvum SL003B-26A1]
          Length = 242

 Score =  283 bits (724), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 138/227 (60%), Positives = 173/227 (76%), Gaps = 4/227 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K+NPI  RLG+N TW+SRW+A   EYG LLHED +IREYL   LKQA V+KI+IER 
Sbjct: 1   MGHKVNPIGMRLGINRTWDSRWYANKGEYGTLLHEDFRIREYLMNELKQAAVSKIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ ++S RPG++IGKKG DIE++RKKL  +T+SE+H+++ EV KPEI+A L+A SI
Sbjct: 61  HKKCRVTIHSGRPGVVIGKKGADIERLRKKLGQITSSEVHINIVEVRKPEIDANLVAASI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA G+++   GRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAQGIRINCGGRLGGAEIARVEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDYG A A TAYG+CG+KV++  + E+ + D   P A  R   + S
Sbjct: 181 DIDYGIATAHTAYGACGVKVWIF-KGEILEHD---PMASERRASEGS 223


>gi|254785085|ref|YP_003072513.1| 30S ribosomal protein S3 [Teredinibacter turnerae T7901]
 gi|237684180|gb|ACR11444.1| ribosomal protein S3 [Teredinibacter turnerae T7901]
          Length = 224

 Score =  283 bits (724), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 109/224 (48%), Positives = 155/224 (69%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+     S W+A   +Y   L+EDLK+R Y+Q  L  A V+++ IER 
Sbjct: 1   MGQKVHPTGIRLGIVKKHTSTWYASKGDYADKLNEDLKVRAYIQKVLSHASVSRVDIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IGKKG D+EK+R ++S      +H+++ E+ KP+++  L+AQS+
Sbjct: 61  ANTARVTIHTARPGIVIGKKGEDVEKLRAEISKQMGVPVHINIEEIRKPDLDGVLVAQSV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV+FRRAMKRAVQ+AMR GA+GVK+  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVMFRRAMKRAVQNAMRQGAEGVKIQVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVE 224
            IDY TA A T YG  G+KV++   + +   +    A + +  +
Sbjct: 181 DIDYATAEASTTYGIIGVKVWIFKGEIIGGLEEAESAPKKKGAK 224


>gi|237653990|ref|YP_002890304.1| 30S ribosomal protein S3 [Thauera sp. MZ1T]
 gi|237625237|gb|ACR01927.1| ribosomal protein S3 [Thauera sp. MZ1T]
          Length = 256

 Score =  283 bits (724), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 122/230 (53%), Positives = 169/230 (73%), Gaps = 3/230 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V   W SRWFA   +Y  +LHEDLK+R+YL+  L  A V +++IER 
Sbjct: 1   MGQKIHPTGFRLAVTRDWGSRWFANSKDYAGMLHEDLKVRDYLKKRLAHASVGRVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN R+ +YSARPG++IGKKG DIE +++ L  +    +H+++ EV KPE++A LIA SI
Sbjct: 61  AKNARVTLYSARPGVVIGKKGEDIEALKRDLQKIVGVPVHVNIEEVRKPELDAKLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLE+R++FRRAMKRA+Q+AMR GA G+K+++SGRLNGAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLEKRIMFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTI---PAAEHRVVEKDS 227
           +IDYG + A+T YG  GIKV+V   + +  ++  +   P A++R   + +
Sbjct: 181 NIDYGVSEAKTTYGVIGIKVWVFKGEMLGRNEQPVAAEPEADNRRGRRGA 230


>gi|90417759|ref|ZP_01225671.1| ribosomal protein S3 [Aurantimonas manganoxydans SI85-9A1]
 gi|90337431|gb|EAS51082.1| ribosomal protein S3 [Aurantimonas manganoxydans SI85-9A1]
          Length = 235

 Score =  283 bits (723), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 148/223 (66%), Positives = 179/223 (80%), Gaps = 3/223 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP  FRLG+N TW+SRW+A   EYG LLHEDLKIR YL   LKQA V+KI+IER 
Sbjct: 1   MGQKINPTGFRLGINRTWDSRWYANTGEYGHLLHEDLKIRAYLLNELKQAAVSKIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CRI ++SARPG++IGKKG DIEK+RKKL+ MTN+E H+++ EV KPE +ATL+AQSI
Sbjct: 61  HKKCRITIHSARPGIVIGKKGADIEKLRKKLAAMTNAETHINIVEVRKPETDATLVAQSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA+G+++   GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAEGIRINCGGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVV 223
            IDYGTA A+TAYG CG+KV++  + E+ + D    A+E R V
Sbjct: 181 DIDYGTAEAKTAYGICGVKVWIF-KGEILEHDPM--ASERRQV 220


>gi|323136092|ref|ZP_08071175.1| ribosomal protein S3 [Methylocystis sp. ATCC 49242]
 gi|322399183|gb|EFY01702.1| ribosomal protein S3 [Methylocystis sp. ATCC 49242]
          Length = 251

 Score =  283 bits (723), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 135/227 (59%), Positives = 171/227 (75%), Gaps = 4/227 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI  RLGVN TW+SRWFA   EY  LLHED+ IRE +   LKQA V+KI+IER 
Sbjct: 1   MGQKVNPIGLRLGVNRTWDSRWFASKGEYAKLLHEDMAIREAVMKLLKQAAVSKIIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ ++SARPG++IGKKG DI+KIRK +  +T SE+ +++ EV KPE  A L+A SI
Sbjct: 61  HKKCRVTIHSARPGVVIGKKGADIDKIRKLVGKLTGSEVVINIVEVRKPETEAALVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSA+R GA G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAIRLGAQGIRINCSGRLGGAEIARLEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            +DYGTA A TAYG+CGIKV++  + E+ + D   P A+ +   + +
Sbjct: 181 DVDYGTATAHTAYGACGIKVWIF-KGEILEHD---PMAQDKRAAEQA 223


>gi|91977646|ref|YP_570305.1| 30S ribosomal protein S3 [Rhodopseudomonas palustris BisB5]
 gi|115525579|ref|YP_782490.1| 30S ribosomal protein S3 [Rhodopseudomonas palustris BisA53]
 gi|122295414|sp|Q07KM4|RS3_RHOP5 RecName: Full=30S ribosomal protein S3
 gi|123735289|sp|Q134T5|RS3_RHOPS RecName: Full=30S ribosomal protein S3
 gi|91684102|gb|ABE40404.1| SSU ribosomal protein S3P [Rhodopseudomonas palustris BisB5]
 gi|115519526|gb|ABJ07510.1| SSU ribosomal protein S3P [Rhodopseudomonas palustris BisA53]
          Length = 232

 Score =  283 bits (723), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 136/227 (59%), Positives = 180/227 (79%), Gaps = 3/227 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI  RLG+N TW+SRWFA  +EYG LLHED+KIR  L   LKQA VA+I+IER 
Sbjct: 1   MGQKINPIGLRLGINRTWDSRWFAGKNEYGKLLHEDVKIRAILHKELKQAAVARIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ ++SARPG++IGKKG DI+K+RKK++++T S++ +++ E+ KPE++ATL+A+SI
Sbjct: 61  HKKCRVTIHSARPGVVIGKKGADIDKLRKKVADITASDVVINIVEIRKPELDATLVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA+G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAEGIRINCSGRLGGAEIARMEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDYG A A T +G+CG+KV++  + E+ + D    A + R+ E D+
Sbjct: 181 DIDYGVATAFTTFGTCGVKVWIF-KGEILEHDPM--AQDKRMAEGDN 224


>gi|75675562|ref|YP_317983.1| 30S ribosomal protein S3 [Nitrobacter winogradskyi Nb-255]
 gi|91207824|sp|Q3SSW0|RS3_NITWN RecName: Full=30S ribosomal protein S3
 gi|74420432|gb|ABA04631.1| SSU ribosomal protein S3P [Nitrobacter winogradskyi Nb-255]
          Length = 231

 Score =  282 bits (722), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 135/227 (59%), Positives = 180/227 (79%), Gaps = 3/227 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI  RLG+N TW+SRW+A  +EYG LLHED+KIRE L   LKQA VA+I+IER 
Sbjct: 1   MGQKINPIGLRLGINRTWDSRWYAGKAEYGRLLHEDVKIRELLHKELKQAAVARIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ ++SARPG++IGKKG DI+K+RK+++++T+S++ L++ E+ KPE++ATL+A+SI
Sbjct: 61  HKKCRVTIHSARPGVVIGKKGADIDKLRKRVADITSSDVVLNIVEIRKPELDATLVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA+G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAEGIRINCSGRLGGAEIARMEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            +DYG A A T +G+CG+KV++  + E+ + D    A + R    DS
Sbjct: 181 DVDYGVATAFTTFGTCGVKVWIF-KGEILEHDPM--AQDKRQAGDDS 224


>gi|329889135|ref|ZP_08267478.1| ribosomal protein S3 [Brevundimonas diminuta ATCC 11568]
 gi|328844436|gb|EGF94000.1| ribosomal protein S3 [Brevundimonas diminuta ATCC 11568]
          Length = 248

 Score =  282 bits (722), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 133/227 (58%), Positives = 173/227 (76%), Gaps = 4/227 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI  RLGVN TW+SRWFA G++Y  LLH+DLK+R +L+  L  AGV++I+IER 
Sbjct: 1   MGQKINPIGLRLGVNRTWDSRWFAGGADYAKLLHQDLKLRTWLKERLSAAGVSRIIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ +Y+ARPG++IGKKG DIEK+RK +S  T  E+HL++ EV KPE +A LIA++I
Sbjct: 61  HKKCRVTIYAARPGVVIGKKGADIEKLRKDISARTEGEVHLNIVEVRKPETDAQLIAENI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERR+ FRRAMKR++QSAMR GA GV++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRIAFRRAMKRSMQSAMRLGAKGVRINVSGRLGGAEIARMEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDYG   A+T YG  G+KV+V  + EV + D   P A+ +   +++
Sbjct: 181 DIDYGFYEAKTTYGIIGVKVWVF-KGEVLEHD---PMAQDKRWAQEA 223


>gi|260468548|ref|ZP_05813715.1| ribosomal protein S3 [Mesorhizobium opportunistum WSM2075]
 gi|259028704|gb|EEW30013.1| ribosomal protein S3 [Mesorhizobium opportunistum WSM2075]
          Length = 241

 Score =  282 bits (722), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 145/224 (64%), Positives = 179/224 (79%), Gaps = 3/224 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI  RLG+N TW+SRWFA   EYG LLHED+KIR+YL+  LKQA ++K++IER 
Sbjct: 1   MGQKVNPIGLRLGINRTWDSRWFANTGEYGKLLHEDIKIRKYLEKELKQAAISKVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ +++ARPGLIIGKKG DIEK+RKKL  MT SE HL++ EV KPEI+ATL+AQSI
Sbjct: 61  HKKCRVTIHAARPGLIIGKKGADIEKLRKKLMEMTKSETHLNIVEVRKPEIDATLVAQSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERR+ FRRAMKRAVQSAMR GA+G+++  +GRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRIAFRRAMKRAVQSAMRLGAEGIRINCAGRLGGAEIARMEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVE 224
            +DYGTA A TAYG CG+KV+V  + E+ + D    A+E R  E
Sbjct: 181 DVDYGTAEANTAYGICGVKVWVF-KGEILEHDPM--ASERRATE 221


>gi|118591178|ref|ZP_01548577.1| 30S ribosomal protein S3 [Stappia aggregata IAM 12614]
 gi|118436254|gb|EAV42896.1| 30S ribosomal protein S3 [Stappia aggregata IAM 12614]
          Length = 242

 Score =  282 bits (721), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 135/227 (59%), Positives = 172/227 (75%), Gaps = 1/227 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K NPI  RLG+N TW+SRW+A  +EYG LLHED +IRE L   LKQA V+K++IER 
Sbjct: 1   MGHKTNPIGMRLGINRTWDSRWYANKNEYGDLLHEDFRIRELLLKELKQAAVSKVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ ++S RPG++IGKKG DIE++RKK++++TNSE+HL++ EV KPEI+ATL+AQSI
Sbjct: 61  HKKCRVSIHSGRPGVVIGKKGADIERLRKKIADITNSEVHLNIVEVRKPEIDATLVAQSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA G+++   GRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAQGIRINCGGRLGGAEIARIEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDYG A A TAYG CG+KV++  + E+ + D            + +
Sbjct: 181 DIDYGVASAHTAYGVCGVKVWIF-KGEILEHDPMASERRATAASEGN 226


>gi|182678343|ref|YP_001832489.1| ribosomal protein S3 [Beijerinckia indica subsp. indica ATCC 9039]
 gi|226697664|sp|B2IK68|RS3_BEII9 RecName: Full=30S ribosomal protein S3
 gi|182634226|gb|ACB95000.1| ribosomal protein S3 [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 241

 Score =  282 bits (721), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 138/225 (61%), Positives = 178/225 (79%), Gaps = 4/225 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI  RLG+N TW+SRWFA   EY  LLHED++IRE L  +LKQA V+KI+IER 
Sbjct: 1   MGQKVNPIGLRLGINRTWDSRWFANKGEYSKLLHEDMRIREVLMKNLKQAAVSKIIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ ++SARPG++IGKKG DI+KIRK +S +T+SE+ +++ EV KPEI+ATL+A SI
Sbjct: 61  HKKCRVTIHSARPGVVIGKKGADIDKIRKLVSKLTDSEVVINIVEVRKPEIDATLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSA+R GA+G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAIRLGAEGIRINCSGRLGGAEIARLEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            +DYG A A TAYG+CGIKV++  + E+ + D   P A+ R + +
Sbjct: 181 DVDYGVATAHTAYGTCGIKVWIF-KGEILEHD---PMAQDRKMAE 221


>gi|83312223|ref|YP_422487.1| 30S ribosomal protein S3 [Magnetospirillum magneticum AMB-1]
 gi|123726906|sp|Q2W2J7|RS3_MAGMM RecName: Full=30S ribosomal protein S3
 gi|82947064|dbj|BAE51928.1| Ribosomal protein S3 [Magnetospirillum magneticum AMB-1]
          Length = 227

 Score =  282 bits (721), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 131/227 (57%), Positives = 172/227 (75%), Gaps = 5/227 (2%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI  R+G+N TW+SRWFA    Y  LLH+DLK+R+YL+  L QAGV++++IER 
Sbjct: 1   MGQKVNPIGLRVGINRTWDSRWFAD-ETYAKLLHQDLKLRKYLREKLAQAGVSRVVIERP 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K  RI +++ARPG++IGKKG DIE +RK+LS MT SE+HL++ E+ KPE++A L+A+SI
Sbjct: 60  AKKARITIHTARPGVVIGKKGADIEVLRKELSKMTGSEVHLNIVEIRKPELDAQLVAESI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 120 AQQLERRVAFRRAMKRAVQSAMRLGAQGIRINCSGRLGGAEIARMEWYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            +DYG   A T YGSCG+KV+V  + E+   D   P A+ +    ++
Sbjct: 180 DVDYGVGTAHTTYGSCGVKVWVF-KGEILAHD---PMAQDKRAAGET 222


>gi|197104702|ref|YP_002130079.1| 30S ribosomal protein S3 [Phenylobacterium zucineum HLK1]
 gi|226697742|sp|B4R8M3|RS3_PHEZH RecName: Full=30S ribosomal protein S3
 gi|196478122|gb|ACG77650.1| 30S ribosomal protein S3 [Phenylobacterium zucineum HLK1]
          Length = 253

 Score =  282 bits (721), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 136/227 (59%), Positives = 174/227 (76%), Gaps = 4/227 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP+  RLG+N TW+SRWFA G EYG LLHED+K+R  L+  L QAGV++I+IER 
Sbjct: 1   MGQKINPVGLRLGINRTWDSRWFADGPEYGRLLHEDIKVRRALKKRLYQAGVSRIIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CRI +Y+ARPG+IIGKKG DIEK+RK ++ MT+ E+HL++ E+ KPE +A LIA++I
Sbjct: 61  HKKCRITIYAARPGVIIGKKGADIEKLRKDVAAMTDGEVHLNIVEIRKPETDAQLIAENI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKR++QSAMR GA GV++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRSMQSAMRLGAKGVRINVSGRLGGAEIARMEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            +DYG   A+T YG  G+KV+V  + EV + D   P A  + +  +S
Sbjct: 181 DVDYGFTEAKTTYGVIGVKVWVF-KGEVLEHD---PMALDKRLAGES 223


>gi|254512172|ref|ZP_05124239.1| ribosomal protein S3 [Rhodobacteraceae bacterium KLH11]
 gi|221535883|gb|EEE38871.1| ribosomal protein S3 [Rhodobacteraceae bacterium KLH11]
          Length = 236

 Score =  282 bits (721), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 134/225 (59%), Positives = 172/225 (76%), Gaps = 4/225 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K+NPI  RL VN TW+SRW+A   +YG LL EDLKIRE++    KQAGVA+++IER 
Sbjct: 1   MGHKVNPIGMRLQVNRTWDSRWYADTKDYGDLLLEDLKIREFINKECKQAGVARVIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ +++ARPG+IIGKKG DIE +RKKL+ MT+SE+HL++ EV KPE++A L+A+SI
Sbjct: 61  HKKCRVTIHTARPGVIIGKKGADIEVLRKKLARMTDSELHLNIVEVRKPELDAQLVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKR+VQ+AMR GA G++V  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVSFRRAMKRSVQNAMRMGALGIRVNVAGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDY  A A T YG  GIKV++  + E+ + D   P A  R  ++
Sbjct: 181 DIDYAHAEAMTPYGIIGIKVWIF-KGEIMEHD---PQARDRKAQE 221


>gi|260432436|ref|ZP_05786407.1| ribosomal protein S3 [Silicibacter lacuscaerulensis ITI-1157]
 gi|260416264|gb|EEX09523.1| ribosomal protein S3 [Silicibacter lacuscaerulensis ITI-1157]
          Length = 236

 Score =  282 bits (721), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 134/225 (59%), Positives = 173/225 (76%), Gaps = 4/225 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K+NPI  RL VN TW+SRW+A   +YG LL EDLKIRE+++   KQAGVA+++IER 
Sbjct: 1   MGHKVNPIGMRLQVNRTWDSRWYADTKDYGDLLLEDLKIREFIKKECKQAGVARVIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ +++ARPG+IIGKKG DIE +RKKL+ MT+SE+HL++ EV KPE++A L+A+SI
Sbjct: 61  HKKCRVTIHTARPGVIIGKKGADIEVLRKKLAAMTDSELHLNIVEVRKPELDAQLVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKR+VQ+AMR GA G++V  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVSFRRAMKRSVQNAMRMGALGIRVNVAGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDY  A A T YG  GIKV++  + E+ + D   P A  R  ++
Sbjct: 181 DIDYAHAEAMTPYGIIGIKVWIF-KGEIMEHD---PQARDRKAQE 221


>gi|296447536|ref|ZP_06889458.1| ribosomal protein S3 [Methylosinus trichosporium OB3b]
 gi|296254924|gb|EFH02029.1| ribosomal protein S3 [Methylosinus trichosporium OB3b]
          Length = 247

 Score =  281 bits (720), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 135/227 (59%), Positives = 173/227 (76%), Gaps = 4/227 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI  RLGVN TW+SRWFA   EY  LLHEDL IR  +  HLKQA V++I+IER 
Sbjct: 1   MGQKVNPIGLRLGVNRTWDSRWFASKGEYAKLLHEDLAIRAAVAKHLKQAAVSRIIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ ++SARPG++IGKKG DI+KIRK +  +T SE+ +++ EV KPE+ ATL+A SI
Sbjct: 61  HKKCRVTIHSARPGVVIGKKGADIDKIRKLVGRLTGSEVVINIVEVRKPEVEATLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSA+R GA G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAIRLGAQGIRINCSGRLGGAEIARLEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            +DYG A A TAYG+CGIKV++  + E+ + D   P A+ + + + +
Sbjct: 181 DVDYGVATAHTAYGACGIKVWIF-KGEILEHD---PMAQDKRLAEAA 223


>gi|92117104|ref|YP_576833.1| 30S ribosomal protein S3 [Nitrobacter hamburgensis X14]
 gi|122990230|sp|Q1QN24|RS3_NITHX RecName: Full=30S ribosomal protein S3
 gi|91799998|gb|ABE62373.1| SSU ribosomal protein S3P [Nitrobacter hamburgensis X14]
          Length = 231

 Score =  281 bits (720), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 132/226 (58%), Positives = 181/226 (80%), Gaps = 4/226 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI  RLG+N TW+SRW+A  +EYG LLHED++IRE L   LKQA VA+I+IER 
Sbjct: 1   MGQKINPIGLRLGINRTWDSRWYAGKNEYGRLLHEDVRIRELLHKELKQAAVARIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ ++SARPG++IGKKG DI+K+RK+++++T+S++ +++ E+ KPE++ATL+A+SI
Sbjct: 61  HKKCRVTIHSARPGVVIGKKGADIDKLRKRVADITSSDVVINIVEIRKPELDATLVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA+G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAEGIRINCSGRLGGAEIARMEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            +DYG A A T +G+CG+KV++  + E+ + D   P A+ + +  D
Sbjct: 181 DVDYGVATAFTTFGTCGVKVWIF-KGEILEHD---PMAQDKRLAGD 222


>gi|15599453|ref|NP_252947.1| 30S ribosomal protein S3 [Pseudomonas aeruginosa PAO1]
 gi|107103770|ref|ZP_01367688.1| hypothetical protein PaerPA_01004841 [Pseudomonas aeruginosa PACS2]
 gi|116052292|ref|YP_788862.1| 30S ribosomal protein S3 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|152987607|ref|YP_001346229.1| 30S ribosomal protein S3 [Pseudomonas aeruginosa PA7]
 gi|218889415|ref|YP_002438279.1| 30S ribosomal protein S3 [Pseudomonas aeruginosa LESB58]
 gi|296387186|ref|ZP_06876685.1| 30S ribosomal protein S3 [Pseudomonas aeruginosa PAb1]
 gi|313111411|ref|ZP_07797216.1| 30S ribosomal protein S3 [Pseudomonas aeruginosa 39016]
 gi|27734535|sp|Q9HWE1|RS3_PSEAE RecName: Full=30S ribosomal protein S3
 gi|122261441|sp|Q02T74|RS3_PSEAB RecName: Full=30S ribosomal protein S3
 gi|171460872|sp|A6UZJ4|RS3_PSEA7 RecName: Full=30S ribosomal protein S3
 gi|9950474|gb|AAG07645.1|AE004841_23 30S ribosomal protein S3 [Pseudomonas aeruginosa PAO1]
 gi|115587513|gb|ABJ13528.1| 30S ribosomal protein S3 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|150962765|gb|ABR84790.1| ribosomal protein S3 [Pseudomonas aeruginosa PA7]
 gi|218769638|emb|CAW25398.1| 30S ribosomal protein S3 [Pseudomonas aeruginosa LESB58]
 gi|310883718|gb|EFQ42312.1| 30S ribosomal protein S3 [Pseudomonas aeruginosa 39016]
          Length = 228

 Score =  281 bits (719), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 112/227 (49%), Positives = 152/227 (66%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+     S W+A    Y   L  DLK+REYLQ  LK A V++I I R 
Sbjct: 1   MGQKVHPNGIRLGIVKEHTSVWYADRKNYADYLFADLKVREYLQDKLKSASVSRIDIHRP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +  RI +++ARPG++IGKKG D+EK+R+ L+      +H+++ E+ KPE++A L+AQS+
Sbjct: 61  AQTARITIHTARPGIVIGKKGEDVEKLRQDLTKQMGVPVHINIEEIRKPELDAMLVAQSV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV+FRRAMKRAVQ+AMR GA G+K+  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVMFRRAMKRAVQNAMRIGAKGIKIQVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDY T  A T YG  G+KV++   + +      +        +K +
Sbjct: 181 DIDYATYEAHTTYGVIGVKVWIFKGEVIGGRQEELKPVAPAPRKKAA 227


>gi|99080096|ref|YP_612250.1| 30S ribosomal protein S3 [Ruegeria sp. TM1040]
 gi|259416631|ref|ZP_05740551.1| ribosomal protein S3 [Silicibacter sp. TrichCH4B]
 gi|122984457|sp|Q1GK28|RS3_SILST RecName: Full=30S ribosomal protein S3
 gi|99036376|gb|ABF62988.1| SSU ribosomal protein S3P [Ruegeria sp. TM1040]
 gi|259348070|gb|EEW59847.1| ribosomal protein S3 [Silicibacter sp. TrichCH4B]
          Length = 239

 Score =  281 bits (719), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 129/225 (57%), Positives = 173/225 (76%), Gaps = 4/225 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K+NP+  RL +N TW+SRW+A   +YG LL ED+KIRE+++   KQAGVA+++IER 
Sbjct: 1   MGHKVNPVGMRLQINRTWDSRWYADTKDYGDLLLEDIKIREFIKEECKQAGVARVIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ +++ARPG+IIGKKG DIE +RKK+++MT+SE+HL++ EV KPE++A L+ +SI
Sbjct: 61  HKKCRVTIHTARPGVIIGKKGADIEVLRKKIASMTDSELHLNIVEVRKPELDAQLVGESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQ+AMR GA G++V  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVSFRRAMKRAVQNAMRMGALGIRVNVAGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDY  + A T YG  GIKV++  + E+ + D   P A  R  ++
Sbjct: 181 DIDYAHSEASTPYGIIGIKVWIF-KGEIMEHD---PQARDRKAQE 221


>gi|315497979|ref|YP_004086783.1| ribosomal protein s3 [Asticcacaulis excentricus CB 48]
 gi|315415991|gb|ADU12632.1| ribosomal protein S3 [Asticcacaulis excentricus CB 48]
          Length = 251

 Score =  281 bits (719), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 130/227 (57%), Positives = 172/227 (75%), Gaps = 4/227 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI  RLGVN TW+SRWFA   EY  LLH+DLKIR+ L+  L  AGV++I+IER 
Sbjct: 1   MGQKVNPIGLRLGVNRTWDSRWFAARQEYAKLLHQDLKIRKELKEKLNAAGVSRIIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CRI +Y+ARPG++IGKKG DI+K+RK +S +T  E+ L++ EV KPE+++ L+A+SI
Sbjct: 61  HKKCRITIYAARPGVVIGKKGADIDKLRKDISALTEGEVFLNLVEVRKPEVDSQLVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKR++QSAMR GA G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRSIQSAMRLGAKGIRMNLSGRLGGAEIARMEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            ID+G A A T YG  G+KV++  + EV + D   P A+ +   +++
Sbjct: 181 DIDFGFAEALTTYGIIGVKVWIF-KGEVLEHD---PMAQDKRWSQEA 223


>gi|254467163|ref|ZP_05080574.1| ribosomal protein S3 [Rhodobacterales bacterium Y4I]
 gi|206688071|gb|EDZ48553.1| ribosomal protein S3 [Rhodobacterales bacterium Y4I]
          Length = 236

 Score =  281 bits (718), Expect = 6e-74,   Method: Composition-based stats.
 Identities = 132/225 (58%), Positives = 174/225 (77%), Gaps = 4/225 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI  RL VN TW+SRW+A   +YG LL ED+KIRE+++   KQAG+A+++IER 
Sbjct: 1   MGQKVNPIGMRLQVNRTWDSRWYADTKDYGDLLLEDIKIREFIKEECKQAGIARVIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ +++ARPG+IIGKKG DIE +RKKL+ MT+SE+HL++ EV KPE++A L+ +SI
Sbjct: 61  HKKCRVTIHTARPGVIIGKKGADIEVLRKKLAKMTDSELHLNIVEVRKPELDAQLVGESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQ+AMR GA G++V  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVSFRRAMKRAVQNAMRMGALGIRVNVAGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDY  + A T YG  GIKV++  + E+ + D   P+A  R  ++
Sbjct: 181 DIDYAHSEAMTPYGIIGIKVWIF-KGEIMEHD---PSARDRKAQE 221


>gi|288957428|ref|YP_003447769.1| small subunit ribosomal protein S3 [Azospirillum sp. B510]
 gi|288909736|dbj|BAI71225.1| small subunit ribosomal protein S3 [Azospirillum sp. B510]
          Length = 249

 Score =  281 bits (718), Expect = 6e-74,   Method: Composition-based stats.
 Identities = 131/223 (58%), Positives = 169/223 (75%), Gaps = 5/223 (2%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI  RLG+N TW+SRWFA   +Y  LLH+DLK+R YLQ  L+QAG ++++IER 
Sbjct: 1   MGQKINPIGLRLGINRTWDSRWFA-KRDYANLLHQDLKLRGYLQGRLQQAGCSRVVIERP 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K  RI ++SARPG++IGKKG DIEK+R +LS MT SE+ L++ E+ KPEI+A LIA++I
Sbjct: 60  AKKARITIHSARPGVVIGKKGADIEKLRLELSKMTGSEVSLNIVEIRKPEIDARLIAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV FRRAMKRAVQSAMR GA G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 120 ASQLERRVAFRRAMKRAVQSAMRLGAQGIRINCSGRLGGAEIARMEWYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVV 223
            IDYG   A+T YG+CG+KV+V   + ++      P A+ + +
Sbjct: 180 DIDYGVGTAKTTYGTCGVKVWVFKGEVMAHD----PMAQDKRM 218


>gi|83594014|ref|YP_427766.1| 30S ribosomal protein S3 [Rhodospirillum rubrum ATCC 11170]
 gi|91207836|sp|Q2RQW6|RS3_RHORT RecName: Full=30S ribosomal protein S3
 gi|83576928|gb|ABC23479.1| SSU ribosomal protein S3P [Rhodospirillum rubrum ATCC 11170]
          Length = 223

 Score =  281 bits (718), Expect = 6e-74,   Method: Composition-based stats.
 Identities = 132/226 (58%), Positives = 174/226 (76%), Gaps = 5/226 (2%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI  RLG+N TW+SRWFA G +Y +LLH+DL I++YL+  L QAGV++I+IER 
Sbjct: 1   MGQKVNPIGLRLGINRTWDSRWFA-GRDYASLLHQDLAIKKYLKSKLAQAGVSRIVIERP 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K  RI +++ARPG++IGKKG DIE +RKKL  MT +E+HL++ E+ KPE++A L+A++I
Sbjct: 60  AKKARITIHTARPGVVIGKKGQDIENLRKKLQVMTGNEVHLNIVEIRKPELDAQLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA G+++   GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 120 AQQLERRVAFRRAMKRAVQSAMRLGALGIRINCGGRLGGAEIARTEWYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            +DYGTA A T YG CG+KV+V  + E+ + D   P A+ +  +  
Sbjct: 180 DVDYGTAAAHTTYGVCGVKVWVF-KGEIMEHD---PMAQDKRSQDQ 221


>gi|226942784|ref|YP_002797857.1| 30S ribosomal protein S3 [Azotobacter vinelandii DJ]
 gi|226717711|gb|ACO76882.1| 30S ribosomal protein S3 [Azotobacter vinelandii DJ]
          Length = 228

 Score =  281 bits (718), Expect = 7e-74,   Method: Composition-based stats.
 Identities = 112/228 (49%), Positives = 154/228 (67%), Gaps = 4/228 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P+  RLG+     S W+A    Y   L+ DLK+REYLQ  LK A V++I I R 
Sbjct: 1   MGQKVHPVGIRLGIVKEHTSVWYADRKNYADYLYADLKVREYLQDKLKSASVSRIDIARP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +  RI +++ARPG++IGKKG D+EK+R+ L+      +H+++ E+ KPE+++ L+AQS+
Sbjct: 61  AQTARITIHTARPGIVIGKKGEDVEKLRQDLTKQMGVPVHINIEEIRKPELDSMLVAQSV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV+FRRAMKRAVQ+AMR GA G+K+  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVMFRRAMKRAVQNAMRIGAKGIKIQVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDS----DSTIPAAEHRVVE 224
            IDY T  A T YG  G+KV++   + +           PA   +  +
Sbjct: 181 DIDYATYEAHTTYGVIGVKVWIFKGEVIGGQHEELKPQAPAPRKKAAK 228


>gi|70732876|ref|YP_262644.1| 30S ribosomal protein S3 [Pseudomonas fluorescens Pf-5]
 gi|91207831|sp|Q4K539|RS3_PSEF5 RecName: Full=30S ribosomal protein S3
 gi|68347175|gb|AAY94781.1| ribosomal protein S3 [Pseudomonas fluorescens Pf-5]
          Length = 228

 Score =  281 bits (718), Expect = 7e-74,   Method: Composition-based stats.
 Identities = 113/228 (49%), Positives = 152/228 (66%), Gaps = 4/228 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI  RLG+     S W+A G  Y   L  DL +REYLQ  LK A V++I I R 
Sbjct: 1   MGQKVHPIGIRLGIVKEHTSVWYADGRTYADYLLADLNVREYLQDKLKSASVSRIDIHRP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +  RI +++ARPG++IGKKG D+EK+R+ L+      +H+++ E+ KPE++  L+AQS+
Sbjct: 61  AQTARITIHTARPGIVIGKKGEDVEKLRQDLTKQMGVPVHINIEEIRKPELDGMLVAQSV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV+FRRAMKRAVQ+AMR GA G+K+  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVMFRRAMKRAVQNAMRIGAKGIKIQVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDS----DSTIPAAEHRVVE 224
            IDY T  A T YG  G+KV++   + +           PA   +  +
Sbjct: 181 DIDYATYEAHTTYGVIGVKVWIFKGEVIGGRQEELKPQAPAPRKKAAK 228


>gi|254475420|ref|ZP_05088806.1| ribosomal protein S3 [Ruegeria sp. R11]
 gi|214029663|gb|EEB70498.1| ribosomal protein S3 [Ruegeria sp. R11]
          Length = 235

 Score =  281 bits (718), Expect = 7e-74,   Method: Composition-based stats.
 Identities = 128/225 (56%), Positives = 173/225 (76%), Gaps = 4/225 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K+NP+  RL VN TW+SRW+A   +YG LL EDL+IR++++   KQAG+A+++IER 
Sbjct: 1   MGHKVNPVGMRLQVNRTWDSRWYADTKDYGDLLLEDLRIRDFIKEECKQAGIARVIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ +++ARPG+IIGKKG DIE +RKK+++MT+SE+HL++ EV KPE++A L+ +SI
Sbjct: 61  HKKCRVTIHTARPGVIIGKKGADIEVLRKKIASMTDSELHLNIVEVRKPELDAQLVGESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQ+AMR GA G++V  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVSFRRAMKRAVQNAMRMGALGIRVNVAGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDY  + A T YG  GIKV++  + E+ + D   P A  R  ++
Sbjct: 181 DIDYAHSEASTPYGIIGIKVWIF-KGEIMEHD---PQARDRKAQE 221


>gi|217976761|ref|YP_002360908.1| ribosomal protein S3 [Methylocella silvestris BL2]
 gi|254764535|sp|B8ELF7|RS3_METSB RecName: Full=30S ribosomal protein S3
 gi|217502137|gb|ACK49546.1| ribosomal protein S3 [Methylocella silvestris BL2]
          Length = 239

 Score =  280 bits (717), Expect = 8e-74,   Method: Composition-based stats.
 Identities = 140/226 (61%), Positives = 179/226 (79%), Gaps = 3/226 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI  RLG+N TW+SRWFA  +EYG LLHED+ IR  L   LKQA V+KI+IER 
Sbjct: 1   MGQKVNPIGLRLGINRTWDSRWFAGKNEYGKLLHEDMAIRAALMKTLKQAAVSKIIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ ++SARPG++IGKKG DI+KIRK ++ MT+SE+ +++ EV KPEI+ATL+A SI
Sbjct: 61  HKKCRVTIHSARPGVVIGKKGADIDKIRKLVAKMTDSEVLINIVEVRKPEIDATLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA+G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAEGIRINCSGRLGGAEIARLEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            +DYGTA A TAYG+CGIKV++  + E+ + D    A + ++ E+D
Sbjct: 181 DVDYGTATAHTAYGACGIKVWIF-KGEILEHDPM--AQDKKMAEQD 223


>gi|146308917|ref|YP_001189382.1| 30S ribosomal protein S3 [Pseudomonas mendocina ymp]
 gi|330505201|ref|YP_004382070.1| 30S ribosomal protein S3 [Pseudomonas mendocina NK-01]
 gi|172046042|sp|A4XZ84|RS3_PSEMY RecName: Full=30S ribosomal protein S3
 gi|145577118|gb|ABP86650.1| SSU ribosomal protein S3P [Pseudomonas mendocina ymp]
 gi|328919487|gb|AEB60318.1| 30S ribosomal protein S3 [Pseudomonas mendocina NK-01]
          Length = 228

 Score =  280 bits (717), Expect = 8e-74,   Method: Composition-based stats.
 Identities = 112/228 (49%), Positives = 154/228 (67%), Gaps = 3/228 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P+  RLG+     S W+A G  Y   L+ DLK+R YLQ  LK A V++I I R 
Sbjct: 1   MGQKVHPVGIRLGIVKDHTSVWYADGRNYADYLNADLKVRAYLQDKLKSASVSRIDIARP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +  RI +++ARPG++IGKKG D+EK+R+ L+      +H+++ E+ KPE++  L+AQS+
Sbjct: 61  AQTARITIHTARPGIVIGKKGEDVEKLRQDLTKQMGVPVHINIEEIRKPELDGMLVAQSV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV+FRRAMKRAVQ+AMR GA G+K+  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVMFRRAMKRAVQNAMRIGAKGIKIQVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIP---AAEHRVVEK 225
            IDY T  A T YG  G+KV++   + +      +     A  +  +K
Sbjct: 181 DIDYATYEAHTTYGVIGVKVWIFKGEVIGGRTEELKPQAPAPRKAAKK 228


>gi|121602435|ref|YP_989003.1| 30S ribosomal protein S3 [Bartonella bacilliformis KC583]
 gi|121602523|ref|YP_988973.1| 30S ribosomal protein S3 [Bartonella bacilliformis KC583]
 gi|152060847|sp|A1USM0|RS3_BARBK RecName: Full=30S ribosomal protein S3
 gi|120614612|gb|ABM45213.1| ribosomal protein S3 [Bartonella bacilliformis KC583]
 gi|120614700|gb|ABM45301.1| ribosomal protein S3 [Bartonella bacilliformis KC583]
          Length = 236

 Score =  280 bits (717), Expect = 9e-74,   Method: Composition-based stats.
 Identities = 145/227 (63%), Positives = 178/227 (78%), Gaps = 3/227 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI  RLGVN TW+SRW+A   EYG LLHEDLKIR Y+   LKQA ++K++IER 
Sbjct: 1   MGQKINPIGLRLGVNQTWSSRWYADSGEYGRLLHEDLKIRSYVMEELKQAAISKVIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ ++SARPGLIIGKKG DIEK+R +LS MTN+E  L++ E+ KPEI+AT+IAQS+
Sbjct: 61  HKKCRVTIHSARPGLIIGKKGADIEKLRHQLSEMTNAETSLNIVEIRKPEIDATIIAQSV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA+G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAEGIRINCSGRLGGAEIARMEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            +DY TA A TAYG CG+KV+V  + E+ + D    A+EHR    D+
Sbjct: 181 DVDYSTAEARTAYGVCGVKVWVF-KGEILEHDPM--ASEHRATRNDN 224


>gi|319407420|emb|CBI81071.1| 30S ribosomal protein S3 [Bartonella sp. 1-1C]
          Length = 236

 Score =  280 bits (716), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 147/226 (65%), Positives = 181/226 (80%), Gaps = 3/226 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI  RLG+N TW+SRW+A   EYG LLHED+KIR Y+   LKQA V+K++IER 
Sbjct: 1   MGQKINPIGLRLGINRTWDSRWYADSGEYGRLLHEDVKIRLYVVEELKQAAVSKVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CRI ++SARPGLIIGK+G DIEK+R+KLS MTN+E  L++ E+ KPEI++T+IAQSI
Sbjct: 61  HKKCRITIHSARPGLIIGKRGADIEKLRRKLSEMTNAETSLNIVEIRKPEIDSTIIAQSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA+G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAEGIRINCSGRLGGAEIARMEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            +DYGTA A+TAYG CG+KV+V  + E+ + D    A+E R VE D
Sbjct: 181 DVDYGTAEAKTAYGICGVKVWVF-KGEILEHDPM--ASERRAVEGD 223


>gi|84503636|ref|ZP_01001674.1| 30S ribosomal protein S3 [Oceanicola batsensis HTCC2597]
 gi|84387933|gb|EAQ00985.1| 30S ribosomal protein S3 [Oceanicola batsensis HTCC2597]
          Length = 240

 Score =  280 bits (716), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 132/225 (58%), Positives = 173/225 (76%), Gaps = 4/225 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI  RL VN TW+SRW+A   +YG LL ED+++RE+++   KQAGVA+I+IER 
Sbjct: 1   MGQKVNPIGMRLQVNRTWDSRWYADTKDYGDLLLEDVRMREFIKEECKQAGVARIIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ +++ARPG+IIGKKG DIE +RKKL+ MT+SE+HL++ EV KPE++A L+ +SI
Sbjct: 61  HKKCRVTIHTARPGVIIGKKGADIEVLRKKLAKMTDSELHLNIVEVRKPELDAALVGESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQ+AMR GA G++V  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVSFRRAMKRAVQNAMRMGALGIRVNVAGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDY  + A T YG  GIKV++  + E+ + D   P A  R  ++
Sbjct: 181 DIDYAHSEASTPYGIIGIKVWIF-KGEILEHD---PQARDRRAQE 221


>gi|209964046|ref|YP_002296961.1| 30S ribosomal protein S3 [Rhodospirillum centenum SW]
 gi|226697750|sp|B6IRR2|RS3_RHOCS RecName: Full=30S ribosomal protein S3
 gi|209957512|gb|ACI98148.1| ribosomal protein S3 [Rhodospirillum centenum SW]
          Length = 225

 Score =  280 bits (716), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 127/227 (55%), Positives = 170/227 (74%), Gaps = 5/227 (2%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP+  RLG+N TW+SRWFA   +Y  LLH+DLK+R++LQ  L+ AGV++I+IER 
Sbjct: 1   MGQKVNPVGLRLGINRTWDSRWFA-ARDYAVLLHQDLKLRKFLQGKLQAAGVSRIVIERP 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K  R+ +++ARPG++IGKKG DIEK+R  L  M   E+ L++ E+ KPE++A LIA++I
Sbjct: 60  AKKARVTIHTARPGVVIGKKGADIEKLRGTLGTMAGGEVSLNIVEIRKPELDARLIAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV FRRAMKRAVQSAMR GA G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 120 ASQLERRVAFRRAMKRAVQSAMRLGAQGIRINCSGRLGGAEIARLEWYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDYGTA A+T YG+CG+KV+V  + E+   D   P A+ +   + +
Sbjct: 180 DIDYGTATAKTTYGTCGVKVWVF-KGEILAHD---PMAQDKRAMEQA 222


>gi|288942066|ref|YP_003444306.1| 30S ribosomal protein S3 [Allochromatium vinosum DSM 180]
 gi|288897438|gb|ADC63274.1| ribosomal protein S3 [Allochromatium vinosum DSM 180]
          Length = 225

 Score =  279 bits (715), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 109/219 (49%), Positives = 159/219 (72%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   W S+W+A   +Y  LL+ DL++R++L+  L +A V++I I+R 
Sbjct: 1   MGQKVHPNGIRLGIVKDWTSKWYANSKDYADLLNTDLQVRDFLRKELAKASVSRIQIDRP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN  I +++ARPG++IGKKG DI+K+R K+S M    +H+++ E+ KPE++A L+A+ I
Sbjct: 61  AKNAHITIHTARPGVVIGKKGEDIDKLRAKVSEMMGIPVHIAIEEIRKPELDAQLVAEGI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERR++FRRAMKR++Q+ MR GA+G+KV  +GRLNGAE++R+E   EGRVPL TLRA
Sbjct: 121 AQQLERRIMFRRAMKRSIQNTMRLGAEGIKVSVAGRLNGAEIARSEWAREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
            IDYG A A+T YG  G+KV++   +   D     PA +
Sbjct: 181 DIDYGFAEAKTTYGVLGVKVWIFKGEVFGDQLPEEPAPK 219


>gi|209884819|ref|YP_002288676.1| ribosomal protein S3 [Oligotropha carboxidovorans OM5]
 gi|226697738|sp|B6JET9|RS3_OLICO RecName: Full=30S ribosomal protein S3
 gi|209873015|gb|ACI92811.1| ribosomal protein S3 [Oligotropha carboxidovorans OM5]
          Length = 233

 Score =  279 bits (715), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 132/226 (58%), Positives = 176/226 (77%), Gaps = 4/226 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI  RLG+N TW+SRWFA   +Y  LLHED++IRE L   LKQA VA+I+IER 
Sbjct: 1   MGQKINPIGLRLGINRTWDSRWFAGKGDYAKLLHEDVRIREVLMKELKQAAVARIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ VYSARPG++IGKKG DI+K++KK++ +T S++ +++ E+ KPE++ATL+A+SI
Sbjct: 61  HKKCRVSVYSARPGVVIGKKGADIDKLKKKVAEITESDVVINIVEIRKPELDATLVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAQGIRINCSGRLGGAEIARMEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            +DYG A A T +G+CG+KV++  + E+ + D   P A+ + + + 
Sbjct: 181 DVDYGVATAFTTFGTCGVKVWLF-KGEILEHD---PMAQDKRLNEG 222


>gi|119899700|ref|YP_934913.1| 30S ribosomal protein S3 [Azoarcus sp. BH72]
 gi|152060845|sp|A1KB21|RS3_AZOSB RecName: Full=30S ribosomal protein S3
 gi|119672113|emb|CAL96027.1| 30S ribosomal protein S3 [Azoarcus sp. BH72]
          Length = 260

 Score =  279 bits (715), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 121/230 (52%), Positives = 169/230 (73%), Gaps = 3/230 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V   W SRWFA   ++  +LHEDLK+R+YL+  L  A V +++IER 
Sbjct: 1   MGQKIHPTGFRLAVTRDWGSRWFASSRDFSKMLHEDLKVRDYLKKRLAHASVGRVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN R+ ++SARPG++IGKKG DIE +++ L  +    +H+++ EV KPEI+A LIA SI
Sbjct: 61  AKNARVTLFSARPGVVIGKKGEDIEALKRDLQKIVGVPVHVNIEEVRKPEIDAKLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLE+R++FRRAMKRA+Q+AMR GA G+K+++SGRLNGAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLEKRIMFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTI---PAAEHRVVEKDS 227
           +IDYG + A+T YG  GIKV+V   + +  ++  +   P A++R   + +
Sbjct: 181 NIDYGVSEAQTTYGVIGIKVWVFKGEMLGRNEQPVVAEPEADNRRGRRGA 230


>gi|296116726|ref|ZP_06835336.1| 30S ribosomal protein S3 [Gluconacetobacter hansenii ATCC 23769]
 gi|295976938|gb|EFG83706.1| 30S ribosomal protein S3 [Gluconacetobacter hansenii ATCC 23769]
          Length = 225

 Score =  279 bits (714), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 125/227 (55%), Positives = 170/227 (74%), Gaps = 5/227 (2%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K+NPI  RLG+N TW+SRW+A  ++Y  LLH+DLK+R YL+  L  AGV++++IER 
Sbjct: 1   MGHKVNPIGLRLGINRTWDSRWYAD-ADYARLLHDDLKLRSYLRRKLSGAGVSRVVIERP 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K  R+ +Y+ARPG++IGKKG DI+ +RK L+ M  +++ L++ E+ KPEI+ATL+A +I
Sbjct: 60  AKKPRVTIYAARPGVVIGKKGQDIDVLRKDLTRMAKTDVALNIVEIRKPEIDATLVADNI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 120 AQQLERRVAFRRAMKRAVQSAMRLGAQGIRINCSGRLGGAEIARVEWYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDYG A A+T YG+CG+KV++  + E+   D   P A+ R   + +
Sbjct: 180 DIDYGVATAKTTYGTCGVKVWIF-KGEILAHD---PLAQDRRAAEQA 222


>gi|330993852|ref|ZP_08317784.1| 30S ribosomal protein S3 [Gluconacetobacter sp. SXCC-1]
 gi|329759120|gb|EGG75632.1| 30S ribosomal protein S3 [Gluconacetobacter sp. SXCC-1]
          Length = 225

 Score =  279 bits (714), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 125/227 (55%), Positives = 171/227 (75%), Gaps = 5/227 (2%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K+NPI  RLG+N TW+SRW+A  ++Y  LLH+DLK+R YL+  L  AGV++++IER 
Sbjct: 1   MGHKVNPIGLRLGINRTWDSRWYAD-ADYARLLHDDLKLRAYLRRKLSGAGVSRVVIERP 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K  R+ +Y+ARPG++IGKKG DI+ +RK L+ M  +++ L++ E+ KPEI+ATL+A++I
Sbjct: 60  AKKPRVTIYAARPGVVIGKKGQDIDVLRKDLARMAKTDVALNIVEIRKPEIDATLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 120 AQQLERRVAFRRAMKRAVQSAMRLGAQGIRINCSGRLGGAEIARIEWYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDYG A A+T YG+CG+KV++  + E+   D   P A+ R   + +
Sbjct: 180 DIDYGVATAKTTYGTCGVKVWIF-KGEILAHD---PLAQDRRAAEQA 222


>gi|167645584|ref|YP_001683247.1| 30S ribosomal protein S3 [Caulobacter sp. K31]
 gi|189044963|sp|B0T2C8|RS3_CAUSK RecName: Full=30S ribosomal protein S3
 gi|167348014|gb|ABZ70749.1| ribosomal protein S3 [Caulobacter sp. K31]
          Length = 249

 Score =  279 bits (714), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 129/226 (57%), Positives = 171/226 (75%), Gaps = 3/226 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP+  RLG+N TW+SRWFA G +YG LLH+DL +R  L+  L QAGV++I+IER 
Sbjct: 1   MGQKVNPVGLRLGINRTWDSRWFADGEQYGKLLHQDLAVRAMLKKRLYQAGVSRIIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ +Y+ARPG+IIGKKG DI+K+RK LS MT  E+HL++ E+ KPE +A L+A+SI
Sbjct: 61  HKKCRVTIYAARPGVIIGKKGADIDKLRKDLSVMTEGEVHLNIVEIRKPETDAQLVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERR+ FRRAMKR++QSA+R GA G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRIAFRRAMKRSIQSAVRLGAKGIRINVSGRLGGAEIARMEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            IDYG A A+T YG  G+K ++  + EV + D    A + R+  + 
Sbjct: 181 DIDYGFAEAKTTYGIIGVKTWIF-KGEVLEHDPM--ALDKRLATES 223


>gi|330953191|gb|EGH53451.1| 30S ribosomal protein S3 [Pseudomonas syringae Cit 7]
          Length = 228

 Score =  279 bits (714), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 113/228 (49%), Positives = 152/228 (66%), Gaps = 4/228 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI  RLG+     S W+A G  Y   L  DLK+REYLQ  LK A V++I I R 
Sbjct: 1   MGQKVHPIGIRLGIVKEHTSVWYADGRTYADYLFADLKVREYLQNKLKSASVSRIDIHRP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +  RI +++ARPG++IGKKG D+EK+R+ L+      +H+++ E+ KPE++  L+AQS+
Sbjct: 61  AQTARITIHTARPGIVIGKKGEDVEKLRQDLTKQMGVPVHINIEEIRKPELDGMLVAQSV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV+FRRAMKRAVQ+AMR GA G+K+  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVMFRRAMKRAVQNAMRIGAKGIKIQVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDS----DSTIPAAEHRVVE 224
            IDY    A T YG  G+KV++   + +           PA   +  +
Sbjct: 181 DIDYANYEAHTTYGVIGVKVWIFKGEVIGGRQEELKPQAPAPRKKAAK 228


>gi|28867860|ref|NP_790479.1| 30S ribosomal protein S3 [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|66047769|ref|YP_237610.1| 30S ribosomal protein S3 [Pseudomonas syringae pv. syringae B728a]
 gi|71736756|ref|YP_276700.1| 30S ribosomal protein S3 [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|77461294|ref|YP_350801.1| 30S ribosomal protein S3 [Pseudomonas fluorescens Pf0-1]
 gi|213969220|ref|ZP_03397358.1| 30S ribosomal protein S3 [Pseudomonas syringae pv. tomato T1]
 gi|229592897|ref|YP_002875016.1| 30S ribosomal protein S3 [Pseudomonas fluorescens SBW25]
 gi|237797438|ref|ZP_04585899.1| 30S ribosomal protein S3 [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|257483191|ref|ZP_05637232.1| 30S ribosomal protein S3 [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|289623843|ref|ZP_06456797.1| 30S ribosomal protein S3 [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289648936|ref|ZP_06480279.1| 30S ribosomal protein S3 [Pseudomonas syringae pv. aesculi str.
           2250]
 gi|289675494|ref|ZP_06496384.1| 30S ribosomal protein S3 [Pseudomonas syringae pv. syringae FF5]
 gi|301381727|ref|ZP_07230145.1| 30S ribosomal protein S3 [Pseudomonas syringae pv. tomato Max13]
 gi|302061073|ref|ZP_07252614.1| 30S ribosomal protein S3 [Pseudomonas syringae pv. tomato K40]
 gi|302130786|ref|ZP_07256776.1| 30S ribosomal protein S3 [Pseudomonas syringae pv. tomato NCPPB
           1108]
 gi|302189283|ref|ZP_07265956.1| 30S ribosomal protein S3 [Pseudomonas syringae pv. syringae 642]
 gi|312963362|ref|ZP_07777845.1| ribosomal protein S3 [Pseudomonas fluorescens WH6]
 gi|330812069|ref|YP_004356531.1| 30S ribosomal protein S3 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|34098361|sp|Q889W5|RS3_PSESM RecName: Full=30S ribosomal protein S3
 gi|81307864|sp|Q4ZMQ0|RS3_PSEU2 RecName: Full=30S ribosomal protein S3
 gi|91207830|sp|Q48D42|RS3_PSE14 RecName: Full=30S ribosomal protein S3
 gi|91207833|sp|Q3K5Z4|RS3_PSEPF RecName: Full=30S ribosomal protein S3
 gi|28851096|gb|AAO54174.1| ribosomal protein S3 [Pseudomonas syringae pv. tomato str. DC3000]
 gi|63258476|gb|AAY39572.1| ribosomal protein S3 [Pseudomonas syringae pv. syringae B728a]
 gi|71557309|gb|AAZ36520.1| ribosomal protein S3 [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|77385297|gb|ABA76810.1| 30S ribosomal protein S3 [Pseudomonas fluorescens Pf0-1]
 gi|213925898|gb|EEB59455.1| 30S ribosomal protein S3 [Pseudomonas syringae pv. tomato T1]
 gi|229364763|emb|CAY52756.1| 30S ribosomal protein S3 [Pseudomonas fluorescens SBW25]
 gi|311282442|gb|EFQ61040.1| ribosomal protein S3 [Pseudomonas fluorescens WH6]
 gi|320322316|gb|EFW78410.1| 30S ribosomal protein S3 [Pseudomonas syringae pv. glycinea str.
           B076]
 gi|320331974|gb|EFW87910.1| 30S ribosomal protein S3 [Pseudomonas syringae pv. glycinea str.
           race 4]
 gi|327380177|gb|AEA71527.1| 30S ribosomal protein S3 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|330869425|gb|EGH04134.1| 30S ribosomal protein S3 [Pseudomonas syringae pv. aesculi str.
           0893_23]
 gi|330879375|gb|EGH13524.1| 30S ribosomal protein S3 [Pseudomonas syringae pv. glycinea str.
           race 4]
 gi|330879436|gb|EGH13585.1| 30S ribosomal protein S3 [Pseudomonas syringae pv. morsprunorum
           str. M302280PT]
 gi|330891925|gb|EGH24586.1| 30S ribosomal protein S3 [Pseudomonas syringae pv. mori str.
           301020]
 gi|330899731|gb|EGH31150.1| 30S ribosomal protein S3 [Pseudomonas syringae pv. japonica str.
           M301072PT]
 gi|330944849|gb|EGH46717.1| 30S ribosomal protein S3 [Pseudomonas syringae pv. pisi str. 1704B]
 gi|330962519|gb|EGH62779.1| 30S ribosomal protein S3 [Pseudomonas syringae pv. maculicola str.
           ES4326]
 gi|330966905|gb|EGH67165.1| 30S ribosomal protein S3 [Pseudomonas syringae pv. actinidiae str.
           M302091]
 gi|330969815|gb|EGH69881.1| 30S ribosomal protein S3 [Pseudomonas syringae pv. aceris str.
           M302273PT]
 gi|330976646|gb|EGH76690.1| 30S ribosomal protein S3 [Pseudomonas syringae pv. aptata str. DSM
           50252]
 gi|330988276|gb|EGH86379.1| 30S ribosomal protein S3 [Pseudomonas syringae pv. lachrymans str.
           M301315]
 gi|331012419|gb|EGH92475.1| 30S ribosomal protein S3 [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|331018166|gb|EGH98222.1| 30S ribosomal protein S3 [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
 gi|331020288|gb|EGI00345.1| 30S ribosomal protein S3 [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 228

 Score =  279 bits (714), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 113/228 (49%), Positives = 152/228 (66%), Gaps = 4/228 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI  RLG+     S W+A G  Y   L  DLK+REYLQ  LK A V++I I R 
Sbjct: 1   MGQKVHPIGIRLGIVKEHTSVWYADGRTYADYLFADLKVREYLQDKLKSASVSRIDIHRP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +  RI +++ARPG++IGKKG D+EK+R+ L+      +H+++ E+ KPE++  L+AQS+
Sbjct: 61  AQTARITIHTARPGIVIGKKGEDVEKLRQDLTKQMGVPVHINIEEIRKPELDGMLVAQSV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV+FRRAMKRAVQ+AMR GA G+K+  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVMFRRAMKRAVQNAMRIGAKGIKIQVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDS----DSTIPAAEHRVVE 224
            IDY    A T YG  G+KV++   + +           PA   +  +
Sbjct: 181 DIDYANYEAHTTYGVIGVKVWIFKGEVIGGRQEELKPQAPAPRKKAAK 228


>gi|294675862|ref|YP_003576477.1| 30S ribosomal protein S3 [Rhodobacter capsulatus SB 1003]
 gi|294474682|gb|ADE84070.1| 30S ribosomal protein S3 [Rhodobacter capsulatus SB 1003]
          Length = 238

 Score =  279 bits (713), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 131/225 (58%), Positives = 169/225 (75%), Gaps = 4/225 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI  RL VN TW+SRWFA   +YG LL EDL++RE++    KQAG+A+++IER 
Sbjct: 1   MGQKVNPIGMRLQVNRTWDSRWFAESKDYGNLLLEDLRMREFIHEEAKQAGIARVIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ +++ARPG+IIGKKG DIE +RKKL+N T SE+HL++ EV KPE+++ L+A+SI
Sbjct: 61  HKKCRVTIHAARPGVIIGKKGADIETLRKKLANFTASELHLNIVEVRKPELDSQLVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLERRV FRRAMKRAVQ+AMR GA G++V  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 CQQLERRVSFRRAMKRAVQNAMRMGALGIRVNVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDY    A T YG  G+KV++  + E+ + D   P A  R   +
Sbjct: 181 DIDYALDEAMTPYGIIGVKVWIF-KGEIMEHD---PQARDRKAAE 221


>gi|83858560|ref|ZP_00952082.1| 30S ribosomal protein S3 [Oceanicaulis alexandrii HTCC2633]
 gi|83853383|gb|EAP91235.1| 30S ribosomal protein S3 [Oceanicaulis alexandrii HTCC2633]
          Length = 234

 Score =  279 bits (713), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 132/223 (59%), Positives = 172/223 (77%), Gaps = 4/223 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI  R+G+N TW SRWFA+G EY  LLHEDL+IREYL+  LK A V++I+IER 
Sbjct: 1   MGQKVNPIGLRVGINRTWESRWFAKGEEYADLLHEDLRIREYLKKELKNASVSRIIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CRI +++ARPG++IGKKG DIEK+R+K+S M   E+ L++ EV KPE++ATL+A+S+
Sbjct: 61  HKKCRITIHTARPGVVIGKKGADIEKLRRKVSKMVEGEVFLNLVEVRKPEVDATLVAESV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKR++Q+AMR GA G K++  GRL GAE++R E Y EG VPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRSLQTAMRMGALGCKIMCGGRLGGAEIARVEKYSEGSVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVV 223
            IDYG A A+TA G  GIKV++  + E+ + D   P A+ R +
Sbjct: 181 DIDYGFAEAKTAMGIIGIKVWIY-KGEIMEHD---PMAQERRM 219


>gi|163868644|ref|YP_001609853.1| 30S ribosomal protein S3 [Bartonella tribocorum CIP 105476]
 gi|189044952|sp|A9IW20|RS3_BART1 RecName: Full=30S ribosomal protein S3
 gi|161018300|emb|CAK01858.1| 30S ribosomal protein S3 [Bartonella tribocorum CIP 105476]
          Length = 236

 Score =  279 bits (713), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 146/226 (64%), Positives = 180/226 (79%), Gaps = 3/226 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI  RLGVN TW+SRW+A   EYG LLHEDL+IR Y+   L+QA ++K++IER 
Sbjct: 1   MGQKINPIGLRLGVNRTWDSRWYADSGEYGRLLHEDLRIRSYVLEELRQAAISKVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ ++SARPGLIIGKKG DIEK+R+KLS MTN+E  L++ E+ KPEI+AT+IAQSI
Sbjct: 61  HKKCRVTIHSARPGLIIGKKGADIEKLRRKLSEMTNAETSLNIVEIRKPEIDATIIAQSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA+G+++  SGRL GAE++R E Y EGRVPL TLR+
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAEGIRINCSGRLGGAEIARMEWYREGRVPLHTLRS 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            +DYGTA A+TAYG CGIKV+V  + E+ + D    A+E R  E D
Sbjct: 181 DVDYGTAEAKTAYGICGIKVWVF-KGEILEHDPM--ASERRATEAD 223


>gi|149915850|ref|ZP_01904374.1| 30S ribosomal protein S3 [Roseobacter sp. AzwK-3b]
 gi|149810173|gb|EDM70019.1| 30S ribosomal protein S3 [Roseobacter sp. AzwK-3b]
          Length = 235

 Score =  279 bits (713), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 129/225 (57%), Positives = 173/225 (76%), Gaps = 4/225 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K+NPI  RL VN TW+SRW+A   +YG LL EDLKIR++++   KQAG+++++IER 
Sbjct: 1   MGNKVNPIGMRLQVNRTWDSRWYADTKDYGNLLLEDLKIRDFIEKECKQAGISRVIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ +++ARPG+IIGKKG DIE +RKKL+ MT+SE+HL++ EV KPE++A L+A+SI
Sbjct: 61  HKKCRVTIHTARPGVIIGKKGADIEGLRKKLARMTDSELHLNIVEVRKPELDAALVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKR+VQ+AMR GA G++V  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVSFRRAMKRSVQNAMRMGALGIRVNVAGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDY    A T YG  G+KV++  + E+ + D   P+A  R  ++
Sbjct: 181 DIDYAHKEAVTPYGIIGVKVWIF-KGEIMEHD---PSARDRKAQE 221


>gi|58038849|ref|YP_190813.1| 30S ribosomal protein S3 [Gluconobacter oxydans 621H]
 gi|62287182|sp|Q5FTY9|RS3_GLUOX RecName: Full=30S ribosomal protein S3
 gi|58001263|gb|AAW60157.1| SSU ribosomal protein S3P [Gluconobacter oxydans 621H]
          Length = 225

 Score =  279 bits (713), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 127/227 (55%), Positives = 172/227 (75%), Gaps = 5/227 (2%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K+NPI  RLGVN TW+SRW+A G +Y  LLHEDLK+R +L+  L  AGV++++IER 
Sbjct: 1   MGHKVNPIGLRLGVNRTWDSRWYA-GQDYARLLHEDLKLRAFLRRKLSGAGVSRVVIERP 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K  R+ +Y+ARPG++IGKKG DI+ +RK+LS M  +++ L++ E+ KPEI+ATL+A++I
Sbjct: 60  AKKPRVTIYAARPGVVIGKKGQDIDALRKELSRMAKTDVALNIVEIRKPEIDATLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRA+QSAMR GA G+++   GRL GAE++R E Y EGRVPL TLRA
Sbjct: 120 AQQLERRVAFRRAMKRAIQSAMRLGAQGIRITCGGRLGGAEIARAEKYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDYGTA A+T YG+CG+KV++  + E+   D   P A+ R   + +
Sbjct: 180 DIDYGTATAKTTYGTCGVKVWIF-KGEILAHD---PLAQDRRAAEQA 222


>gi|319899093|ref|YP_004159186.1| 30S ribosomal protein S3 [Bartonella clarridgeiae 73]
 gi|319403057|emb|CBI76612.1| 30S ribosomal protein S3 [Bartonella clarridgeiae 73]
          Length = 236

 Score =  279 bits (713), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 148/226 (65%), Positives = 180/226 (79%), Gaps = 3/226 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI  RLGVN TW+SRW+A   EYG LLHEDLKIR Y+   LKQA ++K++IER 
Sbjct: 1   MGQKINPIGLRLGVNRTWDSRWYADSDEYGRLLHEDLKIRLYVIEELKQAAISKVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CRI ++SARPGLIIGKKG DIEK+R+KLS MTN+E  L++ E+ KPEI++T+IAQSI
Sbjct: 61  HKKCRITIHSARPGLIIGKKGADIEKLRRKLSEMTNAETSLNIIEIRKPEIDSTIIAQSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA+G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAEGIRINCSGRLGGAEIARMEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            +DYGTA A+TAYG CG+KV+V  + E+ + D    A+E R  E D
Sbjct: 181 DVDYGTAEAKTAYGICGVKVWVF-KGEILEHDPM--ASERRATEGD 223


>gi|146281176|ref|YP_001171329.1| 30S ribosomal protein S3 [Pseudomonas stutzeri A1501]
 gi|152060896|sp|A4VHN6|RS3_PSEU5 RecName: Full=30S ribosomal protein S3
 gi|145569381|gb|ABP78487.1| ribosomal protein S3 [Pseudomonas stutzeri A1501]
 gi|327479329|gb|AEA82639.1| 30S ribosomal protein S3 [Pseudomonas stutzeri DSM 4166]
          Length = 228

 Score =  279 bits (713), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 113/228 (49%), Positives = 152/228 (66%), Gaps = 4/228 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+     S W+A G  Y   L  DL +REYLQ  LK A V++I I R 
Sbjct: 1   MGQKVHPTGIRLGIVKEHTSVWYADGRTYADYLLADLNVREYLQDKLKSASVSRIDIHRP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +  RI +++ARPG++IGKKG D+EK+R+ L+      +H+++ E+ KPE++A L+AQS+
Sbjct: 61  AQTARITIHTARPGIVIGKKGEDVEKLRQDLTKQMGVPVHINIEEIRKPELDAMLVAQSV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV+FRRAMKRAVQ+AMR GA G+K+  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVMFRRAMKRAVQNAMRIGAKGIKIQVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDS----DSTIPAAEHRVVE 224
            IDY T  A T YG  G+KV++   + +           PA   +  +
Sbjct: 181 DIDYNTYEAHTTYGVIGVKVWIFKGEVIGGRHEELKPQAPAPRKKAAK 228


>gi|254421013|ref|ZP_05034737.1| ribosomal protein S3 [Brevundimonas sp. BAL3]
 gi|196187190|gb|EDX82166.1| ribosomal protein S3 [Brevundimonas sp. BAL3]
          Length = 251

 Score =  279 bits (713), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 135/227 (59%), Positives = 174/227 (76%), Gaps = 4/227 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI  RLGVN TW+SRWFA G++Y  LLH+DLK+RE+L+  L  AGV++I+IER 
Sbjct: 1   MGQKINPIGLRLGVNRTWDSRWFAAGADYSRLLHQDLKLREWLRERLAAAGVSRIIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CRI +Y+ARPG++IGKKG DIEK+RK +S  T  E+HL++ EV KPE +A LIA++I
Sbjct: 61  HKKCRITIYAARPGVVIGKKGADIEKLRKDISAQTEGEVHLNIIEVRKPETDAQLIAENI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKR++QSAMR GA G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRSMQSAMRLGAKGIRMNVSGRLGGAEIARMEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDYG   A+T YG  G+KV+V  + EV + D   P A+ +   +++
Sbjct: 181 DIDYGFYEAKTTYGIIGVKVWVF-KGEVLEHD---PMAQDKRWAQEA 223


>gi|312115693|ref|YP_004013289.1| ribosomal protein S3 [Rhodomicrobium vannielii ATCC 17100]
 gi|311220822|gb|ADP72190.1| ribosomal protein S3 [Rhodomicrobium vannielii ATCC 17100]
          Length = 254

 Score =  278 bits (712), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 129/226 (57%), Positives = 172/226 (76%), Gaps = 1/226 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI  RLG+N TW+SRW+A   EYG LLHED +IRE++    +QAG++K++IER 
Sbjct: 1   MGQKVNPIGLRLGINRTWDSRWYADKGEYGRLLHEDFRIREFIMKQRRQAGISKVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           H+ CR+ V++ARPG++IGKKG DIEK+R +L+  T SE++L++ EV KPE++ATL A+ I
Sbjct: 61  HRKCRVTVHTARPGILIGKKGADIEKLRGQLAKFTTSEVYLNIVEVRKPELDATLAAEGI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRA QSA+R GA GV++  +GRL GAE++R E YL+GRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRATQSALRLGAQGVRIYVAGRLGGAEIARMEWYLDGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            IDYGTAVAETAYG  G+KV++  + E+ + D           ++ 
Sbjct: 181 DIDYGTAVAETAYGVIGVKVWIF-KGEILEHDPMAQERRSLESQES 225


>gi|154253183|ref|YP_001414007.1| 30S ribosomal protein S3 [Parvibaculum lavamentivorans DS-1]
 gi|171769631|sp|A7HWR7|RS3_PARL1 RecName: Full=30S ribosomal protein S3
 gi|154157133|gb|ABS64350.1| ribosomal protein S3 [Parvibaculum lavamentivorans DS-1]
          Length = 236

 Score =  278 bits (712), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 139/224 (62%), Positives = 181/224 (80%), Gaps = 3/224 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K+NPI  RLG+N TW+SRWFA   EYG LLHED+KIRE L+  LKQAG++KI+IER 
Sbjct: 1   MGHKVNPIGLRLGINRTWDSRWFAGRHEYGKLLHEDIKIREVLEKQLKQAGISKIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ +++ARPG++IGKKG DIEK+R+++  +T SE+HL++ EV KPEI+ATL+A++I
Sbjct: 61  HKKCRVAIHTARPGVVIGKKGADIEKLRREIGKITASEVHLNIVEVRKPEIDATLVAENI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA G+++  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAGGIRINCAGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVE 224
            IDYG A A+TAYG+CG+KV++  + E+ + D    A+E R +E
Sbjct: 181 DIDYGVATAKTAYGTCGVKVWIY-KGEILEHDPM--ASERRALE 221


>gi|89070551|ref|ZP_01157840.1| 30S ribosomal protein S3 [Oceanicola granulosus HTCC2516]
 gi|89043858|gb|EAR50056.1| 30S ribosomal protein S3 [Oceanicola granulosus HTCC2516]
          Length = 235

 Score =  278 bits (711), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 128/225 (56%), Positives = 172/225 (76%), Gaps = 4/225 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K+NPI  RL VN TW+SRW+A   +YG LL ED+KIRE+++   KQAG+++++IER 
Sbjct: 1   MGNKVNPIGMRLQVNRTWDSRWYADTKDYGDLLLEDIKIREFIKEECKQAGISRVIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           H+ CR+ +++ARPG+IIGKKG DIE +RKKL+ MT+SE+HL++ EV KPE++A L+ +SI
Sbjct: 61  HRKCRVTIHTARPGVIIGKKGADIETLRKKLAKMTDSELHLNIVEVRKPELDAALVGESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKR+VQ+AMR GA G++V  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVSFRRAMKRSVQNAMRMGALGIRVNVAGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDY  + A T YG  GIKV++  + E+ + D   P A  R  ++
Sbjct: 181 DIDYAHSEAVTPYGIIGIKVWIF-KGEIMEHD---PQARDRKAQE 221


>gi|257095034|ref|YP_003168675.1| 30S ribosomal protein S3 [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
 gi|257047558|gb|ACV36746.1| ribosomal protein S3 [Candidatus Accumulibacter phosphatis clade
           IIA str. UW-1]
          Length = 282

 Score =  278 bits (711), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 116/225 (51%), Positives = 161/225 (71%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V   W+SRW+A    +  +L+ED+K+REYL+  LK A V +ILIER 
Sbjct: 1   MGQKIHPAGFRLAVTRDWSSRWYANKKNFAGMLNEDIKVREYLKKKLKHASVGRILIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN R+ ++SARPG++IGKKG +I+ +R  L  +    +H+S+ E+ KPE++A LIA SI
Sbjct: 61  AKNARVTIFSARPGVVIGKKGEEIDHLRVALQKIMGVPVHVSIEEIRKPELDAQLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLE+R++FRRAMKRA+Q+AMR GA G+K+++SGRLNGAE++R E Y EGRVPL TLRA
Sbjct: 121 TQQLEKRIMFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGAEIARREWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDY T+ A T YG  G+KV+V   + ++  +    + E    E+
Sbjct: 181 DIDYATSEALTTYGLIGVKVWVFKGEILNRQEQAALSPEAAADER 225


>gi|319404419|emb|CBI78022.1| 30S ribosomal protein S3 [Bartonella rochalimae ATCC BAA-1498]
          Length = 236

 Score =  278 bits (710), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 146/226 (64%), Positives = 181/226 (80%), Gaps = 3/226 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI  RLGVN TW+SRW+A   EYG LLHED+KIR Y+   LKQA ++K++IER 
Sbjct: 1   MGQKINPIGLRLGVNRTWDSRWYADSGEYGRLLHEDVKIRLYVIEELKQAAISKVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CRI ++SARPGLIIGK+G DIEK+R+KLS MT++E  L++ E+ KPEI++T+IAQSI
Sbjct: 61  HKKCRITIHSARPGLIIGKRGADIEKLRRKLSEMTDAETSLNIVEIRKPEIDSTIIAQSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA+G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAEGIRINCSGRLGGAEIARMEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            +DYGTA A+TAYG CG+KV+V  + E+ + D    A+E R VE D
Sbjct: 181 DVDYGTAEAKTAYGICGVKVWVF-KGEILEHDPM--ASERRAVEGD 223


>gi|24981839|gb|AAN66090.1|AE016238_8 ribosomal protein S3 [Pseudomonas putida KT2440]
          Length = 237

 Score =  278 bits (710), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 114/228 (50%), Positives = 154/228 (67%), Gaps = 4/228 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+     S W+A G+ Y   L +DLK REYLQ  LK A V++I I R 
Sbjct: 10  MGQKVHPTGIRLGIVKEHTSVWYADGATYADYLLKDLKTREYLQDKLKSASVSRIDIHRP 69

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +  RI +++ARPG++IGKKG D+EK+R+ L+      +H+++ E+ KPE++A L+AQS+
Sbjct: 70  AQTARITIHTARPGIVIGKKGEDVEKLRQDLTKQMGVPVHINIEEIRKPELDAMLVAQSV 129

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV+FRRAMKRAVQ+AMR GA G+K+  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 130 AQQLERRVMFRRAMKRAVQNAMRIGAKGIKIQVSGRLGGAEIARTEWYREGRVPLHTLRA 189

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDS----DSTIPAAEHRVVE 224
            IDY T  A T YG  G+KV++   + +           PA   +  +
Sbjct: 190 DIDYNTYEAHTTYGVIGVKVWIFKGEVIGGRQEELKPQAPAPRKKAAK 237


>gi|299135251|ref|ZP_07028442.1| ribosomal protein S3 [Afipia sp. 1NLS2]
 gi|298590228|gb|EFI50432.1| ribosomal protein S3 [Afipia sp. 1NLS2]
          Length = 234

 Score =  278 bits (710), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 135/227 (59%), Positives = 176/227 (77%), Gaps = 4/227 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI  RLG+N TW+SRWFA   EY  LLHED++IRE L   LKQA VA+I+IER 
Sbjct: 1   MGQKINPIGLRLGINRTWDSRWFAGKGEYAKLLHEDVRIREVLMKELKQAAVARIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ VYSARPG++IGKKG DI+K++KK++ +T S++ +++ E+ KPE++ATL+A+SI
Sbjct: 61  HKKCRVSVYSARPGVVIGKKGADIDKLKKKVAEITQSDVVINIVEIRKPELDATLVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAQGIRINCSGRLGGAEIARMEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDYG A A T +G+CG+KV++  + E+ + D   P A+ + +   S
Sbjct: 181 DIDYGVATAFTTFGTCGVKVWLF-KGEILEHD---PMAQDKRLNDTS 223


>gi|240850829|ref|YP_002972229.1| 30S ribosomal protein S3 [Bartonella grahamii as4aup]
 gi|240267952|gb|ACS51540.1| 30S ribosomal protein S3 [Bartonella grahamii as4aup]
          Length = 236

 Score =  278 bits (710), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 148/226 (65%), Positives = 180/226 (79%), Gaps = 3/226 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI  RLGVN TW+SRW+A   EYG LLHEDLKIR Y+   LKQA ++K++IER 
Sbjct: 1   MGQKINPIGLRLGVNRTWDSRWYADSGEYGRLLHEDLKIRSYVLEELKQAAISKVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CRI ++SARPGLIIGKKG DIEK+R+KLS MT++E  L++ E+ KPEI+AT+IAQSI
Sbjct: 61  HKKCRITIHSARPGLIIGKKGADIEKLRRKLSEMTDAETSLNIVEIRKPEIDATIIAQSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA+G+++  SGRL GAE++R E Y EGRVPL TLR+
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAEGIRINCSGRLGGAEIARMEWYREGRVPLHTLRS 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            +DYGTA A+TAYG CGIKV+V  + E+ + D    A+E R  E D
Sbjct: 181 DVDYGTAEAKTAYGICGIKVWVF-KGEILEHDPM--ASERRATEVD 223


>gi|329850213|ref|ZP_08265058.1| ribosomal protein S3 [Asticcacaulis biprosthecum C19]
 gi|328840528|gb|EGF90099.1| ribosomal protein S3 [Asticcacaulis biprosthecum C19]
          Length = 253

 Score =  278 bits (710), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 129/227 (56%), Positives = 172/227 (75%), Gaps = 4/227 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK NPI  RLG+N TW+SRWFA+  EY  LLH+DL IR+ L+  L  AGV++I+IER 
Sbjct: 1   MGQKANPIGLRLGINRTWDSRWFAQRQEYAKLLHQDLLIRKVLKEKLNAAGVSRIIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CRI +Y+ARPG++IGKKG DI+K+RK +S +T+ E+ L++ EV KPE++A L+A+SI
Sbjct: 61  HKKCRITIYAARPGVVIGKKGADIDKLRKDVSVITDGEVFLNLVEVRKPEVDAQLVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKR++QSAMR GA G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRSIQSAMRLGAKGIRMNLSGRLGGAEIARMEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            ID G A A T YG  G+KV++  + EV + D   P+A+ +   +++
Sbjct: 181 DIDMGFAEALTTYGIIGVKVWIF-KGEVLEHD---PSAQDKRWAQEA 223


>gi|302382624|ref|YP_003818447.1| ribosomal protein S3 [Brevundimonas subvibrioides ATCC 15264]
 gi|302193252|gb|ADL00824.1| ribosomal protein S3 [Brevundimonas subvibrioides ATCC 15264]
          Length = 250

 Score =  278 bits (710), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 133/227 (58%), Positives = 170/227 (74%), Gaps = 4/227 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI FRLGVN TW+SRWFA G  Y  LLH+DL +R +L+  L  AGV++I+IER 
Sbjct: 1   MGQKINPIGFRLGVNRTWDSRWFADGPSYARLLHQDLALRTWLKERLNAAGVSRIIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ +Y+ARPG++IGKKG DIEK+RK +S  T  E+HL++ EV KPE +A LIA++I
Sbjct: 61  HKKCRVTIYAARPGVVIGKKGADIEKLRKDISARTEGEVHLNIVEVRKPETDAQLIAENI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERR+ FRRAMKR++QSAMR GA GV++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRIAFRRAMKRSMQSAMRLGAKGVRINVSGRLGGAEIARMEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDYG   A+T YG  G+KV+V  + EV + D   P A+ +    ++
Sbjct: 181 DIDYGFIEAKTTYGIIGVKVWVF-KGEVLEHD---PMAQDKRWALEA 223


>gi|307946292|ref|ZP_07661627.1| ribosomal protein S3 [Roseibium sp. TrichSKD4]
 gi|307769956|gb|EFO29182.1| ribosomal protein S3 [Roseibium sp. TrichSKD4]
          Length = 242

 Score =  277 bits (709), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 136/227 (59%), Positives = 173/227 (76%), Gaps = 4/227 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K+NPI  RLG+N TW+SRWFA   EYG LLHED +IRE+L   LKQA V+KI+IER 
Sbjct: 1   MGHKVNPIGMRLGINRTWDSRWFAPKGEYGGLLHEDFRIREFLMNELKQAAVSKIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK  R+ ++S RPG++IGKKG DIE++RKK++++T SE+H+++ EV KPE++ATL+A SI
Sbjct: 61  HKKARVTIHSGRPGVVIGKKGADIERLRKKIADITKSEVHINIVEVRKPEVDATLVAASI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKR+VQSAMR GA G+K+   GRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRSVQSAMRLGAQGIKITCGGRLGGAEIARIEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDYG A A TAYG CG+KV++  + E+ + D   P A  R   + S
Sbjct: 181 DIDYGVASAHTAYGVCGVKVWIF-KGEILEHD---PMASERRATQGS 223


>gi|170738697|ref|YP_001767352.1| ribosomal protein S3 [Methylobacterium sp. 4-46]
 gi|168192971|gb|ACA14918.1| ribosomal protein S3 [Methylobacterium sp. 4-46]
          Length = 252

 Score =  277 bits (709), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 132/226 (58%), Positives = 174/226 (76%), Gaps = 4/226 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI  RLG+N TW+SRW+A   EY  L+HED+ IR+ L   LKQA V+KI+IER 
Sbjct: 1   MGQKVNPIGLRLGINRTWDSRWYANKGEYARLMHEDVAIRQALMKQLKQAAVSKIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           H+ CR+ ++S RPG++IGKKG DIEK+RK +  MT +++ +++ EV KPEI+ATL+A SI
Sbjct: 61  HRKCRVTIHSGRPGVVIGKKGADIEKLRKLVGTMTKADVTINIIEVRKPEIDATLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA+G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAEGIRINCSGRLGGAEIARLEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            +DYGTA A T YG+CGIKV+V  + E+ + D   P A+ +  +++
Sbjct: 181 DVDYGTATAFTTYGTCGIKVWVF-KGEILEHD---PMAQDKRAQEE 222


>gi|148545745|ref|YP_001265847.1| 30S ribosomal protein S3 [Pseudomonas putida F1]
 gi|161378146|ref|NP_742626.2| 30S ribosomal protein S3 [Pseudomonas putida KT2440]
 gi|167031506|ref|YP_001666737.1| 30S ribosomal protein S3 [Pseudomonas putida GB-1]
 gi|170723900|ref|YP_001751588.1| 30S ribosomal protein S3 [Pseudomonas putida W619]
 gi|325272013|ref|ZP_08138457.1| 30S ribosomal protein S3 [Pseudomonas sp. TJI-51]
 gi|34098362|sp|Q88QM9|RS3_PSEPK RecName: Full=30S ribosomal protein S3
 gi|172048429|sp|A5VXQ3|RS3_PSEP1 RecName: Full=30S ribosomal protein S3
 gi|148509803|gb|ABQ76663.1| SSU ribosomal protein S3P [Pseudomonas putida F1]
 gi|166857994|gb|ABY96401.1| ribosomal protein S3 [Pseudomonas putida GB-1]
 gi|169761903|gb|ACA75219.1| ribosomal protein S3 [Pseudomonas putida W619]
 gi|313496825|gb|ADR58191.1| RpsC [Pseudomonas putida BIRD-1]
 gi|324102844|gb|EGC00247.1| 30S ribosomal protein S3 [Pseudomonas sp. TJI-51]
          Length = 228

 Score =  277 bits (709), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 114/228 (50%), Positives = 154/228 (67%), Gaps = 4/228 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+     S W+A G+ Y   L +DLK REYLQ  LK A V++I I R 
Sbjct: 1   MGQKVHPTGIRLGIVKEHTSVWYADGATYADYLLKDLKTREYLQDKLKSASVSRIDIHRP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +  RI +++ARPG++IGKKG D+EK+R+ L+      +H+++ E+ KPE++A L+AQS+
Sbjct: 61  AQTARITIHTARPGIVIGKKGEDVEKLRQDLTKQMGVPVHINIEEIRKPELDAMLVAQSV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV+FRRAMKRAVQ+AMR GA G+K+  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVMFRRAMKRAVQNAMRIGAKGIKIQVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDS----DSTIPAAEHRVVE 224
            IDY T  A T YG  G+KV++   + +           PA   +  +
Sbjct: 181 DIDYNTYEAHTTYGVIGVKVWIFKGEVIGGRQEELKPQAPAPRKKAAK 228


>gi|302344350|ref|YP_003808879.1| ribosomal protein S3 [Desulfarculus baarsii DSM 2075]
 gi|301640963|gb|ADK86285.1| ribosomal protein S3 [Desulfarculus baarsii DSM 2075]
          Length = 219

 Score =  277 bits (709), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 114/218 (52%), Positives = 155/218 (71%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI FRLGV  TW+SRWFA   +Y  L+ ED +IR++L+  L  AGV+ I IER 
Sbjct: 1   MGQKVNPIGFRLGVIRTWDSRWFANKRDYAGLVFEDHQIRKFLKKKLFHAGVSHIEIERA 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               +I +++ARPG++IGKKG++IE ++K L  +   E+ L ++EV KPE++A L+A+S+
Sbjct: 61  ANKAKIRIHTARPGIVIGKKGSEIESVKKALEQLIKREVMLDIHEVRKPEVDAQLVAESV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERR+ FRRAMKRAV +A++ GA G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 ASQLERRIAFRRAMKRAVTTALKLGAQGIRIQCSGRLGGAEMARREWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAA 218
            IDYG A A T YG  G+KV +   + + D D T   A
Sbjct: 181 DIDYGFAEARTTYGVIGVKVLIFKGEVLDDRDKTQAQA 218


>gi|319405892|emb|CBI79524.1| 30S ribosomal protein S3 [Bartonella sp. AR 15-3]
          Length = 236

 Score =  277 bits (709), Expect = 8e-73,   Method: Composition-based stats.
 Identities = 147/226 (65%), Positives = 180/226 (79%), Gaps = 3/226 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI  RLG+N TW+SRW+A   EYG LLHED+KIR Y+   LKQA V+K++IER 
Sbjct: 1   MGQKINPIGLRLGINRTWDSRWYADSGEYGRLLHEDVKIRLYIIEELKQAAVSKVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CRI V+SARPGLIIGK+G DIEK+R+KLS MT++E  L++ E+ KPEI+AT+IAQSI
Sbjct: 61  HKKCRITVHSARPGLIIGKRGADIEKLRRKLSEMTDAETSLNIVEIRKPEIDATIIAQSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA+G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAEGIRINCSGRLGGAEIARMEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            +DYGTA A+TAYG CG+KV+V  + E+ + D    A+E R  E D
Sbjct: 181 DVDYGTAEAKTAYGICGVKVWVF-KGEILEHDPM--ASERRATEGD 223


>gi|163739444|ref|ZP_02146854.1| 30S ribosomal protein S3 [Phaeobacter gallaeciensis BS107]
 gi|163740238|ref|ZP_02147632.1| 30S ribosomal protein S3 [Phaeobacter gallaeciensis 2.10]
 gi|161386096|gb|EDQ10471.1| 30S ribosomal protein S3 [Phaeobacter gallaeciensis 2.10]
 gi|161387197|gb|EDQ11556.1| 30S ribosomal protein S3 [Phaeobacter gallaeciensis BS107]
          Length = 235

 Score =  277 bits (709), Expect = 8e-73,   Method: Composition-based stats.
 Identities = 128/225 (56%), Positives = 172/225 (76%), Gaps = 4/225 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K+NP+  RL VN TW+SRW+A   +YG LL EDL+IR++++   KQAG+A+++IER 
Sbjct: 1   MGHKVNPVGMRLQVNRTWDSRWYADTKDYGDLLLEDLRIRDFIKEECKQAGIARVIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ +++ARPG+IIGKKG DIE +RKKL++MT+SE+HL++ EV KPE++A L+ +SI
Sbjct: 61  HKKCRVTIHTARPGVIIGKKGADIEVLRKKLASMTDSELHLNIVEVRKPELDAQLVGESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQ+AMR GA G++V  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVSFRRAMKRAVQNAMRMGALGIRVNVAGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDY  + A T YG  GIK ++  + E+ + D   P A  R  ++
Sbjct: 181 DIDYAHSEAMTPYGIIGIKTWIF-KGEIMEHD---PQARDRKAQE 221


>gi|260577175|ref|ZP_05845152.1| ribosomal protein S3 [Rhodobacter sp. SW2]
 gi|259020649|gb|EEW23968.1| ribosomal protein S3 [Rhodobacter sp. SW2]
          Length = 236

 Score =  277 bits (709), Expect = 8e-73,   Method: Composition-based stats.
 Identities = 130/227 (57%), Positives = 168/227 (74%), Gaps = 1/227 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI  RL VN TW+SRWFA   +YG LL EDLK+R ++    KQAGV+K++IER 
Sbjct: 1   MGQKVNPIGMRLQVNRTWDSRWFAESKDYGNLLLEDLKMRAFIHEECKQAGVSKVIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ +++ARPG+IIGKKG DIE +RKKL+  T SE+HL++ EV KPE++A L+A+SI
Sbjct: 61  HKKCRVTIHTARPGVIIGKKGADIETLRKKLTVFTKSELHLNIVEVRKPELDAQLVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLERRV FRRAMKRAVQ+AMR GA G++V  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 TQQLERRVSFRRAMKRAVQNAMRIGALGIRVNVSGRLGGAEIARVEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDY  + A TAYG  G+KV++  + E+ + D       H   ++ +
Sbjct: 181 DIDYALSEAMTAYGIIGVKVWIF-KGEILEHDPQAHDRRHAEAQEGA 226


>gi|114327224|ref|YP_744381.1| 30S ribosomal protein S3 [Granulibacter bethesdensis CGDNIH1]
 gi|122327797|sp|Q0BUP4|RS3_GRABC RecName: Full=30S ribosomal protein S3
 gi|114315398|gb|ABI61458.1| SSU ribosomal protein S3P [Granulibacter bethesdensis CGDNIH1]
          Length = 225

 Score =  277 bits (709), Expect = 8e-73,   Method: Composition-based stats.
 Identities = 124/227 (54%), Positives = 170/227 (74%), Gaps = 5/227 (2%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K+NPI  RLG+N TW+SRW+A G +Y  LLH+DLK+R +L+  L  AGV++++IER 
Sbjct: 1   MGHKVNPIGLRLGINRTWDSRWYAGG-DYSRLLHDDLKLRGHLRKKLSGAGVSRVVIERP 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K  R+ +Y+ARPG++IGKKG DIE +RK L+ M  +++ L++ E+ KPEI+ATL+A++I
Sbjct: 60  AKKPRVTIYAARPGVVIGKKGQDIEALRKGLTGMAGTDVALNIVEIRKPEIDATLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 120 AQQLERRVAFRRAMKRAVQSAMRLGAQGIRINCSGRLGGAEIARIEWYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDYG A A+T YG+CG+KV++   + ++      P A+ R   + +
Sbjct: 180 DIDYGVATAKTTYGTCGVKVWIFKGEILAQD----PMAQDRRAAEQA 222


>gi|114771263|ref|ZP_01448683.1| 30S ribosomal protein S3 [alpha proteobacterium HTCC2255]
 gi|114548188|gb|EAU51075.1| 30S ribosomal protein S3 [alpha proteobacterium HTCC2255]
          Length = 239

 Score =  277 bits (708), Expect = 9e-73,   Method: Composition-based stats.
 Identities = 136/225 (60%), Positives = 177/225 (78%), Gaps = 4/225 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI FRL VN TW+SRW+A G +YG+LL ED+KIRE+++    QAGVA++++ER 
Sbjct: 1   MGQKINPIGFRLQVNRTWDSRWYAEGDKYGSLLLEDIKIREFVKKECVQAGVARVIVERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ ++SARPG+IIGKKG DIE +RKKL+  T+SE+HL++ EV KPE++A L+A+S+
Sbjct: 61  HKKCRVTIHSARPGVIIGKKGADIETLRKKLAAFTDSELHLNIVEVRKPEMDAQLVAESV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQ+AMR GA G+++  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVSFRRAMKRAVQNAMRMGALGIRINVAGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDY  A   TAYG  GIKV++  + E+ + D   PAA  R +E+
Sbjct: 181 DIDYARAEGMTAYGIIGIKVWIF-KGEIMEHD---PAARDRRIEE 221


>gi|167629473|ref|YP_001679972.1| 30S ribosomal protein s3 [Heliobacterium modesticaldum Ice1]
 gi|167592213|gb|ABZ83961.1| 30S ribosomal protein s3 [Heliobacterium modesticaldum Ice1]
          Length = 251

 Score =  277 bits (708), Expect = 9e-73,   Method: Composition-based stats.
 Identities = 101/220 (45%), Positives = 154/220 (70%), Gaps = 1/220 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   R+G+   W++RWFA G  Y  LLHEDLKIR++++  L  AG+ +I IER 
Sbjct: 1   MGQKVNPKGLRIGIIKDWDARWFA-GKNYAELLHEDLKIRKFVKSKLYAAGIPRIEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               ++ +++A+PG++IG+ G ++E +RK+L  MT   +++++ EV KPE++A L+A+++
Sbjct: 60  ANRVKVTIHTAKPGIVIGRGGAEVENLRKELEKMTGRAVNINIAEVKKPELDAQLVAENV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLE+R  FRRAMK++V   MR GA+G+K++ SGRL GAE++RTE Y EG+VPL TLRA
Sbjct: 120 AAQLEKRTSFRRAMKQSVGRTMRLGAEGIKIMVSGRLGGAEIARTEWYNEGKVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEH 220
            IDYG A A T YG  G+KV++   + +  + +    +  
Sbjct: 180 DIDYGFAEARTTYGIIGVKVWIYKGEILPGAKNRTGESRE 219


>gi|16125503|ref|NP_420067.1| 30S ribosomal protein S3 [Caulobacter crescentus CB15]
 gi|221234249|ref|YP_002516685.1| 30S ribosomal protein S3 [Caulobacter crescentus NA1000]
 gi|27734530|sp|Q9A8U7|RS3_CAUCR RecName: Full=30S ribosomal protein S3
 gi|254764520|sp|B8H4E0|RS3_CAUCN RecName: Full=30S ribosomal protein S3
 gi|13422585|gb|AAK23235.1| ribosomal protein S3 [Caulobacter crescentus CB15]
 gi|220963421|gb|ACL94777.1| SSU ribosomal protein S3P [Caulobacter crescentus NA1000]
          Length = 250

 Score =  277 bits (708), Expect = 9e-73,   Method: Composition-based stats.
 Identities = 128/226 (56%), Positives = 172/226 (76%), Gaps = 3/226 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP+  RLG+N TW+SRWFA G++YG LLH+DL +R  L+  L QAGV++I+IER 
Sbjct: 1   MGQKVNPVGLRLGINRTWDSRWFADGNQYGKLLHQDLAVRAALKKRLYQAGVSRIIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ +Y+ARPG+IIGKKG DI+K+RK LS MT  E+HL++ E+ KPE +A L+A+SI
Sbjct: 61  HKKCRVTIYAARPGVIIGKKGADIDKLRKDLSIMTEGEVHLNIVEIRKPETDAQLVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERR+ FRRAMKR++QSA+R GA G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRIAFRRAMKRSIQSAVRLGAKGIRINVSGRLGGAEIARMEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            ID+G A A+T YG  G+K ++  + EV + D    A + R+  + 
Sbjct: 181 DIDFGFAEAKTTYGIIGVKTWIF-KGEVLEHDPM--ALDKRLATES 223


>gi|94498482|ref|ZP_01305038.1| 30S ribosomal protein S3 [Sphingomonas sp. SKA58]
 gi|94422025|gb|EAT07070.1| 30S ribosomal protein S3 [Sphingomonas sp. SKA58]
          Length = 231

 Score =  277 bits (708), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 127/215 (59%), Positives = 164/215 (76%), Gaps = 1/215 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K NPI  RL +N TW+SRWFA G +YG LL EDLKIR+Y+   L QA ++K++IER 
Sbjct: 1   MGHKSNPIGLRLQINRTWDSRWFAEGQDYGRLLLEDLKIRQYIMKTLPQAAISKVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K CR+ +Y+ARPG+IIGKKG DIEK+RKKL N+T+S++ L++ E+ KPE+++ L+AQ I
Sbjct: 61  AKLCRVSIYAARPGVIIGKKGADIEKLRKKLGNLTSSDVSLNIVEIRKPEVDSKLVAQGI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV FRRAMKRAVQSA+R GA+G+K+   GRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 ADQLERRVAFRRAMKRAVQSALRLGAEGIKITCGGRLGGAEIARVEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTI 215
           ++DY  A A TAYG CGIKV++  + E+   D   
Sbjct: 181 NVDYAEATAHTAYGVCGIKVWIF-KGEILGHDPMA 214


>gi|163733819|ref|ZP_02141261.1| 30S ribosomal protein S3 [Roseobacter litoralis Och 149]
 gi|161392930|gb|EDQ17257.1| 30S ribosomal protein S3 [Roseobacter litoralis Och 149]
          Length = 235

 Score =  276 bits (707), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 129/225 (57%), Positives = 170/225 (75%), Gaps = 4/225 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K+NPI  RL VN TW+SRW+A   +YG LL EDL IR++++    QAGVA+++IER 
Sbjct: 1   MGNKVNPIGMRLQVNRTWDSRWYADTKDYGDLLLEDLAIRDFIKKECHQAGVARVIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ +++ARPG+IIGKKG DIE +R+K++ MT SE+HL++ EV KPE++A L+ +SI
Sbjct: 61  HKKCRVTIHTARPGVIIGKKGADIEGLRQKIAKMTASELHLNIVEVRKPELDAALVGESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQ+AMR GA G++V  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVSFRRAMKRAVQNAMRMGALGIRVNVAGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDY    A+TAYG  GIK ++  + E+ + D   PAA  R  ++
Sbjct: 181 DIDYAHVEAKTAYGIIGIKTWIF-KGEIMEHD---PAARDRKAQE 221


>gi|304391459|ref|ZP_07373401.1| ribosomal protein S3 [Ahrensia sp. R2A130]
 gi|303295688|gb|EFL90046.1| ribosomal protein S3 [Ahrensia sp. R2A130]
          Length = 236

 Score =  276 bits (707), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 127/225 (56%), Positives = 173/225 (76%), Gaps = 1/225 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI FRLG+N TW+SRWFA   +Y ++L ED+ IR Y++  LK A ++K++IER 
Sbjct: 1   MGQKINPIGFRLGINRTWDSRWFATKGDYASMLDEDINIRNYIEKELKAASISKVIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ +++ RPGLIIGKKG DIEK+++K+  MT++E+ +++ E+ KPE++AT++AQSI
Sbjct: 61  HKKCRVTIHAGRPGLIIGKKGADIEKLKRKVQTMTSAEVSVNIVEIRKPELDATIVAQSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKR+VQSA+R GA G+++   GRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRSVQSAIRLGAQGIRINCGGRLGGAEIARVEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDYGTA AETAYG CG+KV++  + E+ + D       H   ++
Sbjct: 181 DIDYGTAEAETAYGICGVKVWIF-KGEILEHDPMAHERRHTEAQE 224


>gi|110678727|ref|YP_681734.1| 30S ribosomal protein S3 [Roseobacter denitrificans OCh 114]
 gi|123065752|sp|Q16AE5|RS3_ROSDO RecName: Full=30S ribosomal protein S3
 gi|109454843|gb|ABG31048.1| ribosomal protein S3 [Roseobacter denitrificans OCh 114]
          Length = 235

 Score =  276 bits (707), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 129/225 (57%), Positives = 169/225 (75%), Gaps = 4/225 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K+NPI  RL VN TW+SRW+A   +YG LL EDL IR++++    QAGVA+++IER 
Sbjct: 1   MGNKVNPIGMRLQVNRTWDSRWYADTKDYGDLLLEDLAIRDFIKKECHQAGVARVIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ +++ARPG+IIGKKG DIE +R+K++ MT SE+HL++ EV KPE++A L+ +SI
Sbjct: 61  HKKCRVTIHTARPGVIIGKKGADIEGLRQKIAKMTASELHLNIVEVRKPELDAALVGESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQ+AMR GA G++V  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVSFRRAMKRAVQNAMRMGALGIRVNVAGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDY    A TAYG  GIK ++  + E+ + D   PAA  R  ++
Sbjct: 181 DIDYAHVEAATAYGIIGIKTWIF-KGEIMEHD---PAARDRKAQE 221


>gi|308047997|ref|YP_003911563.1| 30S ribosomal protein S3P [Ferrimonas balearica DSM 9799]
 gi|307630187|gb|ADN74489.1| SSU ribosomal protein S3P [Ferrimonas balearica DSM 9799]
          Length = 229

 Score =  276 bits (707), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 107/226 (47%), Positives = 153/226 (67%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   W+S W+A   +Y   L  D ++R++L+  LK A V++I IER 
Sbjct: 1   MGQKVHPNGIRLGITKPWSSTWYAEKKDYADNLFSDHEVRQFLKQELKNASVSRITIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R K++ +      ++++EV KPE++A L+  S+
Sbjct: 61  AKSIRVTIHTARPGVVIGKKGEDVEKLRLKVAKLAGVPAQINISEVRKPELDAQLVGDSV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+K+  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQNAMRLGAKGIKIEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            IDY T+ A T YG  GIKV++   + +          + +   K 
Sbjct: 181 DIDYATSEAHTTYGVIGIKVWIFKGEVLGGMPVVAEEPKAQPKRKG 226


>gi|39997943|ref|NP_953894.1| 30S ribosomal protein S3 [Geobacter sulfurreducens PCA]
 gi|61215646|sp|Q748Z4|RS3_GEOSL RecName: Full=30S ribosomal protein S3
 gi|39984888|gb|AAR36244.1| ribosomal protein S3 [Geobacter sulfurreducens PCA]
 gi|298506882|gb|ADI85605.1| ribosomal protein S3 [Geobacter sulfurreducens KN400]
          Length = 211

 Score =  276 bits (707), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 116/212 (54%), Positives = 161/212 (75%), Gaps = 1/212 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP+ FRLGV  TW+SRW+A  ++Y  LLHEDLK+R +L+  L  +GV+KI IER 
Sbjct: 1   MGQKVNPVGFRLGVIRTWDSRWYAE-ADYSKLLHEDLKLRNFLKKRLYNSGVSKIEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               +I +Y+ARPGLIIGKKG ++E ++K+L+ +T+ EI+L++ EV KPE++A L+A+++
Sbjct: 60  ANKAKINIYTARPGLIIGKKGAEVETLKKELAKLTDKEIYLNIQEVRKPELDAQLVAENV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV FRRAMK++V S+++FGA G+++  SGRL GAE+SRTE Y EGRVPL TLRA
Sbjct: 120 ALQLERRVAFRRAMKKSVTSSLKFGAKGIRITCSGRLGGAEMSRTEWYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSD 212
            IDYG A A+T YG  G+KV +   + +    
Sbjct: 180 DIDYGFAEAKTTYGIIGVKVLIFKGEVLPGQK 211


>gi|104779761|ref|YP_606259.1| 30S ribosomal protein S3 [Pseudomonas entomophila L48]
 gi|123381068|sp|Q1IFW0|RS3_PSEE4 RecName: Full=30S ribosomal protein S3
 gi|95108748|emb|CAK13442.1| 30S ribosomal subunit protein S3 [Pseudomonas entomophila L48]
          Length = 228

 Score =  276 bits (707), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 113/228 (49%), Positives = 154/228 (67%), Gaps = 4/228 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+     S W+A G+ Y   L +DL+ REYLQ  LK A V++I I R 
Sbjct: 1   MGQKVHPTGIRLGIVKEHTSVWYADGATYADYLLKDLQTREYLQDKLKSASVSRIDIHRP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +  RI +++ARPG++IGKKG D+EK+R+ L+      +H+++ E+ KPE++A L+AQS+
Sbjct: 61  AQTARITIHTARPGIVIGKKGEDVEKLRQDLTKQMGVPVHINIEEIRKPELDAMLVAQSV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV+FRRAMKRAVQ+AMR GA G+K+  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVMFRRAMKRAVQNAMRIGAKGIKIQVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDS----DSTIPAAEHRVVE 224
            IDY T  A T YG  G+KV++   + +           PA   +  +
Sbjct: 181 DIDYNTYEAHTTYGVIGVKVWIFKGEVIGGRQEELKPQAPAPRKKAAK 228


>gi|319408759|emb|CBI82416.1| 30S ribosomal protein S3 [Bartonella schoenbuchensis R1]
          Length = 236

 Score =  276 bits (707), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 149/226 (65%), Positives = 182/226 (80%), Gaps = 3/226 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI  RLGVN TW+SRW+A   EYG LLHEDLKIR Y+   LKQA ++K++IER 
Sbjct: 1   MGQKINPIGLRLGVNRTWDSRWYADSGEYGRLLHEDLKIRLYVIEELKQAAISKVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CRII++SARPGLIIGKKG DIEK+R KLS MTN+E  L++ E+ KPEI+AT+IAQSI
Sbjct: 61  HKKCRIIIHSARPGLIIGKKGADIEKLRCKLSEMTNAETSLNIVEIRKPEIDATIIAQSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA+G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAEGIRINCSGRLGGAEIARMEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            +DYGTA A+TAYG CG+KV+V  + E+ + +    A+E+R +E D
Sbjct: 181 DVDYGTAEAKTAYGICGVKVWVF-KGEILEHNPM--ASENRAMESD 223


>gi|114570339|ref|YP_757019.1| 30S ribosomal protein S3P [Maricaulis maris MCS10]
 gi|122315789|sp|Q0ANQ6|RS3_MARMM RecName: Full=30S ribosomal protein S3
 gi|114340801|gb|ABI66081.1| SSU ribosomal protein S3P [Maricaulis maris MCS10]
          Length = 234

 Score =  276 bits (707), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 135/226 (59%), Positives = 173/226 (76%), Gaps = 4/226 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI  RLGVN TW SRW+A   EY  LLHED+KIR+ L+  LK A V+KI+IER 
Sbjct: 1   MGQKVNPIGLRLGVNRTWESRWYAGAGEYAKLLHEDIKIRKMLKERLKNASVSKIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ V++ARPG++IGKKG+DIE +RK+LS M + E+HL++ EV KPEI+A L+A+SI
Sbjct: 61  HKKCRVTVHTARPGVVIGKKGSDIETLRKELSKMIDGEVHLNLVEVRKPEIDAALVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKR++QSAMR GA G K++  GRL GAE++RTE Y EG VPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRSMQSAMRMGAKGCKIVCGGRLGGAEIARTEQYNEGSVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            IDYGT  A+TA G  GIKV++  + E+ + D   P A+ R +++ 
Sbjct: 181 DIDYGTCEAKTAMGIIGIKVWIY-KGEIMEHD---PNAQERRLQES 222


>gi|115376080|ref|ZP_01463325.1| ribosomal protein S3 [Stigmatella aurantiaca DW4/3-1]
 gi|310821000|ref|YP_003953358.1| 30S ribosomal protein S3 [Stigmatella aurantiaca DW4/3-1]
 gi|115366895|gb|EAU65885.1| ribosomal protein S3 [Stigmatella aurantiaca DW4/3-1]
 gi|309394072|gb|ADO71531.1| 30S ribosomal protein S3 [Stigmatella aurantiaca DW4/3-1]
          Length = 220

 Score =  276 bits (706), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 111/221 (50%), Positives = 154/221 (69%), Gaps = 1/221 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI FRLGV  TW+S+WF     Y   LHED++IRE+++  L  AGV+K+ IER 
Sbjct: 1   MGQKVHPIGFRLGVIKTWDSKWF-EHKNYAQWLHEDIRIREFVKKSLNHAGVSKVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               ++ V++ARPG++IGK+G  IE ++K L   T +E+ L++ EV K E +A L+A++I
Sbjct: 60  ANKVKVNVHTARPGIVIGKRGAGIETVKKDLQQFTKNEVFLNIVEVRKAETDAQLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERR+ FRRAMK+A+Q+AM+FGA G++V  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 120 ATQLERRIAFRRAMKKALQTAMKFGAKGIRVACSGRLGGAEMARYEWYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHR 221
            IDYG A A+T YG  G KV++   + +       P   +R
Sbjct: 180 DIDYGFAEAKTTYGKIGCKVWICRGEVLPGKGGQAPLPSNR 220


>gi|258512664|ref|YP_003186098.1| 30S ribosomal protein S3 [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
 gi|257479390|gb|ACV59709.1| ribosomal protein S3 [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
          Length = 226

 Score =  276 bits (706), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 105/226 (46%), Positives = 153/226 (67%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI  R+G+   W ++W+A   +Y  LLHEDLKIR Y+   LK A +  + IER 
Sbjct: 1   MGQKVNPIGLRIGIIRDWEAKWYANKKDYQELLHEDLKIRNYVMQRLKDAAIGSVEIERA 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                + +++A+PG++IGK G +++ +R +L+ +T   +H+S++E+ +P++ A L+A+SI
Sbjct: 61  ANRINVTIHTAKPGMVIGKGGQEVDALRNELNKLTGKRVHISISEIKQPDLCAKLVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMK+A+Q +MR GA GV+V  SGRL GAE++RTE Y+EG VPLQTLRA
Sbjct: 121 AQQLERRVAFRRAMKQAIQRSMRAGAKGVRVQVSGRLGGAEIARTEGYVEGTVPLQTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            IDY  A A T YG  G+KV++   + +    +    A    V+  
Sbjct: 181 DIDYALAEAHTTYGRIGVKVWIYRGEVLPKRKNAQAEAASEAVQGG 226


>gi|83949789|ref|ZP_00958522.1| 30S ribosomal protein S3 [Roseovarius nubinhibens ISM]
 gi|83837688|gb|EAP76984.1| 30S ribosomal protein S3 [Roseovarius nubinhibens ISM]
          Length = 235

 Score =  276 bits (706), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 129/225 (57%), Positives = 171/225 (76%), Gaps = 4/225 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K+NPI  RL VN TW+SRW+A   +YG LL ED+ IRE+++   KQAG+++++IER 
Sbjct: 1   MGNKVNPIGMRLQVNRTWDSRWYANTKDYGNLLLEDIAIREFIEKECKQAGISRVIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ +++ARPG+IIGKKG DIE +RKKL+ MT+SE+HL++ EV KPE++A L+  SI
Sbjct: 61  HKKCRVTIHTARPGVIIGKKGADIETLRKKLAAMTDSELHLNIVEVRKPELDAALVGDSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQ+AMR GA G++V  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVSFRRAMKRAVQNAMRMGALGIRVNVAGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDY  + A T YG  GIKV++  + E+ + D   P+A  R  ++
Sbjct: 181 DIDYAHSEAMTPYGIIGIKVWIF-KGEIMEHD---PSARDRKAQE 221


>gi|331005020|ref|ZP_08328427.1| SSU ribosomal protein S3p (S3e) [gamma proteobacterium IMCC1989]
 gi|330421186|gb|EGG95445.1| SSU ribosomal protein S3p (S3e) [gamma proteobacterium IMCC1989]
          Length = 228

 Score =  276 bits (706), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 105/224 (46%), Positives = 155/224 (69%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+     S W+A  +EY   LH DL +R+Y++  L  A V+++ IER 
Sbjct: 1   MGQKVHPTGIRLGIVKKHTSTWYANSNEYADKLHADLSVRKYIETKLASASVSRVDIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               ++ +++ARPG++IGKKG D+EK+R ++S +    +H+++ E+ KP+++A L+A+S+
Sbjct: 61  ANTAKVTIHTARPGIVIGKKGEDVEKLRNEVSKIMGVPVHINIEEIRKPDLDAKLVAESV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+K+   GRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQNAMRQGAQGIKIQVGGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVE 224
            IDY TA A T YG  G+KV++   + + D     PA + +  +
Sbjct: 181 DIDYSTAEAATTYGIIGVKVWIFKGEVIGDVVDAEPAPKKKNSK 224


>gi|49475788|ref|YP_033829.1| 30S ribosomal protein S3 [Bartonella henselae str. Houston-1]
 gi|61215538|sp|Q6G2X1|RS3_BARHE RecName: Full=30S ribosomal protein S3
 gi|49238595|emb|CAF27836.1| 30S ribosomal protein s3 [Bartonella henselae str. Houston-1]
          Length = 236

 Score =  276 bits (706), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 145/225 (64%), Positives = 175/225 (77%), Gaps = 4/225 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI  RLGVN TW+SRW+A   EYG LLHEDLKIR Y+   LKQA V+KI+IER 
Sbjct: 1   MGQKINPIGLRLGVNRTWDSRWYADSGEYGRLLHEDLKIRLYVLEELKQAAVSKIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ +YSARPGLIIGKKG DIEK+R+KLS MTN+E  L++ E+ KPEI+AT+IAQSI
Sbjct: 61  HKKCRVTIYSARPGLIIGKKGADIEKLRRKLSEMTNAETSLNIVEIHKPEIDATIIAQSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSA+R GA+G+++  SGRL GAE++R E Y EGRVPL TLR+
Sbjct: 121 AQQLERRVAFRRAMKRAVQSALRLGAEGIRINCSGRLGGAEIARMEWYREGRVPLHTLRS 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            +DYGTA A+TAYG CG+KV+V   + +       P A  R   +
Sbjct: 181 DVDYGTAEAKTAYGICGVKVWVFKGEIL----EYDPMASERRAAE 221


>gi|188581381|ref|YP_001924826.1| ribosomal protein S3 [Methylobacterium populi BJ001]
 gi|179344879|gb|ACB80291.1| ribosomal protein S3 [Methylobacterium populi BJ001]
          Length = 248

 Score =  276 bits (705), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 133/224 (59%), Positives = 173/224 (77%), Gaps = 4/224 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI  RLG+N TW+SRWFA   EY  L+HED+ IR  L   LKQA V+KI+IER 
Sbjct: 1   MGQKINPIGLRLGINRTWDSRWFAEKGEYAKLMHEDVAIRAALMKQLKQAAVSKIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           H+ CR+ ++S RPG++IGKKG DIEK+RK +  MT +++ +++ EV KPE++ATL+A+SI
Sbjct: 61  HRKCRVTIHSGRPGVVIGKKGADIEKLRKLVGTMTKADVTINIVEVRKPEVDATLVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA+G+++  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAEGIRINCAGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVE 224
            +DYGTA A T YG+CGIKV+V  + E+ + D   P A+ +  +
Sbjct: 181 DVDYGTATAFTTYGTCGIKVWVF-KGEILEHD---PMAQDKKAQ 220


>gi|163745546|ref|ZP_02152906.1| 30S ribosomal protein S3 [Oceanibulbus indolifex HEL-45]
 gi|161382364|gb|EDQ06773.1| 30S ribosomal protein S3 [Oceanibulbus indolifex HEL-45]
          Length = 235

 Score =  276 bits (705), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 128/225 (56%), Positives = 169/225 (75%), Gaps = 4/225 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K+NPI  RL VN TW+SRW+A   +YG LL EDL IR++++    QAGVA+++IER 
Sbjct: 1   MGNKVNPIGMRLQVNRTWDSRWYADTKDYGDLLLEDLAIRDFIKKECHQAGVARVIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ +++ARPG+IIGKKG DIE +R+K++ MT SE+HL++ E+ KPE++A L+ +SI
Sbjct: 61  HKKCRVTIHTARPGVIIGKKGADIETLRQKIAKMTKSELHLNIVEIRKPELDAHLVGESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQ+AMR GA G++V  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVSFRRAMKRAVQNAMRMGALGIRVNLAGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDY    A TAYG  GIK ++  + E+ + D   PAA  R  ++
Sbjct: 181 DIDYAHVEAMTAYGIIGIKTWIF-KGEIMEHD---PAARDRKAQE 221


>gi|83854971|ref|ZP_00948501.1| 30S ribosomal protein S3 [Sulfitobacter sp. NAS-14.1]
 gi|83941493|ref|ZP_00953955.1| 30S ribosomal protein S3 [Sulfitobacter sp. EE-36]
 gi|83842814|gb|EAP81981.1| 30S ribosomal protein S3 [Sulfitobacter sp. NAS-14.1]
 gi|83847313|gb|EAP85188.1| 30S ribosomal protein S3 [Sulfitobacter sp. EE-36]
          Length = 235

 Score =  276 bits (705), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 126/225 (56%), Positives = 169/225 (75%), Gaps = 4/225 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K+NPI  RL VN TW+SRW+A   +YG LL EDL IR++++    QAG+A+++IER 
Sbjct: 1   MGNKVNPIGMRLQVNRTWDSRWYADTKDYGDLLLEDLAIRDFIKKECAQAGIARVIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ +++ARPG+IIGKKG DIE +R+K++ +T S++HL++ EV KPE++A L+ +SI
Sbjct: 61  HKKCRVTIHTARPGVIIGKKGADIEGLRQKIAKITKSDLHLNIVEVRKPELDAALVGESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQ+AMR GA G++V  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVSFRRAMKRAVQNAMRMGALGIRVNVAGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDY    A TAYG  GIK ++  + E+ + D   PAA  R  ++
Sbjct: 181 DIDYAHVEASTAYGIIGIKTWIF-KGEIMEHD---PAARDRKAQE 221


>gi|103488289|ref|YP_617850.1| 30S ribosomal protein S3 [Sphingopyxis alaskensis RB2256]
 gi|123379480|sp|Q1GPA5|RS3_SPHAL RecName: Full=30S ribosomal protein S3
 gi|98978366|gb|ABF54517.1| SSU ribosomal protein S3P [Sphingopyxis alaskensis RB2256]
          Length = 235

 Score =  276 bits (705), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 130/215 (60%), Positives = 165/215 (76%), Gaps = 1/215 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK NPI  RL VN TW+SRWFA G +YG +L EDLKIR+Y+   L QA ++K++IER 
Sbjct: 1   MGQKSNPIGLRLQVNRTWDSRWFAEGEDYGRMLVEDLKIRQYVFKALPQAAISKVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K CR+ +Y+ARPG+IIGKKG DIEK+RKKL  MT S++ L++ E+ KPE++A L+AQ I
Sbjct: 61  AKLCRVSIYAARPGVIIGKKGADIEKLRKKLGEMTGSDVSLNIVEIRKPEVDAKLVAQGI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV FRRAMKRAVQSAMR GA+G+++  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 ADQLERRVAFRRAMKRAVQSAMRLGAEGIRINCAGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTI 215
           ++DY  A A TAYG CGIKV++  + E+   D   
Sbjct: 181 NVDYAEAEAHTAYGVCGIKVWIF-KGEILGHDPMA 214


>gi|300309462|ref|YP_003773554.1| 30S ribosomal protein S3 [Herbaspirillum seropedicae SmR1]
 gi|300072247|gb|ADJ61646.1| 30S ribosomal subunit S3 protein [Herbaspirillum seropedicae SmR1]
          Length = 272

 Score =  275 bits (704), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 118/225 (52%), Positives = 162/225 (72%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V   W SRW+A  + +  +L+EDLK+R YL+  LK A V +++IER 
Sbjct: 1   MGQKIHPTGFRLAVTRNWGSRWYAGNNNFADMLNEDLKVRAYLKKKLKNASVGRVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI +YS+RPG++IGKKG DIE ++  L+ +    +H+++ E+ KPE +A LIA SI
Sbjct: 61  AKNARITIYSSRPGVVIGKKGEDIEVLKSALAKLMGVPVHVNIEEIRKPEADAQLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLE+R++FRRAMKRA+Q+AMR GA G+K+++SGRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 CQQLEKRIMFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDYG   AET YG  G+KV+V   D +++ +S +   E    +K
Sbjct: 181 DIDYGFGEAETTYGIIGVKVWVYKGDRLANGESPVLVGEPEDDKK 225


>gi|296533993|ref|ZP_06896509.1| 30S ribosomal protein S3 [Roseomonas cervicalis ATCC 49957]
 gi|296265659|gb|EFH11768.1| 30S ribosomal protein S3 [Roseomonas cervicalis ATCC 49957]
          Length = 225

 Score =  275 bits (704), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 126/227 (55%), Positives = 169/227 (74%), Gaps = 5/227 (2%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K+NPI  RLG+N TW+SRWFA   +Y  LLH+DLK+R+ L+  LK AGV+K++IER 
Sbjct: 1   MGHKVNPIGLRLGINRTWDSRWFAGD-DYARLLHDDLKLRKTLKDRLKGAGVSKVIIERP 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K  R+ +++ARPG++IGKKG DIE +RK L+ +  +E+ L++ E+ KPEI A L+A+SI
Sbjct: 60  AKKPRVTIHAARPGVVIGKKGADIEVLRKDLAKLAGAEVALNIVEIRKPEIEAQLVAESI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA G+++   GRL GAE++R E Y EGRVPL TLRA
Sbjct: 120 AQQLERRVAFRRAMKRAVQSAMRLGAGGIRINCGGRLGGAEIARMEWYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDYGTA A+T YG+CG+KV++  + E+   D   P A+ +   + +
Sbjct: 180 DIDYGTATAKTTYGTCGVKVWIF-KGEIMAHD---PLAQDKRAAEQA 222


>gi|153210013|ref|ZP_01947564.1| ribosomal protein S3 [Coxiella burnetii 'MSU Goat Q177']
 gi|154706269|ref|YP_001425176.1| SSU ribosomal protein S3P [Coxiella burnetii Dugway 5J108-111]
 gi|161830479|ref|YP_001596191.1| ribosomal protein S3 [Coxiella burnetii RSA 331]
 gi|165924132|ref|ZP_02219964.1| ribosomal protein S3 [Coxiella burnetii RSA 334]
 gi|212213244|ref|YP_002304180.1| SSU ribosomal protein S3P [Coxiella burnetii CbuG_Q212]
 gi|212218080|ref|YP_002304867.1| SSU ribosomal protein S3P [Coxiella burnetii CbuK_Q154]
 gi|189044972|sp|A9KD25|RS3_COXBN RecName: Full=30S ribosomal protein S3
 gi|189044973|sp|A9NAN0|RS3_COXBR RecName: Full=30S ribosomal protein S3
 gi|226697691|sp|B6J5D8|RS3_COXB1 RecName: Full=30S ribosomal protein S3
 gi|226697692|sp|B6J257|RS3_COXB2 RecName: Full=30S ribosomal protein S3
 gi|120575196|gb|EAX31820.1| ribosomal protein S3 [Coxiella burnetii 'MSU Goat Q177']
 gi|154355555|gb|ABS77017.1| SSU ribosomal protein S3P [Coxiella burnetii Dugway 5J108-111]
 gi|161762346|gb|ABX77988.1| ribosomal protein S3 [Coxiella burnetii RSA 331]
 gi|165916414|gb|EDR35018.1| ribosomal protein S3 [Coxiella burnetii RSA 334]
 gi|212011654|gb|ACJ19035.1| SSU ribosomal protein S3P [Coxiella burnetii CbuG_Q212]
 gi|212012342|gb|ACJ19722.1| SSU ribosomal protein S3P [Coxiella burnetii CbuK_Q154]
          Length = 227

 Score =  275 bits (704), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 114/225 (50%), Positives = 158/225 (70%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP+  R+G+   W S W+A   ++   L+EDL +R+ LQ  LK A V++I IER 
Sbjct: 1   MGQKVNPVGMRIGITRDWTSNWYADKKDFADRLNEDLNVRQLLQKRLKGAAVSRIQIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +N +II++SARPG+IIGKKG +IE +R ++S +    +H+++ EV KPE++A L+A++I
Sbjct: 61  ARNAKIIIHSARPGVIIGKKGGEIEALRDEISKVMKVPVHITIEEVRKPELDAKLVAENI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV+FRRAMKRAVQ+ +R GA GVK+  SGRL GAE++RTE Y EGRVPL T RA
Sbjct: 121 AQQLERRVMFRRAMKRAVQNTLRQGALGVKISVSGRLGGAEIARTEWYREGRVPLHTFRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDY TA A+T YG  G+KV++   +  +       AA     E+
Sbjct: 181 DIDYATASAKTTYGIIGVKVWIFKGEVHAPKPQAEEAAPQETEEE 225


>gi|29653596|ref|NP_819288.1| SSU ribosomal protein S3P [Coxiella burnetii RSA 493]
 gi|30581016|sp|O85388|RS3_COXBU RecName: Full=30S ribosomal protein S3
 gi|29540858|gb|AAO89802.1| SSU ribosomal protein S3P [Coxiella burnetii RSA 493]
          Length = 227

 Score =  275 bits (704), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 113/225 (50%), Positives = 157/225 (69%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP+  R+G+   W S W+A   ++   L+EDL +R+ LQ  LK A V++I IER 
Sbjct: 1   MGQKVNPVGMRIGITRDWTSNWYADKKDFADRLNEDLNVRQLLQKRLKGAAVSRIQIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +N +II++SARPG+IIGKKG +IE +R ++  +    +H+++ EV KPE++A L+A++I
Sbjct: 61  ARNAKIIIHSARPGVIIGKKGGEIEALRDEIFKVMKVPVHITIEEVRKPELDAKLVAENI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV+FRRAMKRAVQ+ +R GA GVK+  SGRL GAE++RTE Y EGRVPL T RA
Sbjct: 121 AQQLERRVMFRRAMKRAVQNTLRQGALGVKISVSGRLGGAEIARTEWYREGRVPLHTFRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDY TA A+T YG  G+KV++   +  +       AA     E+
Sbjct: 181 DIDYATASAKTTYGIIGVKVWIFKGEVHAPKPQAEEAAPQETEEE 225


>gi|162149168|ref|YP_001603629.1| 30S ribosomal protein S3 [Gluconacetobacter diazotrophicus PAl 5]
 gi|209545088|ref|YP_002277317.1| 30S ribosomal protein S3 [Gluconacetobacter diazotrophicus PAl 5]
 gi|189045011|sp|A9H3P5|RS3_GLUDA RecName: Full=30S ribosomal protein S3
 gi|161787745|emb|CAP57341.1| 30S ribosomal protein S3 [Gluconacetobacter diazotrophicus PAl 5]
 gi|209532765|gb|ACI52702.1| ribosomal protein S3 [Gluconacetobacter diazotrophicus PAl 5]
          Length = 225

 Score =  275 bits (704), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 124/227 (54%), Positives = 171/227 (75%), Gaps = 5/227 (2%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K+NPI  RLG+N TW+SRW+A G++Y  LLH+DLK+R +L+  L  AGV++++IER 
Sbjct: 1   MGHKVNPIGLRLGINRTWDSRWYA-GADYSRLLHDDLKLRAHLRRKLSGAGVSRVVIERP 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K  R+ +Y+ARPG++IGKKG DI+ +RK L+ M  +++ L++ E+ KPEI+ATL+A++I
Sbjct: 60  AKKPRVTIYAARPGVVIGKKGQDIDVLRKDLTRMAKTDVALNIVEIRKPEIDATLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA G+++   GRL GAE++R E Y EGRVPL TLRA
Sbjct: 120 AQQLERRVAFRRAMKRAVQSAMRLGAQGIRINCGGRLGGAEIARVEWYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDYG A A+T YG+CG+KV++  + E+   D   P A+ R   + +
Sbjct: 180 DIDYGVATAKTTYGTCGVKVWIF-KGEILAHD---PLAQDRRAAEQA 222


>gi|163851591|ref|YP_001639634.1| ribosomal protein S3 [Methylobacterium extorquens PA1]
 gi|218530400|ref|YP_002421216.1| ribosomal protein S3 [Methylobacterium chloromethanicum CM4]
 gi|240138759|ref|YP_002963231.1| 30S ribosomal subunit protein S3 [Methylobacterium extorquens AM1]
 gi|254561359|ref|YP_003068454.1| 30S ribosomal subunit protein S3 [Methylobacterium extorquens DM4]
 gi|163663196|gb|ABY30563.1| ribosomal protein S3 [Methylobacterium extorquens PA1]
 gi|218522703|gb|ACK83288.1| ribosomal protein S3 [Methylobacterium chloromethanicum CM4]
 gi|240008728|gb|ACS39954.1| 30S ribosomal subunit protein S3 [Methylobacterium extorquens AM1]
 gi|254268637|emb|CAX24596.1| 30S ribosomal subunit protein S3 [Methylobacterium extorquens DM4]
          Length = 248

 Score =  275 bits (704), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 134/224 (59%), Positives = 173/224 (77%), Gaps = 4/224 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI  RLG+N TW+SRWFA   EY  L+HED+ IR  L   LKQA V+KI+IER 
Sbjct: 1   MGQKINPIGLRLGINRTWDSRWFAEKGEYAKLMHEDVAIRAALMKQLKQAAVSKIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           H+ CR+ ++S RPG++IGKKG DIEK+RK +  MT +++ +++ EV KPEI+ATL+A+SI
Sbjct: 61  HRKCRVTIHSGRPGVVIGKKGADIEKLRKLVGTMTKADVTINIVEVRKPEIDATLVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA+G+++  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAEGIRINCAGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVE 224
            +DYGTA A T YG+CGIKV+V  + E+ + D   P A+ +  +
Sbjct: 181 DVDYGTATAFTTYGTCGIKVWVF-KGEILEHD---PMAQDKKAQ 220


>gi|254282595|ref|ZP_04957563.1| ribosomal protein S3 [gamma proteobacterium NOR51-B]
 gi|219678798|gb|EED35147.1| ribosomal protein S3 [gamma proteobacterium NOR51-B]
          Length = 224

 Score =  275 bits (704), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 108/224 (48%), Positives = 150/224 (66%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLGV    NS W+A    Y   L  DL++REY+   L  A V++++IER 
Sbjct: 1   MGQKVHPTGIRLGVVKDHNSVWYADSKNYAKNLISDLQVREYILKKLDAASVSRVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               RI +++ARPG++IGKKG D+E +RK+LS      +H+++ E+ KP+++A L+AQ++
Sbjct: 61  AATARITIHTARPGIVIGKKGEDVEALRKELSAKMGVPVHINIEEIRKPDLDARLVAQNV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV+FRRAMKR VQ+AMR GA+G+KV   GRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVMFRRAMKRVVQNAMRQGAEGIKVQVGGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVE 224
            IDY T  AET YG  G+KV++   + +   D     +      
Sbjct: 181 DIDYSTYEAETTYGIIGVKVWIFKGEVIGGDDDAPDTSRRTAAN 224


>gi|56477600|ref|YP_159189.1| 30S ribosomal protein S3 [Aromatoleum aromaticum EbN1]
 gi|81677438|sp|Q5P326|RS3_AZOSE RecName: Full=30S ribosomal protein S3
 gi|56313643|emb|CAI08288.1| 30S ribosomal protein S3 [Aromatoleum aromaticum EbN1]
          Length = 278

 Score =  275 bits (704), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 118/226 (52%), Positives = 163/226 (72%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V   WNSRWFA   +Y  +LHEDLK+R++L+  L  A V +++IER 
Sbjct: 1   MGQKIHPTGFRLAVTRDWNSRWFASSGDYSRMLHEDLKVRDFLKKRLAHASVGRVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI ++SARPG++IGKKG DIE ++++L  +    +H+++ EV KPE++A LIA SI
Sbjct: 61  AKNARITLFSARPGVVIGKKGEDIELLKRELQKIMGVPVHVNIEEVRKPEVDAKLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLE+R++FRRAMKRA+Q+AMR GA G+K++++GRLNGAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLEKRIMFRRAMKRAMQNAMRLGAQGIKIMSAGRLNGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            IDYG + A+T YG  GIKV+V   + +  ++            + 
Sbjct: 181 DIDYGVSEAKTTYGIIGIKVWVYKGEMLGRNERPAVVENENEARRG 226


>gi|163796913|ref|ZP_02190870.1| 30S ribosomal protein S3 [alpha proteobacterium BAL199]
 gi|159177902|gb|EDP62451.1| 30S ribosomal protein S3 [alpha proteobacterium BAL199]
          Length = 227

 Score =  275 bits (704), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 133/226 (58%), Positives = 173/226 (76%), Gaps = 5/226 (2%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K+NPI  RLG+N TW+SRWFA    Y ALLHEDL +R++LQ  L+QAGV++I+IER 
Sbjct: 1   MGHKVNPIGLRLGINRTWDSRWFA-SKGYAALLHEDLVLRKFLQKRLRQAGVSRIVIERP 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K  RI +Y+ARPG+IIGKKG DIEK+R++LS MT +++ L++ E+ KPEI+A L+A++I
Sbjct: 60  AKRARITIYTARPGVIIGKKGADIEKLRQELSQMTRTDVALNIVEIRKPEIDAKLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA G+++   GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 120 AQQLERRVAFRRAMKRAVQSAMRLGAQGIRITCGGRLGGAEIARTEWYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            IDYG A A T YG+CG+KV+V  + E+   D   P A+ + + + 
Sbjct: 180 DIDYGDATAFTTYGTCGVKVWVF-KGEIMAHD---PMAQDKRLAEQ 221


>gi|108762029|ref|YP_631504.1| 30S ribosomal protein S3 [Myxococcus xanthus DK 1622]
 gi|122981077|sp|Q1D769|RS3_MYXXD RecName: Full=30S ribosomal protein S3
 gi|108465909|gb|ABF91094.1| ribosomal protein S3 [Myxococcus xanthus DK 1622]
          Length = 220

 Score =  275 bits (704), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 112/221 (50%), Positives = 154/221 (69%), Gaps = 1/221 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI FRLGV  TW+S+WF     Y   LHED++IRE+++  L  AGV+K+ IER 
Sbjct: 1   MGQKVHPIGFRLGVIKTWDSKWF-EHKNYAQWLHEDIRIREFVKKSLNHAGVSKVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               ++ V++ARPG++IGK+G  IE ++K L   T +E+ L++ EV K E +A L+A++I
Sbjct: 60  ANKVKVNVHTARPGIVIGKRGAGIETVKKDLQQFTKNEVFLNIVEVRKAETDAQLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERR+ FRRAMK+A+Q+AM+FGA G++V  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 120 ATQLERRIAFRRAMKKALQTAMKFGAKGIRVACSGRLGGAEMARYEWYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHR 221
            IDYG A A+T YG  G KV+V   + +       P   +R
Sbjct: 180 DIDYGFAEAKTTYGKIGCKVWVCKGEVLPGKGGQAPMPSNR 220


>gi|126666807|ref|ZP_01737784.1| 30S ribosomal protein S3 [Marinobacter sp. ELB17]
 gi|126628852|gb|EAZ99472.1| 30S ribosomal protein S3 [Marinobacter sp. ELB17]
          Length = 227

 Score =  275 bits (704), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 109/213 (51%), Positives = 156/213 (73%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K+NPI FRLGV    NS W+A   +Y   L  D+++RE+L   L +A V+KI+IER 
Sbjct: 1   MGHKVNPIGFRLGVIKEHNSVWYADKKDYAKNLLNDIQVREFLDKRLVKASVSKIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +N RI +++ARPG++IGKKG D++++R+++S+M    +H+++ EV KP+++A L+AQ++
Sbjct: 61  AQNARITIHTARPGIVIGKKGEDVDRLRREVSDMMGVPVHINIEEVRKPDLDARLVAQNV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+K+   GRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 AGQLERRVMFRRAMKRAVQNAMRQGAKGIKIQVGGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDS 213
            IDYGT  A T YG  G+KV++   + +   + 
Sbjct: 181 DIDYGTYEAHTTYGVIGVKVWIFKGEILGGMEQ 213


>gi|307294980|ref|ZP_07574822.1| ribosomal protein S3 [Sphingobium chlorophenolicum L-1]
 gi|306879454|gb|EFN10672.1| ribosomal protein S3 [Sphingobium chlorophenolicum L-1]
          Length = 231

 Score =  275 bits (703), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 126/215 (58%), Positives = 166/215 (77%), Gaps = 1/215 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K NPI  RL +N TW+SRWFA G++YG LL EDLKIR+Y+  +L QA ++K++IER 
Sbjct: 1   MGHKSNPIGLRLQINRTWDSRWFAEGADYGRLLLEDLKIRQYIMKNLPQAAISKVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K CR+ +Y+ARPG+IIGKKG DIEK+RKKL ++T+S++ L++ E+ KPE+++ L+AQ I
Sbjct: 61  AKLCRVSIYAARPGVIIGKKGADIEKLRKKLGSLTSSDVSLNIVEIRKPEVDSKLVAQGI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV FRRAMKRAVQSA+R GA+G+K+   GRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 ADQLERRVAFRRAMKRAVQSALRLGAEGIKITCGGRLGGAEIARVEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTI 215
           ++DY  A A TAYG CGIKV++  + E+   D   
Sbjct: 181 NVDYAEAEAHTAYGVCGIKVWIF-KGEILGHDPMA 214


>gi|170748642|ref|YP_001754902.1| ribosomal protein S3 [Methylobacterium radiotolerans JCM 2831]
 gi|170655164|gb|ACB24219.1| ribosomal protein S3 [Methylobacterium radiotolerans JCM 2831]
          Length = 248

 Score =  275 bits (703), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 132/224 (58%), Positives = 171/224 (76%), Gaps = 4/224 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI  RLG+N TW+SRWFA   +Y  L+HED+ IR  L   LKQA V+KI+IER 
Sbjct: 1   MGQKVNPIGLRLGINRTWDSRWFANKGDYAKLMHEDVAIRAALMKQLKQAAVSKIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           H+ CR+ ++S RPG++IGKKG DIEK+RK +  MT +++ +++ EV KPEI+ATL+A SI
Sbjct: 61  HRKCRVTIHSGRPGVVIGKKGADIEKLRKLVGTMTKADVTINIVEVRKPEIDATLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA+G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAEGIRINCSGRLGGAEIARQEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVE 224
            +DYGTA A T YG+CGIKV+V  + E+ + D   P A+ +  +
Sbjct: 181 DVDYGTATAFTTYGTCGIKVWVF-KGEILEHD---PMAQDKKAQ 220


>gi|56461018|ref|YP_156299.1| ribosomal protein S3 [Idiomarina loihiensis L2TR]
 gi|61215389|sp|Q5QXY3|RS3_IDILO RecName: Full=30S ribosomal protein S3
 gi|56180028|gb|AAV82750.1| Ribosomal protein S3 [Idiomarina loihiensis L2TR]
          Length = 226

 Score =  275 bits (703), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 108/226 (47%), Positives = 161/226 (71%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG++  WN+ W+A  +E+   LH D ++R++L   L+ A V++I+I+R 
Sbjct: 1   MGQKVHPNGIRLGISRPWNATWYANTNEFADNLHSDFQVRKFLNKELRNASVSRIVIDRP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+RK++S +T +   ++++EV KPE+++ L+A +I
Sbjct: 61  AKSVRVTIHTARPGVVIGKKGEDVEKLRKQVSKLTGAPAQINISEVRKPELDSQLVADNI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+A+R GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AGQLERRVMFRRAMKRAVQNAIRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            IDY T+ A T YG  G+KV++   + +    +    A  R   + 
Sbjct: 181 DIDYSTSEANTTYGIIGVKVWIFRGEVLGGLPTEEKPAPKRGKNRK 226


>gi|148260933|ref|YP_001235060.1| 30S ribosomal protein S3 [Acidiphilium cryptum JF-5]
 gi|326404331|ref|YP_004284413.1| 30S ribosomal protein S3 [Acidiphilium multivorum AIU301]
 gi|189044987|sp|A5FZV9|RS3_ACICJ RecName: Full=30S ribosomal protein S3
 gi|146402614|gb|ABQ31141.1| SSU ribosomal protein S3P [Acidiphilium cryptum JF-5]
 gi|325051193|dbj|BAJ81531.1| 30S ribosomal protein S3 [Acidiphilium multivorum AIU301]
          Length = 225

 Score =  275 bits (703), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 128/227 (56%), Positives = 174/227 (76%), Gaps = 5/227 (2%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K+NP+  RLG+N TW+SRWFA G++Y +LLH+DLK+RE+L   L  AGV+K+LIER 
Sbjct: 1   MGHKVNPVGLRLGINRTWDSRWFA-GADYASLLHDDLKLREHLLGRLSGAGVSKVLIERP 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K  R+ +Y+ARPG++IGKKG DIE ++K+LS+M  +++ L++ E+ KPEI+A L+AQ+I
Sbjct: 60  AKKPRVTIYAARPGVVIGKKGQDIEVLKKELSSMAKADVSLNIVEIRKPEIDAALVAQNI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 120 AQQLERRVAFRRAMKRAVQSAMRLGAQGIRINCSGRLGGAEIARMEWYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            ID+G A A+T YG+CG+KV++  + E+   D   P A+ R   + +
Sbjct: 180 DIDFGVATAKTTYGTCGVKVWIF-KGEIMAHD---PMAQDRRAAEQA 222


>gi|53803417|ref|YP_114782.1| 30S ribosomal protein S3 [Methylococcus capsulatus str. Bath]
 gi|61215439|sp|Q605B8|RS3_METCA RecName: Full=30S ribosomal protein S3
 gi|53757178|gb|AAU91469.1| ribosomal protein S3 [Methylococcus capsulatus str. Bath]
          Length = 223

 Score =  274 bits (702), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 106/210 (50%), Positives = 148/210 (70%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   RLG    W+SRWFA    Y   L+ DLK+RE+L+  LK A V++I I R 
Sbjct: 1   MGQKVNPTGIRLGYIKDWSSRWFADSKSYPVFLNNDLKVREFLKQKLKHASVSRIQINRL 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
             N +I +++ARPG++IGK+G DI+ +R+ +S      + +SV E+ KPE++A L+A+ +
Sbjct: 61  ANNAQITIHTARPGIVIGKRGEDIDALRRDVSRFMGVPVQVSVEEIRKPELDAQLVAEGV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLE+R++FRRAMKRAVQ+ +R GA+G+K+  +GRLNGAE++RTE Y EGRVPL T RA
Sbjct: 121 AQQLEKRIMFRRAMKRAVQNTLRVGAEGIKISVAGRLNGAEIARTEWYREGRVPLHTFRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD 210
            IDYG A A T YG  G+KV++   +    
Sbjct: 181 DIDYGFAEAVTTYGVIGVKVWIFKGEVFEP 210


>gi|192362436|ref|YP_001981214.1| 30S ribosomal protein S3 [Cellvibrio japonicus Ueda107]
 gi|190688601|gb|ACE86279.1| ribosomal protein S3 [Cellvibrio japonicus Ueda107]
          Length = 226

 Score =  274 bits (702), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 107/210 (50%), Positives = 152/210 (72%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+     S W+A G++Y   L+ DLK+R Y+Q  L  A V+++ IER 
Sbjct: 1   MGQKVHPNGIRLGIIKKHTSVWYADGTDYADKLNIDLKVRSYIQEKLASASVSRVDIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               RI +++ARPG++IGKKG D++K+R ++S      +H+++ E+ KP+++A L+AQS+
Sbjct: 61  ANTARITIHTARPGIVIGKKGEDVDKLRAEISKQMGVPVHINIEEIRKPDLDAALVAQSV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV+FRRAMKRAVQ+AMR GA+G+K+   GRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVMFRRAMKRAVQNAMRQGAEGIKIQVGGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD 210
            IDY TA A T YG  G+KV++   + + D
Sbjct: 181 DIDYATAEASTTYGIIGVKVWIFKGEVIGD 210


>gi|294010619|ref|YP_003544079.1| ribosomal protein S3 [Sphingobium japonicum UT26S]
 gi|292673949|dbj|BAI95467.1| ribosomal protein S3 [Sphingobium japonicum UT26S]
          Length = 231

 Score =  274 bits (702), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 126/215 (58%), Positives = 165/215 (76%), Gaps = 1/215 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K NPI  RL +N TW+SRWFA G++YG LL EDLKIR+++  +L QA ++K++IER 
Sbjct: 1   MGHKSNPIGLRLQINRTWDSRWFAEGADYGRLLLEDLKIRQFIMKNLPQAAISKVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K CR+ +Y+ARPG+IIGKKG DIEK+RKKL  +T+S++ L++ E+ KPEI++ L+AQ I
Sbjct: 61  AKLCRVSIYAARPGVIIGKKGADIEKLRKKLGGLTSSDVSLNIVEIRKPEIDSKLVAQGI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV FRRAMKRAVQSA+R GA+G+K+   GRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 ADQLERRVAFRRAMKRAVQSALRLGAEGIKITCGGRLGGAEIARVEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTI 215
           ++DY  A A TAYG CGIKV++  + E+   D   
Sbjct: 181 NVDYAEAEAHTAYGVCGIKVWIF-KGEILGHDPMA 214


>gi|71905967|ref|YP_283554.1| 30S ribosomal protein S3 [Dechloromonas aromatica RCB]
 gi|91207650|sp|Q47J97|RS3_DECAR RecName: Full=30S ribosomal protein S3
 gi|71845588|gb|AAZ45084.1| SSU ribosomal protein S3P [Dechloromonas aromatica RCB]
          Length = 261

 Score =  274 bits (702), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 123/224 (54%), Positives = 163/224 (72%), Gaps = 2/224 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V   W+SRW+A   ++  +L+ED+K+REYL+  L  A V ++LIER 
Sbjct: 1   MGQKIHPTGFRLAVTKNWSSRWYANSKDFPGMLNEDIKVREYLKRKLAHASVGRVLIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN R+ VYSARPG++IGKKG DIE++R  L  +    +H+S+ E+ KPEI+A LIA SI
Sbjct: 61  AKNARVTVYSARPGVVIGKKGEDIEQLRTDLQRIMGVPVHVSIEEIRKPEIDAQLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLE+R++FRRAMKRA+Q+AMR GA G+KV+++GRLNGAE++R+E Y EGRVPL TLRA
Sbjct: 121 AQQLEKRIMFRRAMKRAMQNAMRLGAQGIKVMSAGRLNGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVE 224
            IDY T+ A T YG  GIKV+V   D +    +  P AE    +
Sbjct: 181 DIDYATSEALTTYGIIGIKVWVYKGDML--DRNEQPVAEEPAAD 222


>gi|90417575|ref|ZP_01225493.1| 30S ribosomal protein S3 [marine gamma proteobacterium HTCC2207]
 gi|90330596|gb|EAS45892.1| 30S ribosomal protein S3 [marine gamma proteobacterium HTCC2207]
          Length = 229

 Score =  274 bits (702), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 103/224 (45%), Positives = 152/224 (67%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+     S W+A   +Y   LH+DL +RE+++  L  A V+++ IER 
Sbjct: 1   MGQKVHPTGIRLGIVKKHTSTWYAGNKDYADKLHQDLTVREFIRKRLAHASVSRVDIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
             + RI +++ARPG++IGKKG D+EK+R ++ N     + +++ E+ KP+++A L+AQ++
Sbjct: 61  SDSARITIHTARPGIVIGKKGEDVEKLRNEIGNKMGCPVTINIEEIRKPDLDANLVAQNV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV+FRRAMKRAVQ+AMR GA GVK+   GRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVMFRRAMKRAVQNAMRGGALGVKIQVGGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVE 224
            IDY  A   T YG  G+KV++   + +   ++    A+ +   
Sbjct: 181 DIDYAAAEGNTTYGIIGVKVWIFKGEVLGGEEAEKAPAKKQDTR 224


>gi|77462265|ref|YP_351769.1| 30S ribosomal protein S3 [Rhodobacter sphaeroides 2.4.1]
 gi|126461141|ref|YP_001042255.1| 30S ribosomal protein S3 [Rhodobacter sphaeroides ATCC 17029]
 gi|221638119|ref|YP_002524381.1| 30S ribosomal protein S3 [Rhodobacter sphaeroides KD131]
 gi|91207837|sp|Q3J5R6|RS3_RHOS4 RecName: Full=30S ribosomal protein S3
 gi|152060900|sp|A3PGL7|RS3_RHOS1 RecName: Full=30S ribosomal protein S3
 gi|254764543|sp|B9KL97|RS3_RHOSK RecName: Full=30S ribosomal protein S3
 gi|77386683|gb|ABA77868.1| SSU ribosomal protein S3P [Rhodobacter sphaeroides 2.4.1]
 gi|126102805|gb|ABN75483.1| SSU ribosomal protein S3P [Rhodobacter sphaeroides ATCC 17029]
 gi|221158900|gb|ACL99879.1| 30S ribosomal protein S3 [Rhodobacter sphaeroides KD131]
          Length = 238

 Score =  274 bits (702), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 130/226 (57%), Positives = 170/226 (75%), Gaps = 1/226 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI  RL VN TW+SRWFA   +YG LL EDLK+RE++  + KQAGV+K++IER 
Sbjct: 1   MGQKVNPIGMRLQVNRTWDSRWFAESKDYGNLLLEDLKMREFIHDYAKQAGVSKVIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           H+ CR+ +++ARPG+IIGKKG DIE +RKKLS  T SE+HL++ E+ KPE++A L+A+SI
Sbjct: 61  HRKCRVTIHTARPGVIIGKKGADIETLRKKLSAFTKSELHLNIVEIRKPELDAQLVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQ+ERRV FRRAMKR VQ+AMR GA G++V  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQMERRVSFRRAMKRGVQNAMRIGALGIRVNVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            IDY T+ A T YG  G+KV++  + E+ + D       H   ++ 
Sbjct: 181 DIDYATSEATTPYGIIGVKVWIF-KGEILEHDPQAHDRRHSEAQEG 225


>gi|240167709|ref|ZP_04746368.1| 30S ribosomal protein S3 [Mycobacterium kansasii ATCC 12478]
          Length = 277

 Score =  274 bits (701), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 105/229 (45%), Positives = 148/229 (64%), Gaps = 5/229 (2%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP  FRLG+   W SRW+A   +Y   + ED+ IR  L   L++AG+A + IERT
Sbjct: 1   MGQKINPHGFRLGITTDWKSRWYAD-KQYAEYVKEDVAIRRLLSSGLERAGIADVEIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG++GT+ ++IR  L  +T  ++ L++ EV  PE  A L+AQ +
Sbjct: 60  RDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTGKQVQLNILEVKNPESQAQLVAQGV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAM-RFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           A+QL  RV FRRAM++A+QSAM +    G++V  SGRL GAE+SR+E Y EGRVPL TLR
Sbjct: 120 AEQLSNRVAFRRAMRKAIQSAMRQPNVKGIRVQCSGRLGGAEMSRSEFYREGRVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDST---IPAAEHRVVEK 225
           A IDYG   A+T +G  G+KV++   D V         +PA   R   +
Sbjct: 180 ADIDYGLYEAKTTFGRIGVKVWIYKGDIVGGKRELAAAVPAGPERPRRE 228


>gi|332187763|ref|ZP_08389497.1| ribosomal protein S3 [Sphingomonas sp. S17]
 gi|332012113|gb|EGI54184.1| ribosomal protein S3 [Sphingomonas sp. S17]
          Length = 236

 Score =  274 bits (701), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 130/225 (57%), Positives = 173/225 (76%), Gaps = 4/225 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK NPI  RL +N TW+SRWFA G +YG LL EDLKIR+Y+   L QA ++K++IER 
Sbjct: 1   MGQKSNPIGLRLQINRTWDSRWFAEGHDYGRLLLEDLKIRQYIMKTLPQAAISKVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K CRI +++ARPG+IIGKKG DIEK+RKKL +MT+S++ L++ E+ KPEI+A L+AQ +
Sbjct: 61  AKLCRISIFAARPGVIIGKKGADIEKLRKKLGSMTSSDVSLNIVEIRKPEIDAKLVAQGV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERR+ FRRAMKRAVQSA+R GA+G+++   GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 ADQLERRIAFRRAMKRAVQSALRLGAEGIRITCGGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
           ++DY  A A TAYG CG+KV++  + E+   D   P A+ R++ +
Sbjct: 181 NVDYAEAQAHTAYGVCGVKVWIF-KGEILGHD---PMAQDRLMME 221


>gi|147676661|ref|YP_001210876.1| 30S ribosomal protein S3 [Pelotomaculum thermopropionicum SI]
 gi|189045026|sp|A5D5G1|RS3_PELTS RecName: Full=30S ribosomal protein S3
 gi|146272758|dbj|BAF58507.1| ribosomal protein S3 [Pelotomaculum thermopropionicum SI]
          Length = 231

 Score =  274 bits (701), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 96/220 (43%), Positives = 152/220 (69%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   R+G+   W  +W+A    Y ALLHED+KIR++++  L  AG+++I IER 
Sbjct: 1   MGQKVNPKGLRIGIIRDWEGKWYADKRNYAALLHEDIKIRKFIKEKLFAAGISRIQIERA 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               ++ +++A+PG++IG+ G ++E +RK+L N+T  ++ +++ E+  PE++A L+A+++
Sbjct: 61  ANRVKVSIHTAKPGIVIGRGGAEVENLRKQLENLTGKQVSVNIVEIKVPELDAQLVAENV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLE+R+ FRRAMK+ V  +M+ GA G+KV   GRL GAE++RTE Y EG+VPL TLRA
Sbjct: 121 AAQLEKRIAFRRAMKQVVSRSMKMGAKGIKVACGGRLAGAEIARTEWYSEGKVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEH 220
            IDYG A A T YG  G+KV++   + + ++ +    A  
Sbjct: 181 DIDYGFAEANTTYGKIGVKVWIYRGEVLPEAKTPAKTAAR 220


>gi|313903145|ref|ZP_07836539.1| SSU ribosomal protein S3P [Thermaerobacter subterraneus DSM 13965]
 gi|313466647|gb|EFR62167.1| SSU ribosomal protein S3P [Thermaerobacter subterraneus DSM 13965]
          Length = 226

 Score =  274 bits (701), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 104/220 (47%), Positives = 152/220 (69%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK +P  FRLG+   W+SRW+AR  E+  LL ED +IR Y++  L  AG++++ IER 
Sbjct: 1   MGQKTHPKGFRLGIIRDWDSRWYARRQEFVDLLLEDQRIRRYIKKRLYDAGISRVEIERA 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ +PG++IGK GT +E +R++L  MT  ++ ++V EV +PE++A L+A+SI
Sbjct: 61  ANRIRLTIHAGKPGMVIGKGGTGVESLRQELERMTGRQVAINVVEVKEPELDAQLVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A Q++RRV +RRAMK+A+Q  MR GA G K+  SGRL GAE+SR+E   EG VPL TLRA
Sbjct: 121 AAQIQRRVAWRRAMKQALQRTMRAGAKGCKIRVSGRLGGAEISRSEWTAEGSVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEH 220
            IDYG A A T YG  G+KV+++  + + ++     AAE 
Sbjct: 181 DIDYGQAEAFTTYGQIGVKVWINRGEVLPEAKRPAEAAEQ 220


>gi|117927521|ref|YP_872072.1| 30S ribosomal protein S3 [Acidothermus cellulolyticus 11B]
 gi|152060838|sp|A0LRM6|RS3_ACIC1 RecName: Full=30S ribosomal protein S3
 gi|117647984|gb|ABK52086.1| SSU ribosomal protein S3P [Acidothermus cellulolyticus 11B]
          Length = 341

 Score =  274 bits (701), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 103/225 (45%), Positives = 154/225 (68%), Gaps = 1/225 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP  FRLG+   ++SRW+A    Y   + ED+ IR  +   +++AG++++ IERT
Sbjct: 1   MGQKVNPHGFRLGITTEFSSRWYAD-RMYRDYVKEDVAIRRMMTRGMERAGISRVEIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG++G + ++IR  L  +TN ++ L++ EV  PEI+A L+AQ +
Sbjct: 60  RDRVRVDIHTARPGIVIGRRGAEADRIRADLEKLTNKQVQLNILEVKNPEIDAQLVAQGV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QL +RV FRRAM++A+QSA++ GA GV+V  +GRL GAE+SRTE Y EGRVPL TLRA
Sbjct: 120 AEQLSQRVSFRRAMRKALQSALKAGAKGVRVQVAGRLGGAEMSRTEFYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDYG   A T +G  G+KV++   D V+  D        RV ++
Sbjct: 180 DIDYGFYEARTTFGRIGVKVWIYKGDVVAGRDHEAARVAARVQQR 224


>gi|220921905|ref|YP_002497206.1| ribosomal protein S3 [Methylobacterium nodulans ORS 2060]
 gi|219946511|gb|ACL56903.1| ribosomal protein S3 [Methylobacterium nodulans ORS 2060]
          Length = 251

 Score =  274 bits (701), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 132/223 (59%), Positives = 171/223 (76%), Gaps = 4/223 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI  RLG+N TW+SRW+A   EY  L+HED+ IR+ L   LKQA V+KI+IER 
Sbjct: 1   MGQKVNPIGLRLGINRTWDSRWYANKGEYARLMHEDVAIRQALMKQLKQAAVSKIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           H+ CR+ ++S RPG++IGKKG DIEK+RK +  MT +++ +++ EV KPEI+ATL+A SI
Sbjct: 61  HRKCRVTIHSGRPGVVIGKKGADIEKLRKLVGTMTKADVTINIVEVRKPEIDATLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA+G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAEGIRINCSGRLGGAEIARLEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVV 223
            +DYGTA A T YG+CGIKV+V  + E+ + D   P A+ +  
Sbjct: 181 DVDYGTATAFTTYGTCGIKVWVF-KGEILEHD---PMAQDKRA 219


>gi|261211145|ref|ZP_05925434.1| SSU ribosomal protein S3p (S3e) [Vibrio sp. RC341]
 gi|262401877|ref|ZP_06078442.1| SSU ribosomal protein S3p (S3e) [Vibrio sp. RC586]
 gi|260839646|gb|EEX66257.1| SSU ribosomal protein S3p (S3e) [Vibrio sp. RC341]
 gi|262351849|gb|EEZ00980.1| SSU ribosomal protein S3p (S3e) [Vibrio sp. RC586]
          Length = 234

 Score =  274 bits (701), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 108/224 (48%), Positives = 153/224 (68%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WN+ WFA   ++   L  D K+R+YL   L  A +++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNATWFANTKDFADNLDGDFKVRQYLSKELANASLSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  ++ +      +++ EV KPE++  L+A SI
Sbjct: 61  AKSIRVTIHTARPGVVIGKKGEDVEKLRAAVAKIAGVPAQINIAEVRKPELDGQLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVE 224
            IDY T+ A T YG  G+KV++   + +    +   AAE +  +
Sbjct: 181 DIDYATSSAHTTYGVIGVKVWIFKGEILGGMPAATEAAEPKADK 224


>gi|146278562|ref|YP_001168721.1| 30S ribosomal protein S3 [Rhodobacter sphaeroides ATCC 17025]
 gi|189045323|sp|A4WVK2|RS3_RHOS5 RecName: Full=30S ribosomal protein S3
 gi|145556803|gb|ABP71416.1| SSU ribosomal protein S3P [Rhodobacter sphaeroides ATCC 17025]
          Length = 238

 Score =  274 bits (701), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 128/226 (56%), Positives = 170/226 (75%), Gaps = 1/226 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI  RL VN TW+SRWFA   +YG LL EDLK+RE++  + KQAGV+K++IER 
Sbjct: 1   MGQKVNPIGMRLQVNRTWDSRWFAESKDYGNLLLEDLKMREFIHDYAKQAGVSKVIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           H+ CR+ +++ARPG+IIGKKG DIE +RKKL+  T SE+HL++ E+ KPE++A L+A+SI
Sbjct: 61  HRKCRVTIHTARPGVIIGKKGADIETLRKKLAAFTKSELHLNIVEIRKPELDAQLVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQ+ERRV FRRAMKR VQ+AMR GA G++V  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQMERRVSFRRAMKRGVQNAMRIGALGIRVNVAGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            IDY T+ A T YG  G+KV++  + E+ + D       H   ++ 
Sbjct: 181 DIDYATSEASTPYGIIGVKVWIF-KGEILEHDPQAHDRRHSEAQEG 225


>gi|218290000|ref|ZP_03494177.1| ribosomal protein S3 [Alicyclobacillus acidocaldarius LAA1]
 gi|218239985|gb|EED07172.1| ribosomal protein S3 [Alicyclobacillus acidocaldarius LAA1]
          Length = 226

 Score =  274 bits (701), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 105/226 (46%), Positives = 153/226 (67%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI  R+G+   W ++W+A   +Y  LLHEDLKIR Y+   LK A +  + IER 
Sbjct: 1   MGQKVNPIGLRIGIIRDWEAKWYANKKDYQVLLHEDLKIRNYVMQRLKDAAIGSVEIERA 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                + +++A+PG++IGK G +++ +R +L+ +T   +H+S++E+ +P++ A L+A+SI
Sbjct: 61  ANRINVTIHTAKPGMVIGKGGQEVDALRNELNKLTGKRVHISISEIKQPDLCAKLVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMK+A+Q +MR GA GV+V  SGRL GAE++RTE Y+EG VPLQTLRA
Sbjct: 121 AQQLERRVAFRRAMKQAIQRSMRAGAKGVRVQVSGRLGGAEIARTEGYVEGTVPLQTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            IDY  A A T YG  G+KV++   + +    +    A    V+  
Sbjct: 181 DIDYALAEAHTTYGRIGVKVWIYRGEVLPKRKNVQAEAASEAVQGG 226


>gi|319944789|ref|ZP_08019053.1| 30S ribosomal protein S3 [Lautropia mirabilis ATCC 51599]
 gi|319742038|gb|EFV94461.1| 30S ribosomal protein S3 [Lautropia mirabilis ATCC 51599]
          Length = 282

 Score =  274 bits (701), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 116/225 (51%), Positives = 164/225 (72%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V+  W SRW+A   ++   L EDL++RE+L+  LK A V ++LIER 
Sbjct: 1   MGQKIHPTGFRLAVSRNWASRWYAGNKDFAGKLAEDLQVREFLKKRLKNASVGRVLIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI +YSARPG++IGKKG DIE+++ +L+ M    +H+++ E+ KPE++A LIA SI
Sbjct: 61  AKNARITIYSARPGVVIGKKGEDIERLKVELTKMLGVPVHVNIEEIRKPEVDAQLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLE+R++FRRAMKRA+Q+AMR GA G+K++++GRLNGAE++RTE Y EGRVPL TLRA
Sbjct: 121 TQQLEKRIMFRRAMKRAMQNAMRLGAQGIKIMSAGRLNGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            +DYGT+ A+T YG  G+KV+V   D +   ++     +     +
Sbjct: 181 DVDYGTSEAQTTYGIIGVKVWVYKGDTLGRGEAPETTEKEAAGNE 225


>gi|260427444|ref|ZP_05781423.1| ribosomal protein S3 [Citreicella sp. SE45]
 gi|260421936|gb|EEX15187.1| ribosomal protein S3 [Citreicella sp. SE45]
          Length = 236

 Score =  274 bits (700), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 131/225 (58%), Positives = 169/225 (75%), Gaps = 4/225 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K NPI  RL VN TW+SRW+A   +YG LL ED+ IR+++    KQAGVA+++IER 
Sbjct: 1   MGNKTNPIGMRLQVNRTWDSRWYADTKDYGDLLLEDIAIRDFIHEECKQAGVARVIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ ++SARPG+IIGKKG DIE +RKKL+ MT+SE+HL++ EV KPE++A L+ +SI
Sbjct: 61  HKKCRVTIHSARPGVIIGKKGADIEVLRKKLAKMTDSELHLNIVEVRKPELDARLVGESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQ+AMR GA G++V  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVSFRRAMKRAVQNAMRMGALGIRVNVAGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDY    A T YG  GIKV++  + E+ + D   P+A  R  ++
Sbjct: 181 DIDYANVEATTPYGIIGIKVWIF-KGEIMEHD---PSARERKSQE 221


>gi|85713141|ref|ZP_01044173.1| Ribosomal protein S3 [Idiomarina baltica OS145]
 gi|85693011|gb|EAQ30977.1| Ribosomal protein S3 [Idiomarina baltica OS145]
          Length = 226

 Score =  274 bits (700), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 107/226 (47%), Positives = 160/226 (70%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG++  WN+ W+A  +E+   LH D ++R++L   L+ A V++I+IER 
Sbjct: 1   MGQKVHPNGIRLGISRPWNATWYANTNEFADNLHSDHQVRKFLTKELRNASVSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R+++  +T +   ++++EV KPE++A L+A +I
Sbjct: 61  AKSVRVTIHTARPGVVIGKKGEDVEKLRQQVQKLTGAPSQINISEVRKPELDAQLVADNI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           + QLERRV+FRRAMKRAVQ+A+R GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 SGQLERRVMFRRAMKRAVQNAIRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            IDY T+ A T YG  G+KV++   + +    +    A  R   + 
Sbjct: 181 DIDYATSEANTTYGIIGVKVWIFRGEVLGGLPTEEKPAPKRGKNRK 226


>gi|118579125|ref|YP_900375.1| 30S ribosomal protein S3 [Pelobacter propionicus DSM 2379]
 gi|152060889|sp|A1ALU7|RS3_PELPD RecName: Full=30S ribosomal protein S3
 gi|118501835|gb|ABK98317.1| SSU ribosomal protein S3P [Pelobacter propionicus DSM 2379]
          Length = 210

 Score =  274 bits (700), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 118/211 (55%), Positives = 162/211 (76%), Gaps = 1/211 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI FRLGV  +W+S+W+A  ++Y  LLHEDLKIR +L+  L  +G++KI IER 
Sbjct: 1   MGQKVNPIGFRLGVIKSWDSKWYAE-ADYAKLLHEDLKIRAFLKKRLYSSGISKIEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               +I +Y+ARPGLIIGKKG+++E I+K+LSN+T+ EI +++ EV KPE++A L+A+++
Sbjct: 60  ANKTKINIYTARPGLIIGKKGSEVETIKKELSNLTSKEIFINIIEVRKPELDAQLVAENV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERR+ FRRAMK++V SA++FGA G+++  SGRL GAE+SRTE Y EGRVPL TLRA
Sbjct: 120 ALQLERRIAFRRAMKKSVTSALKFGAKGIRITCSGRLGGAEMSRTEWYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDS 211
            IDYG A A+T YG  GIKV +   + +   
Sbjct: 180 DIDYGCAEAKTTYGLIGIKVLIFKGEVLPGH 210


>gi|295688912|ref|YP_003592605.1| 30S ribosomal protein S3 [Caulobacter segnis ATCC 21756]
 gi|295430815|gb|ADG09987.1| ribosomal protein S3 [Caulobacter segnis ATCC 21756]
          Length = 250

 Score =  274 bits (700), Expect = 9e-72,   Method: Composition-based stats.
 Identities = 128/226 (56%), Positives = 171/226 (75%), Gaps = 3/226 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP+  RLGVN TW+SRWFA G++YG +LH+DL +R  L+  L QAGV++I+IER 
Sbjct: 1   MGQKVNPVGLRLGVNRTWDSRWFADGAQYGKMLHQDLAVRAALKKRLYQAGVSRIIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CRI +Y+ARPG+IIGKKG DI+K+RK LS  T  E+HL++ E+ KPE +A L+A+SI
Sbjct: 61  HKKCRITIYAARPGVIIGKKGADIDKLRKDLSVQTEGEVHLNIVEIRKPETDAQLVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERR+ FRRAMKR++QSA+R GA G+++  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRIAFRRAMKRSIQSAVRLGAKGIRINVSGRLGGAEIARMEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            ID+G A A+T YG  G+K ++  + EV + D    A + R+  + 
Sbjct: 181 DIDFGFAEAKTTYGIIGVKTWIF-KGEVLEHDPM--ALDKRLATES 223


>gi|255263196|ref|ZP_05342538.1| ribosomal protein S3 [Thalassiobium sp. R2A62]
 gi|255105531|gb|EET48205.1| ribosomal protein S3 [Thalassiobium sp. R2A62]
          Length = 235

 Score =  273 bits (699), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 131/225 (58%), Positives = 171/225 (76%), Gaps = 4/225 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K+NPI  RL VN TW+SRW+A   +YG LL EDL++RE+++    QAGV++++IER 
Sbjct: 1   MGNKVNPIGMRLQVNRTWDSRWYADTKDYGDLLLEDLRMREFIKKECHQAGVSRVIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ V++ARPG+IIGKKG DIE +RKKL+ MT+SE+HL++ EV KPE++A L+ +SI
Sbjct: 61  HKKCRVTVHTARPGVIIGKKGADIETLRKKLAAMTDSELHLNIVEVRKPELDAALVGESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQ+AMR GA G++V  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVSFRRAMKRAVQNAMRMGALGIRVNLAGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDY    A TAYG  GIK ++  + E+ + D   PAA  R  ++
Sbjct: 181 DIDYAHVEALTAYGIIGIKTWIF-KGEIMEHD---PAARDRRQQE 221


>gi|319796211|ref|YP_004157851.1| ribosomal protein s3 [Variovorax paradoxus EPS]
 gi|315598674|gb|ADU39740.1| ribosomal protein S3 [Variovorax paradoxus EPS]
          Length = 304

 Score =  273 bits (699), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 120/219 (54%), Positives = 163/219 (74%), Gaps = 2/219 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V   W+SRW+A   ++  +L ED+K+REYL+  LK A V++++IER 
Sbjct: 1   MGQKIHPTGFRLAVTRNWSSRWYASDRDFAGMLAEDIKVREYLKKKLKNASVSRVMIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI +YSARPG++IGKKG DIE ++++L       + +++ EV KPEI+A LIA SI
Sbjct: 61  AKNARITIYSARPGVVIGKKGEDIENLKRELGKQLGVPVAVNIEEVRKPEIDAQLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLE+R++FRRAMKRA+Q+AMR GA G+K+++SGRLNG E++R E Y EGRVPL TLRA
Sbjct: 121 TQQLEKRIMFRRAMKRAMQNAMRLGALGIKIMSSGRLNGIEIARCEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
            IDYGT+ A+T YG  G+KV+V   D +  +D  +PA E
Sbjct: 181 DIDYGTSEAKTTYGVIGVKVWVYKGDTLGRND--LPAVE 217


>gi|15642585|ref|NP_232218.1| 30S ribosomal protein S3 [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121730407|ref|ZP_01682752.1| ribosomal protein S3 [Vibrio cholerae V52]
 gi|147673134|ref|YP_001218084.1| 30S ribosomal protein S3 [Vibrio cholerae O395]
 gi|153217580|ref|ZP_01951261.1| ribosomal protein S3 [Vibrio cholerae 1587]
 gi|153827402|ref|ZP_01980069.1| ribosomal protein S3 [Vibrio cholerae MZO-2]
 gi|227082707|ref|YP_002811258.1| ribosomal protein S3 [Vibrio cholerae M66-2]
 gi|229507358|ref|ZP_04396863.1| SSU ribosomal protein S3p (S3e) [Vibrio cholerae BX 330286]
 gi|229509719|ref|ZP_04399200.1| SSU ribosomal protein S3p (S3e) [Vibrio cholerae B33]
 gi|229513513|ref|ZP_04402977.1| SSU ribosomal protein S3p (S3e) [Vibrio cholerae TMA 21]
 gi|229516843|ref|ZP_04406289.1| SSU ribosomal protein S3p (S3e) [Vibrio cholerae RC9]
 gi|229521656|ref|ZP_04411074.1| SSU ribosomal protein S3p (S3e) [Vibrio cholerae TM 11079-80]
 gi|229524571|ref|ZP_04413976.1| SSU ribosomal protein S3p (S3e) [Vibrio cholerae bv. albensis
           VL426]
 gi|229527480|ref|ZP_04416872.1| SSU ribosomal protein S3p (S3e) [Vibrio cholerae 12129(1)]
 gi|229606864|ref|YP_002877512.1| 30S ribosomal protein S3 [Vibrio cholerae MJ-1236]
 gi|254292184|ref|ZP_04962954.1| ribosomal protein S3 [Vibrio cholerae AM-19226]
 gi|254851130|ref|ZP_05240480.1| 30S ribosomal protein S3 [Vibrio cholerae MO10]
 gi|255744441|ref|ZP_05418393.1| SSU ribosomal protein S3p (S3e) [Vibrio cholera CIRS 101]
 gi|258622721|ref|ZP_05717739.1| 30S ribosomal protein S3 [Vibrio mimicus VM573]
 gi|258625746|ref|ZP_05720625.1| 30S ribosomal protein S3 [Vibrio mimicus VM603]
 gi|262166611|ref|ZP_06034348.1| SSU ribosomal protein S3p (S3e) [Vibrio mimicus VM223]
 gi|262170473|ref|ZP_06038151.1| SSU ribosomal protein S3p (S3e) [Vibrio mimicus MB-451]
 gi|297581432|ref|ZP_06943355.1| ribosomal protein S3 [Vibrio cholerae RC385]
 gi|27734537|sp|Q9KNZ0|RS3_VIBCH RecName: Full=30S ribosomal protein S3
 gi|189045346|sp|A5F543|RS3_VIBC3 RecName: Full=30S ribosomal protein S3
 gi|254764556|sp|C3LRQ2|RS3_VIBCM RecName: Full=30S ribosomal protein S3
 gi|9657177|gb|AAF95731.1| ribosomal protein S3 [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121627841|gb|EAX60437.1| ribosomal protein S3 [Vibrio cholerae V52]
 gi|124113468|gb|EAY32288.1| ribosomal protein S3 [Vibrio cholerae 1587]
 gi|146315017|gb|ABQ19556.1| ribosomal protein S3 [Vibrio cholerae O395]
 gi|149738675|gb|EDM53017.1| ribosomal protein S3 [Vibrio cholerae MZO-2]
 gi|150421913|gb|EDN13890.1| ribosomal protein S3 [Vibrio cholerae AM-19226]
 gi|227010595|gb|ACP06807.1| ribosomal protein S3 [Vibrio cholerae M66-2]
 gi|227014479|gb|ACP10689.1| ribosomal protein S3 [Vibrio cholerae O395]
 gi|229335112|gb|EEO00597.1| SSU ribosomal protein S3p (S3e) [Vibrio cholerae 12129(1)]
 gi|229338152|gb|EEO03169.1| SSU ribosomal protein S3p (S3e) [Vibrio cholerae bv. albensis
           VL426]
 gi|229341250|gb|EEO06254.1| SSU ribosomal protein S3p (S3e) [Vibrio cholerae TM 11079-80]
 gi|229345906|gb|EEO10878.1| SSU ribosomal protein S3p (S3e) [Vibrio cholerae RC9]
 gi|229349390|gb|EEO14346.1| SSU ribosomal protein S3p (S3e) [Vibrio cholerae TMA 21]
 gi|229353193|gb|EEO18132.1| SSU ribosomal protein S3p (S3e) [Vibrio cholerae B33]
 gi|229354863|gb|EEO19784.1| SSU ribosomal protein S3p (S3e) [Vibrio cholerae BX 330286]
 gi|229369519|gb|ACQ59942.1| SSU ribosomal protein S3p (S3e) [Vibrio cholerae MJ-1236]
 gi|254846835|gb|EET25249.1| 30S ribosomal protein S3 [Vibrio cholerae MO10]
 gi|255737966|gb|EET93359.1| SSU ribosomal protein S3p (S3e) [Vibrio cholera CIRS 101]
 gi|258581984|gb|EEW06854.1| 30S ribosomal protein S3 [Vibrio mimicus VM603]
 gi|258584909|gb|EEW09640.1| 30S ribosomal protein S3 [Vibrio mimicus VM573]
 gi|261891549|gb|EEY37535.1| SSU ribosomal protein S3p (S3e) [Vibrio mimicus MB-451]
 gi|262026327|gb|EEY44995.1| SSU ribosomal protein S3p (S3e) [Vibrio mimicus VM223]
 gi|297534270|gb|EFH73108.1| ribosomal protein S3 [Vibrio cholerae RC385]
 gi|327485072|gb|AEA79479.1| SSU ribosomal protein S3p (S3e) [Vibrio cholerae LMA3894-4]
          Length = 233

 Score =  273 bits (699), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 108/224 (48%), Positives = 153/224 (68%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WN+ WFA   ++   L  D K+R+YL   L  A +++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNATWFANTKDFADNLDGDFKVRQYLSKELANASLSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  ++ +      +++ EV KPE++  L+A SI
Sbjct: 61  AKSIRVTIHTARPGVVIGKKGEDVEKLRAAVAKIAGVPAQINIAEVRKPELDGQLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVE 224
            IDY T+ A T YG  G+KV++   + +    +   AAE +  +
Sbjct: 181 DIDYATSSAHTTYGVIGVKVWIFKGEILGGMPAATEAAEPKADK 224


>gi|56551418|ref|YP_162257.1| 30S ribosomal protein S3 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241761066|ref|ZP_04759155.1| ribosomal protein S3 [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|260752968|ref|YP_003225861.1| 30S ribosomal protein S3 [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
 gi|61215381|sp|Q5NQ59|RS3_ZYMMO RecName: Full=30S ribosomal protein S3
 gi|56542992|gb|AAV89146.1| ribosomal protein S3 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241374685|gb|EER64146.1| ribosomal protein S3 [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|258552331|gb|ACV75277.1| ribosomal protein S3 [Zymomonas mobilis subsp. mobilis NCIMB 11163]
          Length = 231

 Score =  273 bits (699), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 129/218 (59%), Positives = 163/218 (74%), Gaps = 1/218 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K NPI  RL +N TW+SRWFA+G +YG LL ED+KIR+++   L QA ++K++IER 
Sbjct: 1   MGHKSNPIGMRLQINRTWDSRWFAQGGDYGQLLLEDIKIRKFIMKTLPQAAISKVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K CRI +Y+ARPG+IIGKKG DIEK+RKKL +MT S + L++ E+ KPEI+A L+AQ I
Sbjct: 61  AKLCRISIYAARPGVIIGKKGADIEKLRKKLDSMTESGVSLNIVEIRKPEIDAQLVAQGI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV FRRAMKRAVQSA+R GA GV++   GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 ADQLERRVAFRRAMKRAVQSALRLGAQGVRITCGGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAA 218
           ++DY  A A TAYG CGIKV++  + E+   D      
Sbjct: 181 NVDYAEAEAHTAYGVCGIKVWIF-KGEIMAHDPLAQDR 217


>gi|317123091|ref|YP_004103094.1| 30S ribosomal protein S3P [Thermaerobacter marianensis DSM 12885]
 gi|315593071|gb|ADU52367.1| SSU ribosomal protein S3P [Thermaerobacter marianensis DSM 12885]
          Length = 226

 Score =  273 bits (699), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 104/220 (47%), Positives = 151/220 (68%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK +P  FRLG+   W+SRW+AR  E+  LL ED +IR +++  L  AG++++ IER 
Sbjct: 1   MGQKTHPKGFRLGIIRDWDSRWYARRQEFVDLLLEDQRIRRHIKKRLYDAGISRVEIERA 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               RI +++ +PG++IGK GT +E +R+ L  MT  ++ ++V EV +PE++A L+A+SI
Sbjct: 61  ANRVRITIHAGKPGMVIGKGGTGVEALRQDLERMTGRQVAINVVEVKEPELDAQLVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A Q+ERR+ +RRAMK+A+Q AMR GA G K+  SGRL GAE+SR+E   EG VPL TLRA
Sbjct: 121 AAQIERRISWRRAMKQALQRAMRAGAKGCKIRVSGRLGGAEISRSEWTAEGSVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEH 220
            IDYG A A T YG  G+KV+++  + + ++      AE 
Sbjct: 181 DIDYGQAEAFTTYGQIGVKVWINRGEVLPEAKREAAPAEQ 220


>gi|78221852|ref|YP_383599.1| 30S ribosomal protein S3 [Geobacter metallireducens GS-15]
 gi|91207656|sp|Q39Y00|RS3_GEOMG RecName: Full=30S ribosomal protein S3
 gi|78193107|gb|ABB30874.1| SSU ribosomal protein S3P [Geobacter metallireducens GS-15]
          Length = 211

 Score =  273 bits (699), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 115/212 (54%), Positives = 161/212 (75%), Gaps = 1/212 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI FRLGV  TW+SRW+A  ++Y  LLHED+K+R +L+  L  +GV+KI IER 
Sbjct: 1   MGQKVNPIGFRLGVIRTWDSRWYAE-ADYAKLLHEDIKLRNFLKKRLFNSGVSKIEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               +I +++ARPGLIIGKKG ++E ++K+L+ +T+ EI+L++ EV KPE++A L+++++
Sbjct: 60  ASKAKINIFTARPGLIIGKKGAEVETLKKELAKLTDKEIYLNIQEVRKPELDAQLVSENV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV FRRAMK++V SA++FGA G+++  SGRL GAE+SRTE Y EGRVPL TLRA
Sbjct: 120 ALQLERRVAFRRAMKKSVTSALKFGAKGIRITCSGRLGGAEMSRTEWYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSD 212
            IDYG A A+T YG  G+KV +   + +    
Sbjct: 180 DIDYGFAEAKTTYGIIGVKVLIFKGEVLPGQK 211


>gi|329898716|ref|ZP_08272450.1| SSU ribosomal protein S3p (S3e) [gamma proteobacterium IMCC3088]
 gi|328920771|gb|EGG28227.1| SSU ribosomal protein S3p (S3e) [gamma proteobacterium IMCC3088]
          Length = 224

 Score =  273 bits (699), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 107/224 (47%), Positives = 152/224 (67%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+    NS W+A    Y   L  DL++R+Y++  L  A V++ILIER 
Sbjct: 1   MGQKVHPTGIRLGIVKDHNSVWYADSKNYARQLITDLEVRQYIEKVLDNASVSRILIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +  RI + +ARPG++IGKKG D++K+RK LS      +++++ E+ KP+++A L+AQ++
Sbjct: 61  AQTARITISTARPGIVIGKKGEDVDKLRKDLSARMGVPVNINIEEIRKPDLDAKLVAQNV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV+FRRAMKRAVQ+A+R GA+GVK+  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVMFRRAMKRAVQNALRQGAEGVKIQVSGRLGGAEIARAEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVE 224
            IDY T  A T YG  G+KV++   + +   +S     +     
Sbjct: 181 DIDYATYEASTTYGIIGVKVWIFKGEVIGGQESAQDGGKKPAAN 224


>gi|126739684|ref|ZP_01755376.1| 30S ribosomal protein S3 [Roseobacter sp. SK209-2-6]
 gi|126719330|gb|EBA16040.1| 30S ribosomal protein S3 [Roseobacter sp. SK209-2-6]
          Length = 236

 Score =  273 bits (699), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 127/225 (56%), Positives = 171/225 (76%), Gaps = 4/225 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K+NP+  RL VN TW+SRW+A   ++G LL ED++IR++++   KQAGVA+++IER 
Sbjct: 1   MGHKVNPVGMRLQVNRTWDSRWYADTKDFGDLLLEDIRIRDFIKTECKQAGVARVIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ +++ARPG+IIGKKG DIE +RKKL+ MT+SE+HL++ EV KPE++A L+ +SI
Sbjct: 61  HKKCRVTIHTARPGVIIGKKGADIEVLRKKLAAMTDSELHLNIVEVRKPELDAQLVGESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQ+AMR GA G++V  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVSFRRAMKRAVQNAMRMGALGIRVNVAGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDY  + A T YG  GIK ++  + E+ + D   P A  R  ++
Sbjct: 181 DIDYAHSEAMTPYGIIGIKTWIF-KGEIMEHD---PQARDRKAQE 221


>gi|118616577|ref|YP_904909.1| 30S ribosomal protein S3 [Mycobacterium ulcerans Agy99]
 gi|183981059|ref|YP_001849350.1| 30S ribosomal protein S3, RpsC [Mycobacterium marinum M]
 gi|152060883|sp|A0PM69|RS3_MYCUA RecName: Full=30S ribosomal protein S3
 gi|226697734|sp|B2HSN7|RS3_MYCMM RecName: Full=30S ribosomal protein S3
 gi|118568687|gb|ABL03438.1| 30S ribosomal protein S3, RpsC [Mycobacterium ulcerans Agy99]
 gi|183174385|gb|ACC39495.1| 30S ribosomal protein S3, RpsC [Mycobacterium marinum M]
          Length = 275

 Score =  273 bits (699), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 105/229 (45%), Positives = 148/229 (64%), Gaps = 5/229 (2%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP  FRLG+   W SRW+A   +Y   + ED+ IR  L   L++AG+A + IERT
Sbjct: 1   MGQKINPHGFRLGITTDWKSRWYAD-KQYADYVKEDVAIRRLLSSGLERAGIADVEIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG++GT+ ++IR  L  +T  ++ L++ EV  PE  A L+AQ +
Sbjct: 60  RDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTGKQVQLNILEVKNPESQAQLVAQGV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAM-RFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           A+QL  RV FRRAM++A+QSAM +    G++V  SGRL GAE+SR+E Y EGRVPL TLR
Sbjct: 120 AEQLSNRVAFRRAMRKAIQSAMRQPNVKGIRVQCSGRLGGAEMSRSEFYREGRVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDST---IPAAEHRVVEK 225
           A IDYG   A+T +G  G+KV++   D V         +PA   R   +
Sbjct: 180 ADIDYGLYEAKTTFGRIGVKVWIYKGDIVGGKRELAAAVPAGADRPRRE 228


>gi|239817867|ref|YP_002946777.1| 30S ribosomal protein S3 [Variovorax paradoxus S110]
 gi|239804444|gb|ACS21511.1| ribosomal protein S3 [Variovorax paradoxus S110]
          Length = 308

 Score =  273 bits (699), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 120/226 (53%), Positives = 166/226 (73%), Gaps = 2/226 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V   W+SRW+A   ++  +L ED+K+REYL+  LK A V++++IER 
Sbjct: 1   MGQKIHPTGFRLAVTRNWSSRWYASDRDFAGMLAEDIKVREYLKKKLKNASVSRVMIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI +YSARPG++IGKKG DIE ++++L       + +++ EV KPEI+A LIA SI
Sbjct: 61  AKNARITIYSARPGVVIGKKGEDIENLKRELGKQLGVPVAVNIEEVRKPEIDAQLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLE+R++FRRAMKRA+Q+AMR GA G+K++++GRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 TQQLEKRIMFRRAMKRAMQNAMRLGAQGIKIMSAGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            IDYGT+ A+T YG  G+KV+V   D +  +D  +PA E    + +
Sbjct: 181 DIDYGTSEAKTTYGVIGVKVWVYKGDTLGRND--LPAVETPRPDDE 224


>gi|171060663|ref|YP_001793012.1| 30S ribosomal protein S3 [Leptothrix cholodnii SP-6]
 gi|226697726|sp|B1Y8I1|RS3_LEPCP RecName: Full=30S ribosomal protein S3
 gi|170778108|gb|ACB36247.1| ribosomal protein S3 [Leptothrix cholodnii SP-6]
          Length = 285

 Score =  273 bits (698), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 116/215 (53%), Positives = 163/215 (75%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V   W+SRW+A    +  +L ED+++RE+L+  LK A V+++ IER 
Sbjct: 1   MGQKIHPTGFRLPVTRNWSSRWYANNRNFAGMLAEDIEVREFLKKKLKNAAVSRVTIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI +YSARPG++IGKKG DIE ++ +L+ M    + +++ EV KPE++A LIA+SI
Sbjct: 61  AKNARITIYSARPGVVIGKKGEDIENLKLELAKMLKVPVAVNIEEVRKPEVDAQLIAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLE+R++FRRAMKRA+Q+AMR GA G+K++++GRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 TQQLEKRIMFRRAMKRAMQNAMRLGAQGIKIMSAGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTI 215
            IDYGTA A+T YG  G+KV+V   D +++ D+ +
Sbjct: 181 DIDYGTAEAKTTYGVIGVKVWVYRGDRLANGDAPV 215


>gi|114766893|ref|ZP_01445815.1| 30S ribosomal protein S3 [Pelagibaca bermudensis HTCC2601]
 gi|114540939|gb|EAU43999.1| 30S ribosomal protein S3 [Roseovarius sp. HTCC2601]
          Length = 236

 Score =  273 bits (698), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 133/225 (59%), Positives = 170/225 (75%), Gaps = 4/225 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K NPI  RL VN TW+SRW+A   +YG LL ED+ IRE++    KQAGVA+++IER 
Sbjct: 1   MGNKTNPIGMRLQVNRTWDSRWYADTKDYGDLLLEDIAIREFIHEECKQAGVARVIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ V++ARPG+IIGKKG DIE +RKKL++MT+SE+HL++ EV KPE++A L+ +SI
Sbjct: 61  HKKCRVTVHTARPGVIIGKKGADIEVLRKKLASMTDSELHLNIVEVRKPELDARLVGESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQ+AMR GA G++V  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVSFRRAMKRAVQNAMRMGALGIRVNVAGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDY    A T YG  GIKV++  + E+ + D   PAA  R  ++
Sbjct: 181 DIDYANVEATTPYGIIGIKVWIF-KGEIMEHD---PAARDRKSQE 221


>gi|91786173|ref|YP_547125.1| 30S ribosomal protein S3 [Polaromonas sp. JS666]
 gi|123165524|sp|Q12GW5|RS3_POLSJ RecName: Full=30S ribosomal protein S3
 gi|91695398|gb|ABE42227.1| SSU ribosomal protein S3P [Polaromonas sp. JS666]
          Length = 301

 Score =  273 bits (698), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 120/226 (53%), Positives = 164/226 (72%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP  FRL V+  W SRW+A   ++  +L ED+K+REYL+  LK A V+++LIER 
Sbjct: 1   MGQKINPTGFRLAVSRNWASRWYASNRDFAGMLAEDIKVREYLKAKLKNAAVSRVLIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI ++SARPG++IGKKG DIE ++K+LS      + +++ EV KPEI+A LIA SI
Sbjct: 61  AKNARITIFSARPGVVIGKKGEDIENLKKELSRQLGVPVAVNIEEVRKPEIDAKLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLE+R++FRRAMKRA+Q+AMR GA G+K+++SGRLNG E++R E Y EGRVPL TLRA
Sbjct: 121 TQQLEKRIMFRRAMKRAMQNAMRLGALGIKIMSSGRLNGIEIARCEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            IDYGT+ A+T YG  G+KV+V   D +   +S     +    +++
Sbjct: 181 DIDYGTSEAKTTYGVIGVKVWVYKGDTLGRGESPGAKLDAAPSDEE 226


>gi|90020613|ref|YP_526440.1| 30S ribosomal protein S3 [Saccharophagus degradans 2-40]
 gi|123396486|sp|Q21M51|RS3_SACD2 RecName: Full=30S ribosomal protein S3
 gi|89950213|gb|ABD80228.1| SSU ribosomal protein S3P [Saccharophagus degradans 2-40]
          Length = 224

 Score =  273 bits (698), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 107/224 (47%), Positives = 154/224 (68%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+     S W+A  +EY   L++DL++R+Y+Q  L  A V++I IER 
Sbjct: 1   MGQKVHPTGIRLGIVKKHTSTWYAGKAEYADKLNQDLQVRKYIQNALAHASVSRIDIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IGKKG D+EK+R +L+      +H+++ E+ KP+++A L AQS+
Sbjct: 61  ANTARVTIHTARPGIVIGKKGEDVEKLRTELTKQMGVPVHINIEEIRKPDLDAALAAQSV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV+FRRAMKR VQ+AMR GA+GVKV   GRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVMFRRAMKRTVQNAMRQGAEGVKVQVGGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVE 224
            IDY TA A T YG  G+KV++   + +   +      + +  +
Sbjct: 181 DIDYATAEASTTYGIIGVKVWIFKGEIIGGIEEVEANQKKKGSK 224


>gi|300114730|ref|YP_003761305.1| 30S ribosomal protein S3 [Nitrosococcus watsonii C-113]
 gi|299540667|gb|ADJ28984.1| ribosomal protein S3 [Nitrosococcus watsonii C-113]
          Length = 223

 Score =  273 bits (697), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 108/216 (50%), Positives = 154/216 (71%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI  RLG+   WNS+W+A   ++  LL+ DL +R YL   L  A V+ I I+R 
Sbjct: 1   MGQKVHPIGIRLGIVKDWNSKWYADSGQFSELLNNDLAVRSYLTKKLSHALVSNIQIDRP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +N RI +++ARPG++IGKKG DI  +R+++S M    +H+++ E+ KPE++ATL+A ++
Sbjct: 61  ARNARITIHTARPGIVIGKKGEDINNLRQEVSGMMGIPVHINIQEIRKPELDATLVAVNV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERR++FRRAMKRAV +AMR GA G+++  SGRLNGAE++R+E Y EGRVPL TLRA
Sbjct: 121 AQQLERRIMFRRAMKRAVTNAMRVGAQGIRIKVSGRLNGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIP 216
            IDYG A A T YG  G+KV++   +     +  + 
Sbjct: 181 DIDYGFAEARTTYGILGVKVWIFKGEVFEQPEPQVA 216


>gi|77165781|ref|YP_344306.1| 30S ribosomal protein S3 [Nitrosococcus oceani ATCC 19707]
 gi|254433894|ref|ZP_05047402.1| ribosomal protein S3 [Nitrosococcus oceani AFC27]
 gi|91207823|sp|Q3J8S0|RS3_NITOC RecName: Full=30S ribosomal protein S3
 gi|76884095|gb|ABA58776.1| SSU ribosomal protein S3P [Nitrosococcus oceani ATCC 19707]
 gi|207090227|gb|EDZ67498.1| ribosomal protein S3 [Nitrosococcus oceani AFC27]
          Length = 223

 Score =  273 bits (697), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 108/217 (49%), Positives = 154/217 (70%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS+W+A   ++  LL+ DL +R YL   L  A V+ I I+R 
Sbjct: 1   MGQKVHPTGIRLGIVKDWNSKWYADSGQFSELLNNDLAVRSYLAKKLSHALVSNIQIDRP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +N RI +++ARPG++IGKKG DI  +R+++S M    +H+++ E+ KPE++ATL+A ++
Sbjct: 61  ARNARITIHTARPGIVIGKKGEDINNLRQEVSRMMGIPVHINIQEIRKPELDATLVAANV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERR++FRRAMKRAV +AMR GA G+++  SGRLNGAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRIMFRRAMKRAVTNAMRVGAQGIRIKVSGRLNGAEIARNEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPA 217
            IDYG A A+T YG  G+KV++   +     +  + A
Sbjct: 181 DIDYGFAEAKTTYGILGVKVWIFKGEVFEQPEPQVAA 217


>gi|295401914|ref|ZP_06811877.1| ribosomal protein S3 [Geobacillus thermoglucosidasius C56-YS93]
 gi|312109267|ref|YP_003987583.1| ribosomal protein S3 [Geobacillus sp. Y4.1MC1]
 gi|294976044|gb|EFG51659.1| ribosomal protein S3 [Geobacillus thermoglucosidasius C56-YS93]
 gi|311214368|gb|ADP72972.1| ribosomal protein S3 [Geobacillus sp. Y4.1MC1]
          Length = 218

 Score =  273 bits (697), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 104/209 (49%), Positives = 152/209 (72%), Gaps = 1/209 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI  R+G+   W+SRW+A   +Y  LLHEDLKIREY+   L+ A V++I IER 
Sbjct: 1   MGQKVNPIGLRIGIIRDWDSRWYAE-KDYADLLHEDLKIREYINKRLQDAAVSRIEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                I +++A+PG++IGK G+++E +RK L+ +T   +H+++ E+ KP+++A L+A++I
Sbjct: 60  ANRVNITIHTAKPGMVIGKGGSEVEALRKALTQLTGKRVHINIVEIKKPDLDAKLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE RV FRRA K+A+Q AMR GA G+K + SGRL GA+++R+E Y EG VPL TLRA
Sbjct: 120 ARQLENRVSFRRAQKQAIQRAMRAGAKGIKTMVSGRLGGADIARSEHYSEGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVS 209
            IDY TA A+T YG  G+KV++   + + 
Sbjct: 180 DIDYATAEADTTYGKIGVKVWIYRGEVLP 208


>gi|189424416|ref|YP_001951593.1| 30S ribosomal protein S3 [Geobacter lovleyi SZ]
 gi|226697717|sp|B3E7U1|RS3_GEOLS RecName: Full=30S ribosomal protein S3
 gi|189420675|gb|ACD95073.1| ribosomal protein S3 [Geobacter lovleyi SZ]
          Length = 210

 Score =  273 bits (697), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 112/211 (53%), Positives = 160/211 (75%), Gaps = 1/211 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI FRLGV  TW+S+W+A  +++   LHEDLKIR++L+  L  AG++KI IER 
Sbjct: 1   MGQKVNPIGFRLGVIKTWDSKWYAE-ADFAKNLHEDLKIRQFLKKRLYSAGISKIEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               +I +++ARPGLIIGKKG ++E ++K L+ +T+ E+ +++NEV KPE++A L+A+++
Sbjct: 60  ANKTKINIHAARPGLIIGKKGAEVELLKKDLAAITSKEVFININEVRKPELDAQLVAENV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERR+ FRRAMK++V S+++FGA G+++  SGRL GAE+SRTE Y EGRVPL TLRA
Sbjct: 120 ALQLERRIAFRRAMKKSVTSSLKFGAKGIRITCSGRLGGAEMSRTEWYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDS 211
            IDYG A A+T YG  G+KV +   + +   
Sbjct: 180 DIDYGFAEAKTTYGIIGVKVLIFKGEVLPGQ 210


>gi|88812751|ref|ZP_01127997.1| ribosomal protein S3 [Nitrococcus mobilis Nb-231]
 gi|88789989|gb|EAR21110.1| ribosomal protein S3 [Nitrococcus mobilis Nb-231]
          Length = 224

 Score =  273 bits (697), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 109/224 (48%), Positives = 158/224 (70%), Gaps = 2/224 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K++P  FRLG+   W S W+A  + +G  L+ DLK+R +++  L  A ++KI IER 
Sbjct: 1   MGHKVHPTGFRLGITEEWRSMWYADSANFGDYLNTDLKVRNFIKHKLAHASISKIKIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN  I +Y+ARPG++IGKKG DIE +R +L+ M +  +H+++ E+ KPE++A L+A+++
Sbjct: 61  AKNALITIYTARPGIVIGKKGADIEALRVRLARMMDIPVHVNIEEIRKPELDAQLVAENV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERR++FRRAMKRAV +AMR G  G+++  SGRLNGAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRIMFRRAMKRAVGNAMRLGGQGIRIQVSGRLNGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVE 224
            IDYG A A+T YG  G+KV++   + +     ++P +  R   
Sbjct: 181 DIDYGLAHAKTTYGVIGVKVWIFKGEIL--DTDSVPGSTARKAR 222


>gi|121608249|ref|YP_996056.1| 30S ribosomal protein S3 [Verminephrobacter eiseniae EF01-2]
 gi|152060914|sp|A1WHD1|RS3_VEREI RecName: Full=30S ribosomal protein S3
 gi|121552889|gb|ABM57038.1| SSU ribosomal protein S3P [Verminephrobacter eiseniae EF01-2]
          Length = 294

 Score =  273 bits (697), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 123/226 (54%), Positives = 167/226 (73%), Gaps = 2/226 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V+  W SRW+A   ++  +L ED+K+REYL+  LK A V++ILIER 
Sbjct: 1   MGQKIHPTGFRLAVSRNWASRWYADNRDFAGMLAEDIKVREYLKTKLKNAAVSRILIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI +YSARPG++IGKKG DIE ++K+L+      + +++ EV KPEI+A LIA SI
Sbjct: 61  AKNARITIYSARPGVVIGKKGEDIESLKKELAVRLGVPVAVNIEEVRKPEIDAKLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLE+R++FRRAMKRA+Q+AMR GA G+K+++SGRLNG E++R E Y EGRVPL TLRA
Sbjct: 121 TQQLEKRIMFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGIEIARCEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            IDYGT+ A+T YG  G+KV+V   D +  +D  +PA E    +++
Sbjct: 181 DIDYGTSEAKTTYGVIGVKVWVYKGDTLGRND--LPAVETPRPDEE 224


>gi|88704370|ref|ZP_01102084.1| 30S ribosomal protein S3 [Congregibacter litoralis KT71]
 gi|88701421|gb|EAQ98526.1| 30S ribosomal protein S3 [Congregibacter litoralis KT71]
          Length = 222

 Score =  273 bits (697), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 103/213 (48%), Positives = 150/213 (70%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+     S W+A    Y   L  DL++R  ++  L  A V++++IER 
Sbjct: 1   MGQKVHPTGIRLGIVKDHTSVWYADRKNYAKQLVTDLQVRSLIEKKLDNASVSRVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +  RI +++ARPG++IGKKG D++K+RK+L+      +H+++ E+ KP+++A L+AQ++
Sbjct: 61  AQTARITIHTARPGIVIGKKGEDVDKLRKQLTKEMGVPVHINIEEIRKPDLDARLVAQNV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV+FRRAMKR VQ+AMR GA+G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVMFRRAMKRVVQNAMRQGAEGIKVQVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDS 213
            IDY T  A T YG  G+KV++   + +   ++
Sbjct: 181 DIDYATYEAATTYGILGVKVWIFKGEVLGADEA 213


>gi|126728170|ref|ZP_01743986.1| 30S ribosomal protein S3 [Sagittula stellata E-37]
 gi|126711135|gb|EBA10185.1| 30S ribosomal protein S3 [Sagittula stellata E-37]
          Length = 240

 Score =  272 bits (696), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 130/225 (57%), Positives = 171/225 (76%), Gaps = 4/225 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K NPI  RL +N TW+SRW+A   +YG LL EDL+IR+++    KQAG+A+++IER 
Sbjct: 1   MGNKTNPIGMRLQINRTWDSRWYADTKDYGDLLLEDLRIRDFIHTECKQAGIARVIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ +++ARPG+IIGKKG DIE +RKK++NMT+SE+HL++ EV KPE++ATL+ +SI
Sbjct: 61  HKKCRVTIHTARPGVIIGKKGADIEVLRKKIANMTDSELHLNIVEVRKPELDATLVGESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQ+AMR GA G++V  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVSFRRAMKRAVQNAMRMGALGIRVNVAGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDY    A T YG  GIKV++  + E+ + D   P A  R  ++
Sbjct: 181 DIDYANIEATTPYGIIGIKVWIF-KGEIMEHD---PQARDRKSQE 221


>gi|134298099|ref|YP_001111595.1| 30S ribosomal protein S3 [Desulfotomaculum reducens MI-1]
 gi|189044975|sp|A4J117|RS3_DESRM RecName: Full=30S ribosomal protein S3
 gi|134050799|gb|ABO48770.1| SSU ribosomal protein S3P [Desulfotomaculum reducens MI-1]
          Length = 221

 Score =  272 bits (696), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 101/216 (46%), Positives = 151/216 (69%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   R+G+   W  +WFA    Y  LL ED+KIREY++  L QAG+++I IER 
Sbjct: 1   MGQKVNPKGLRVGIIKDWEGKWFADKRNYSNLLIEDVKIREYIKRKLYQAGISRIQIERA 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               ++ +++A+PG++IG+ G ++E +RK+L  MT  ++H+++ EV  PE++A L+A++I
Sbjct: 61  ANRVKVSIHTAKPGIVIGRGGAEVEALRKELEKMTAKQVHVNIVEVKTPEVDAQLVAENI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLE+R+ FRRAMK+ VQ ++R GA G+K+  SGRL GAE++RTE Y EG+VPL TLRA
Sbjct: 121 ASQLEKRIAFRRAMKQTVQRSLRMGAKGIKIACSGRLAGAEIARTEWYSEGKVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIP 216
            IDYG A A T YG  G+KV++   + + ++     
Sbjct: 181 DIDYGFAEANTTYGKIGVKVWIYKGEVLPEAKKPAA 216


>gi|148554268|ref|YP_001261850.1| 30S ribosomal protein S3 [Sphingomonas wittichii RW1]
 gi|189045373|sp|A5V5Z6|RS3_SPHWW RecName: Full=30S ribosomal protein S3
 gi|148499458|gb|ABQ67712.1| SSU ribosomal protein S3P [Sphingomonas wittichii RW1]
          Length = 231

 Score =  272 bits (696), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 124/218 (56%), Positives = 166/218 (76%), Gaps = 1/218 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK NPI  RL +N TW+SRW+A G++YG LL EDLKIR+++   + QA ++K++IER 
Sbjct: 1   MGQKSNPIGMRLQINRTWDSRWYADGADYGRLLLEDLKIRKHIMKAIPQAAISKVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K CRI VY+ARPG+IIGKKG DIEK+R+ L  MT+S++ L++ E+ KPEI++ L+AQ +
Sbjct: 61  AKLCRISVYAARPGVIIGKKGADIEKLRRALGKMTSSDVSLNIVEIRKPEIDSKLVAQGV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERR+ FRRAMKRAVQSA+R GA+G+++  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 ADQLERRIAFRRAMKRAVQSALRLGAEGIRITCAGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAA 218
           ++DY  A A TAYG CGIKV++  + E+   D      
Sbjct: 181 NVDYAEAEAHTAYGVCGIKVWIF-KGEILGHDPLAQDR 217


>gi|124268621|ref|YP_001022625.1| 30S ribosomal protein S3 [Methylibium petroleiphilum PM1]
 gi|152060875|sp|A2SLF1|RS3_METPP RecName: Full=30S ribosomal protein S3
 gi|124261396|gb|ABM96390.1| SSU ribosomal protein S3P [Methylibium petroleiphilum PM1]
          Length = 299

 Score =  272 bits (696), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 118/215 (54%), Positives = 162/215 (75%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P+ FRL V   W+SRW+A    +  +L EDLK+REYL+  LK A V++ILIER 
Sbjct: 1   MGQKIHPVGFRLPVTRNWSSRWYASNRNFATMLAEDLKVREYLKAKLKSAAVSRILIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI +YSARPG++IGKKG DIE ++ +L+      + +++ EV KPEI+A LIA SI
Sbjct: 61  AKNARITIYSARPGVVIGKKGEDIENLKAELTRRLGVPVAVNIEEVRKPEIDAQLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLE+R++FRRAMKRA+Q+AMR GA G+K++++GRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 TQQLEKRIMFRRAMKRAMQNAMRLGAQGIKIMSAGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTI 215
            IDYG + A+T YG  G+KV+V   D +++ ++ +
Sbjct: 181 DIDYGFSEAKTTYGIIGVKVWVYRGDRLANGEAPV 215


>gi|34499635|ref|NP_903850.1| 30S ribosomal protein S3 [Chromobacterium violaceum ATCC 12472]
 gi|61215684|sp|Q7NQF8|RS3_CHRVO RecName: Full=30S ribosomal protein S3
 gi|34105485|gb|AAQ61840.1| 30S ribosomal protein S3 [Chromobacterium violaceum ATCC 12472]
          Length = 233

 Score =  272 bits (696), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 111/227 (48%), Positives = 161/227 (70%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL VN  W+S+WFA    +  +L +D+++RE+L+  L  A V ++ IER 
Sbjct: 1   MGQKIHPTGFRLAVNKNWSSKWFASSQNFPEMLKQDIEVREFLKKRLGHASVGRVTIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ RI ++SARPG++IGKKG DIE ++++L       +H+++ EV KPE++A +IA  I
Sbjct: 61  AKSARITIHSARPGVVIGKKGEDIEVLKQELQKRLGVPVHVNIEEVRKPELDAQIIADGI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLE+RV+FRRAMKRA+Q+AMR GA+G+K+++SGRLNG +++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLEKRVMFRRAMKRAMQNAMRLGAEGIKIMSSGRLNGIDIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            +DY T+ A+T YG  GIKV+V   +         PAA  + + K +
Sbjct: 181 DVDYATSEAKTTYGIIGIKVWVYKGELKPGQVQATPAAPEKKMRKGA 227


>gi|323703542|ref|ZP_08115188.1| ribosomal protein S3 [Desulfotomaculum nigrificans DSM 574]
 gi|323531533|gb|EGB21426.1| ribosomal protein S3 [Desulfotomaculum nigrificans DSM 574]
          Length = 221

 Score =  272 bits (696), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 102/216 (47%), Positives = 151/216 (69%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   R+G+   W  +WFA    Y  LL ED+KIRE+++  L QAG+AKI IER 
Sbjct: 1   MGQKVNPKGLRIGIIKDWEGKWFADKRNYSNLLIEDVKIREFIKKKLYQAGIAKIQIERA 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               ++ +++A+PG++IG+ G ++E +RK+L  MT  ++++++ EV  PEI+A L+A+++
Sbjct: 61  ANRVKVSIHTAKPGIVIGRGGAEVEALRKQLEKMTGKQVNVNIVEVKTPEIDAQLVAENV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLE+R+ FRRAMK+ VQ A+R GA G+K+  SGRL GAE++RTE Y EG+VPL TLRA
Sbjct: 121 AAQLEKRIAFRRAMKQTVQRALRLGAKGIKIACSGRLAGAEIARTEWYSEGKVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIP 216
            IDYG A A T YG  G+KV++   + + ++     
Sbjct: 181 DIDYGFAEANTTYGKIGVKVWIYKGEVLPEAKKPAA 216


>gi|152978147|ref|YP_001343776.1| 30S ribosomal protein S3 [Actinobacillus succinogenes 130Z]
 gi|189044986|sp|A6VLJ4|RS3_ACTSZ RecName: Full=30S ribosomal protein S3
 gi|150839870|gb|ABR73841.1| ribosomal protein S3 [Actinobacillus succinogenes 130Z]
          Length = 235

 Score =  272 bits (696), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 110/230 (47%), Positives = 151/230 (65%), Gaps = 6/230 (2%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   W+S WFA   ++   L  D K+R++L   L  A V++I IER 
Sbjct: 1   MGQKVHPHGIRLGIVKPWSSTWFANTQDFADNLDGDFKVRKFLNKELMNASVSRITIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  ++ +      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRTAVAKIAGVPAQINIAEVKKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD------SDSTIPAAEHRVVE 224
            IDY TA A T YG  G+KV++   + +             PAA  +   
Sbjct: 181 DIDYNTAEAHTTYGVIGVKVWIFKGEILGGMAAIAQQPEQQPAAPKKAPR 230


>gi|307823448|ref|ZP_07653677.1| ribosomal protein S3 [Methylobacter tundripaludum SV96]
 gi|307735433|gb|EFO06281.1| ribosomal protein S3 [Methylobacter tundripaludum SV96]
          Length = 223

 Score =  272 bits (695), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 106/223 (47%), Positives = 154/223 (69%), Gaps = 2/223 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNSRW+A   +Y   LH+DL +R+Y++  L  A V++I I R 
Sbjct: 1   MGQKVHPTGIRLGIVKDWNSRWYASSQDYSVFLHQDLTVRDYIKKKLAHASVSRIQINRP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
             N  I +++ARPG++IGKKG DIE +R+ +S +    + L+V E+ KPE++A L+A+ +
Sbjct: 61  PNNAHITIHTARPGIVIGKKGEDIEALRQAVSKIMGIPVQLNVEEIRKPELDAQLVAEGV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLE+R+++RRAMKRAV + MR GA+G+K+   GRLNGAE++R+E Y EGRVPL TLRA
Sbjct: 121 AQQLEKRIMYRRAMKRAVTNTMRLGAEGIKINVGGRLNGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDE--VSDSDSTIPAAEHR 221
            IDY TA A T YG  GIKV++   +   +    ++I +   +
Sbjct: 181 DIDYATAEAHTTYGIIGIKVWIFKGEVFDMDAHIASINSESKK 223


>gi|68249379|ref|YP_248491.1| 30S ribosomal protein S3 [Haemophilus influenzae 86-028NP]
 gi|145628326|ref|ZP_01784127.1| 30S ribosomal protein S3 [Haemophilus influenzae 22.1-21]
 gi|145630528|ref|ZP_01786308.1| 30S ribosomal protein S3 [Haemophilus influenzae R3021]
 gi|145632137|ref|ZP_01787872.1| 30S ribosomal protein S3 [Haemophilus influenzae 3655]
 gi|145634806|ref|ZP_01790514.1| 30S ribosomal protein S3 [Haemophilus influenzae PittAA]
 gi|145636660|ref|ZP_01792327.1| 30S ribosomal protein S3 [Haemophilus influenzae PittHH]
 gi|145638417|ref|ZP_01794027.1| 30S ribosomal protein S3 [Haemophilus influenzae PittII]
 gi|145640878|ref|ZP_01796460.1| 30S ribosomal protein S3 [Haemophilus influenzae R3021]
 gi|148826572|ref|YP_001291325.1| 30S ribosomal protein S3 [Haemophilus influenzae PittEE]
 gi|148827972|ref|YP_001292725.1| 30S ribosomal protein S3 [Haemophilus influenzae PittGG]
 gi|229844650|ref|ZP_04464789.1| 30S ribosomal protein S3 [Haemophilus influenzae 6P18H1]
 gi|229845833|ref|ZP_04465945.1| 30S ribosomal protein S3 [Haemophilus influenzae 7P49H1]
 gi|319897723|ref|YP_004135920.1| 30S ribosomal subunit protein s3 [Haemophilus influenzae F3031]
 gi|329122789|ref|ZP_08251361.1| 30S ribosomal protein S3 [Haemophilus aegyptius ATCC 11116]
 gi|81336194|sp|Q4QMB6|RS3_HAEI8 RecName: Full=30S ribosomal protein S3
 gi|172048052|sp|A5UDU1|RS3_HAEIE RecName: Full=30S ribosomal protein S3
 gi|172048056|sp|A5UHT6|RS3_HAEIG RecName: Full=30S ribosomal protein S3
 gi|68057578|gb|AAX87831.1| 30S ribosomal protein S3 [Haemophilus influenzae 86-028NP]
 gi|144980101|gb|EDJ89760.1| 30S ribosomal protein S3 [Haemophilus influenzae 22.1-21]
 gi|144983918|gb|EDJ91360.1| 30S ribosomal protein S3 [Haemophilus influenzae R3021]
 gi|144987044|gb|EDJ93574.1| 30S ribosomal protein S3 [Haemophilus influenzae 3655]
 gi|145267972|gb|EDK07968.1| 30S ribosomal protein S3 [Haemophilus influenzae PittAA]
 gi|145270186|gb|EDK10122.1| 30S ribosomal protein S3 [Haemophilus influenzae PittHH]
 gi|145272746|gb|EDK12653.1| 30S ribosomal protein S3 [Haemophilus influenzae PittII]
 gi|145274392|gb|EDK14256.1| 30S ribosomal protein S3 [Haemophilus influenzae 22.4-21]
 gi|148716732|gb|ABQ98942.1| 30S ribosomal protein S3 [Haemophilus influenzae PittEE]
 gi|148719214|gb|ABR00342.1| 30S ribosomal protein S3 [Haemophilus influenzae PittGG]
 gi|229810837|gb|EEP46554.1| 30S ribosomal protein S3 [Haemophilus influenzae 7P49H1]
 gi|229812364|gb|EEP48054.1| 30S ribosomal protein S3 [Haemophilus influenzae 6P18H1]
 gi|301169500|emb|CBW29101.1| 30S ribosomal subunit protein S3 [Haemophilus influenzae 10810]
 gi|309751556|gb|ADO81540.1| 30S ribosomal protein S3 [Haemophilus influenzae R2866]
 gi|309973726|gb|ADO96927.1| 30S ribosomal protein S3 [Haemophilus influenzae R2846]
 gi|317433229|emb|CBY81604.1| 30S ribosomal subunit protein S3 [Haemophilus influenzae F3031]
 gi|327472053|gb|EGF17491.1| 30S ribosomal protein S3 [Haemophilus aegyptius ATCC 11116]
          Length = 235

 Score =  272 bits (695), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 112/225 (49%), Positives = 155/225 (68%), Gaps = 1/225 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   W+S WFA   ++   L  D K+R++L   L  A V++I IER 
Sbjct: 1   MGQKVHPHGIRLGIVKPWSSTWFANTQDFADNLEGDFKVRKFLNKELANASVSRITIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  +S +      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRNAVSKIAGVPAQINIAEVKKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQSAMR GA G+KV  SGRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQSAMRLGAKGIKVEVSGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDY TA A T YG  G+KV++  + E+    + +  +E +  +K
Sbjct: 181 DIDYNTAEAHTTYGVIGVKVWIF-KGEILGGMAAVAQSEQQPADK 224


>gi|293391701|ref|ZP_06636035.1| ribosomal protein S3 [Aggregatibacter actinomycetemcomitans D7S-1]
 gi|290952235|gb|EFE02354.1| ribosomal protein S3 [Aggregatibacter actinomycetemcomitans D7S-1]
          Length = 235

 Score =  272 bits (695), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 108/231 (46%), Positives = 152/231 (65%), Gaps = 5/231 (2%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   W+S WFA   ++   L  D K+R++L   L  A V++I IER 
Sbjct: 1   MGQKVHPHGIRLGIVKPWSSTWFANTQDFADNLEGDFKVRKFLNKELANASVSRITIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  ++ +      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRNAVAKIAGVPAQINIAEVKKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMK+AVQ+AMR GA G+KV  SGRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKKAVQNAMRLGAKGIKVEVSGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD-----SDSTIPAAEHRVVEKD 226
            IDY TA A T YG  G+KV++   + +            PA + +   + 
Sbjct: 181 DIDYNTAEAHTTYGVIGVKVWIFKGEILGGMAALTQPEQQPADKPKKAPRG 231


>gi|254362068|ref|ZP_04978193.1| ribosomal protein S3 [Mannheimia haemolytica PHL213]
 gi|261493003|ref|ZP_05989545.1| ribosomal protein S3 [Mannheimia haemolytica serotype A2 str.
           BOVINE]
 gi|261495177|ref|ZP_05991640.1| ribosomal protein S3 [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|153093624|gb|EDN74589.1| ribosomal protein S3 [Mannheimia haemolytica PHL213]
 gi|261309153|gb|EEY10393.1| ribosomal protein S3 [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|261311347|gb|EEY12508.1| ribosomal protein S3 [Mannheimia haemolytica serotype A2 str.
           BOVINE]
          Length = 235

 Score =  272 bits (695), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 109/231 (47%), Positives = 153/231 (66%), Gaps = 5/231 (2%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS WFA   ++   L  D K+R++L   L  A V++I IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNSTWFANTQDFADNLDGDFKVRKFLNKELANASVSRITIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  ++ +      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRNAVAKIAGVPAQINIAEVKKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMK+AVQ+AM+ GA G+KV  SGRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKKAVQNAMKLGAKGIKVEVSGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD-----SDSTIPAAEHRVVEKD 226
            IDY TA A T YG  G+KV++   + +            PAA+ +   + 
Sbjct: 181 DIDYSTAEAHTTYGVIGVKVWIFKGEILGGMAAVIESEKEPAAQPKKAPRG 231


>gi|315633461|ref|ZP_07888751.1| 30S ribosomal protein S3 [Aggregatibacter segnis ATCC 33393]
 gi|315477503|gb|EFU68245.1| 30S ribosomal protein S3 [Aggregatibacter segnis ATCC 33393]
          Length = 235

 Score =  272 bits (695), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 109/225 (48%), Positives = 154/225 (68%), Gaps = 1/225 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   W+S WFA   ++   L  D K+R++L   L  A V++I IER 
Sbjct: 1   MGQKVHPHGIRLGIVKPWSSTWFANTQDFADNLEGDFKVRQFLNKELANASVSRITIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  ++ +      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRNAVAKIAGVPAQINIAEVKKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMK+AVQ+AMR GA G+KV  SGRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKKAVQNAMRLGAKGIKVEVSGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDY TA A T YG  G+KV++  + E+    + +   E +  +K
Sbjct: 181 DIDYNTAEAHTTYGVIGVKVWIF-KGEILGGMAALAQPEQQPADK 224


>gi|254463292|ref|ZP_05076708.1| ribosomal protein S3 [Rhodobacterales bacterium HTCC2083]
 gi|206679881|gb|EDZ44368.1| ribosomal protein S3 [Rhodobacteraceae bacterium HTCC2083]
          Length = 235

 Score =  272 bits (695), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 129/225 (57%), Positives = 169/225 (75%), Gaps = 4/225 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K NPI  RL VN TW+SRW+A   +YG LL EDL IR+++    KQAG+A+++IER 
Sbjct: 1   MGNKTNPIGMRLQVNRTWDSRWYADSKDYGNLLLEDLAIRDFVNKECKQAGIARVIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ +++ARPG+IIGKKG DIE +RKKL+ +T+SE+HL++ EV KPE++A L+ +SI
Sbjct: 61  HKKCRVTIHTARPGVIIGKKGADIETLRKKLAKITDSELHLNIVEVRKPELDAQLVGESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           +QQLERRV FRRAMKRAVQ+AMR GA G++V  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 SQQLERRVSFRRAMKRAVQNAMRMGALGIRVNVAGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDY    AETAYG  GIK ++  + E+ + D   P A  R  ++
Sbjct: 181 DIDYAHVEAETAYGIIGIKTWIF-KGEIMEHD---PQARDRKAQE 221


>gi|148263146|ref|YP_001229852.1| 30S ribosomal protein S3 [Geobacter uraniireducens Rf4]
 gi|189045010|sp|A5GAX1|RS3_GEOUR RecName: Full=30S ribosomal protein S3
 gi|146396646|gb|ABQ25279.1| SSU ribosomal protein S3P [Geobacter uraniireducens Rf4]
          Length = 210

 Score =  272 bits (695), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 116/211 (54%), Positives = 162/211 (76%), Gaps = 1/211 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI FRLGV  TW+S+W+A   +Y  LLHEDLK+R +L+  L  +GV+KI IER 
Sbjct: 1   MGQKVNPIGFRLGVIKTWDSKWYAE-KDYAKLLHEDLKLRSFLKKRLYHSGVSKIEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               +I +++ARPGLIIGKKG+++E ++K+L+ +T+ E++L++ EV KPE++A L+A++I
Sbjct: 60  AGKAKINIFTARPGLIIGKKGSEVETLKKELAKLTDKEVYLNIQEVRKPELDAQLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV FRRAMK++V S+++FGA G+++  SGRL GAE+SRTE Y EGRVPL TLRA
Sbjct: 120 ALQLERRVAFRRAMKKSVTSSLKFGAKGIRITCSGRLGGAEMSRTEWYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDS 211
            IDYG A A+T YG  G+KV +   + +S  
Sbjct: 180 DIDYGFAEAKTTYGIIGVKVLLFKGEVLSGK 210


>gi|223041823|ref|ZP_03612013.1| 30S ribosomal protein S3 [Actinobacillus minor 202]
 gi|240947878|ref|ZP_04752318.1| 30S ribosomal protein S3 [Actinobacillus minor NM305]
 gi|223017392|gb|EEF15813.1| 30S ribosomal protein S3 [Actinobacillus minor 202]
 gi|240297840|gb|EER48276.1| 30S ribosomal protein S3 [Actinobacillus minor NM305]
          Length = 235

 Score =  272 bits (695), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 110/231 (47%), Positives = 153/231 (66%), Gaps = 5/231 (2%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS WFA   ++   L  D K+R++L   L  A V++I IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNSTWFANTQDFADNLDGDFKVRKFLNKELANASVSRITIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  ++ +      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRNAVAKIAGVPAQINIAEVKKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AM+ GA G+KV  SGRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQNAMKLGAKGIKVEVSGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD-----SDSTIPAAEHRVVEKD 226
            IDY TA A T YG  G+KV++   + +            PAA+ +   + 
Sbjct: 181 DIDYNTAEAHTTYGVIGVKVWIFKGEILGGMAAVIESEKEPAAQPKKAPRG 231


>gi|16272724|ref|NP_438942.1| 30S ribosomal protein S3 [Haemophilus influenzae Rd KW20]
 gi|260579874|ref|ZP_05847704.1| ribosomal protein S3 [Haemophilus influenzae RdAW]
 gi|1173250|sp|P44372|RS3_HAEIN RecName: Full=30S ribosomal protein S3
 gi|1573793|gb|AAC22442.1| ribosomal protein S3 (rpS3) [Haemophilus influenzae Rd KW20]
 gi|260093158|gb|EEW77091.1| ribosomal protein S3 [Haemophilus influenzae RdAW]
          Length = 235

 Score =  272 bits (695), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 112/225 (49%), Positives = 155/225 (68%), Gaps = 1/225 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   W+S WFA   ++   L  D K+R++L   L  A V++I IER 
Sbjct: 1   MGQKVHPHGIRLGIVKPWSSTWFANTQDFADNLEGDFKVRKFLNKELASASVSRITIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  +S +      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRNAVSKIAGVPAQINIAEVKKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQSAMR GA G+KV  SGRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQSAMRLGAKGIKVEVSGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDY TA A T YG  G+KV++  + E+    + +  +E +  +K
Sbjct: 181 DIDYNTAEAHTTYGVIGVKVWIF-KGEILGGMAAVAQSEQQPADK 224


>gi|56418647|ref|YP_145965.1| 30S ribosomal protein S3 [Geobacillus kaustophilus HTA426]
 gi|261417613|ref|YP_003251295.1| 30S ribosomal protein S3 [Geobacillus sp. Y412MC61]
 gi|297528488|ref|YP_003669763.1| ribosomal protein S3 [Geobacillus sp. C56-T3]
 gi|319765271|ref|YP_004130772.1| ribosomal protein S3 [Geobacillus sp. Y412MC52]
 gi|61215363|sp|Q5L417|RS3_GEOKA RecName: Full=30S ribosomal protein S3
 gi|56378489|dbj|BAD74397.1| 30S ribosomal protein S3 (BS2) [Geobacillus kaustophilus HTA426]
 gi|261374070|gb|ACX76813.1| ribosomal protein S3 [Geobacillus sp. Y412MC61]
 gi|297251740|gb|ADI25186.1| ribosomal protein S3 [Geobacillus sp. C56-T3]
 gi|317110137|gb|ADU92629.1| ribosomal protein S3 [Geobacillus sp. Y412MC52]
          Length = 218

 Score =  272 bits (695), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 103/219 (47%), Positives = 153/219 (69%), Gaps = 1/219 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI  R+G+   W SRW+A   +Y  LLHEDLKIREY+   L+ A V+++ IER 
Sbjct: 1   MGQKVNPIGLRIGIIRDWESRWYAE-KDYADLLHEDLKIREYISKRLQDAAVSRVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                + +++A+PG++IGK G+++E +RK L+ +T   +H+++ E+ KP+++A L+A++I
Sbjct: 60  ANRVNVTIHTAKPGMVIGKGGSEVEALRKALAQLTGKRVHINIVEIKKPDLDARLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE RV FRRA K+A+Q AMR GA G+K + SGRL GA+++R+E Y EG VPL TLRA
Sbjct: 120 ARQLENRVSFRRAQKQAIQRAMRAGAKGIKTMVSGRLGGADIARSEHYSEGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
            IDYGTA A+T YG  G+KV++   + +          +
Sbjct: 180 DIDYGTAEADTTYGKIGVKVWIYRGEVLPTKKKAEEGGK 218


>gi|319761144|ref|YP_004125081.1| ribosomal protein s3 [Alicycliphilus denitrificans BC]
 gi|330823002|ref|YP_004386305.1| 30S ribosomal protein S3 [Alicycliphilus denitrificans K601]
 gi|317115705|gb|ADU98193.1| ribosomal protein S3 [Alicycliphilus denitrificans BC]
 gi|329308374|gb|AEB82789.1| ribosomal protein S3 [Alicycliphilus denitrificans K601]
          Length = 290

 Score =  272 bits (695), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 121/224 (54%), Positives = 161/224 (71%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V+  W SRW+A   ++  +L ED+K+RE+L+  LK A V++ILIER 
Sbjct: 1   MGQKIHPTGFRLSVSRNWASRWYASNRDFAGMLAEDIKVREFLKAKLKNAAVSRILIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI +YSARPG++IGKKG DIE ++K+L+      + +++ EV KPEI+A LIA SI
Sbjct: 61  AKNARITIYSARPGVVIGKKGEDIENLKKELATRLGVPVAVNIEEVRKPEIDAKLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLE+R+ FRRAMKRA+Q+AMR GA G+K+++SGRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 TQQLEKRIQFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVE 224
            IDYGT+ A+T YG  G+KV+V   D +   D  +        E
Sbjct: 181 DIDYGTSEAKTTYGVIGVKVWVYKGDTLGRGDLPVAETPRPDDE 224


>gi|221069444|ref|ZP_03545549.1| ribosomal protein S3 [Comamonas testosteroni KF-1]
 gi|264676448|ref|YP_003276354.1| ribosomal protein S3 [Comamonas testosteroni CNB-2]
 gi|299531230|ref|ZP_07044641.1| 30S ribosomal protein S3 [Comamonas testosteroni S44]
 gi|220714467|gb|EED69835.1| ribosomal protein S3 [Comamonas testosteroni KF-1]
 gi|262206960|gb|ACY31058.1| ribosomal protein S3 [Comamonas testosteroni CNB-2]
 gi|298720813|gb|EFI61759.1| 30S ribosomal protein S3 [Comamonas testosteroni S44]
          Length = 289

 Score =  272 bits (695), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 123/226 (54%), Positives = 166/226 (73%), Gaps = 2/226 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V+  W SRW+A   ++  +L ED+K+REYL+  LK A VA++LIER 
Sbjct: 1   MGQKIHPTGFRLAVSRNWASRWYASNRDFAGMLAEDIKVREYLKAKLKNAAVARVLIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI ++SARPG++IGKKG DIE ++K+L+      + +++ EV KPEI+A LIA SI
Sbjct: 61  AKNARITIFSARPGVVIGKKGEDIEALKKELAARLGVPVAVNIEEVRKPEIDAKLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLE+R++FRRAMKRA+Q+AMR GA G+K+++SGRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 CQQLEKRIMFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            IDYG + A+T YG  G+KV+V   D +  +D  +PA E    E +
Sbjct: 181 DIDYGFSEAKTTYGIIGVKVWVYKGDTLGRND--LPAVETPRPEDE 224


>gi|85703995|ref|ZP_01035098.1| 30S ribosomal protein S3 [Roseovarius sp. 217]
 gi|149203518|ref|ZP_01880488.1| 30S ribosomal protein S3 [Roseovarius sp. TM1035]
 gi|85671315|gb|EAQ26173.1| 30S ribosomal protein S3 [Roseovarius sp. 217]
 gi|149143351|gb|EDM31390.1| 30S ribosomal protein S3 [Roseovarius sp. TM1035]
          Length = 235

 Score =  272 bits (695), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 130/225 (57%), Positives = 169/225 (75%), Gaps = 4/225 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K+NPI  RL VN TW+SRW+A   +YG LL EDL +R+++    KQAG+++++IER 
Sbjct: 1   MGNKVNPIGMRLQVNRTWDSRWYADTKDYGNLLLEDLAMRKFIGEECKQAGISRVIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ +++ARPG+IIGKKG DIE +RKKL+ MT SE+HL++ EV KPE++A L+ +SI
Sbjct: 61  HKKCRVTIHTARPGVIIGKKGADIEGLRKKLAAMTASELHLNIVEVRKPELDAALVGESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQ+AMR GA G++V  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVSFRRAMKRAVQNAMRMGALGIRVNVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDY    A TAYG  GIKV++  + E+ + D   P A  R  ++
Sbjct: 181 DIDYAPVEATTAYGIIGIKVWIF-KGEIMEHD---PGARDRKAQE 221


>gi|169630894|ref|YP_001704543.1| 30S ribosomal protein S3 [Mycobacterium abscessus ATCC 19977]
 gi|226697732|sp|B1MGE4|RS3_MYCA9 RecName: Full=30S ribosomal protein S3
 gi|169242861|emb|CAM63889.1| 30S ribosomal protein S3 [Mycobacterium abscessus]
          Length = 277

 Score =  271 bits (694), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 104/218 (47%), Positives = 145/218 (66%), Gaps = 2/218 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP  FRLG+   W SRW+A   +Y   + ED+ IR  L   L++AG+AK+ IERT
Sbjct: 1   MGQKINPHGFRLGITTDWKSRWYAD-KQYADYVKEDVAIRRLLATGLERAGIAKVEIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG++GT+ ++IR  L  +T  ++ L++ EV  PE  A L+AQ +
Sbjct: 60  RDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTGKQVQLNILEVKNPEAEAQLVAQGV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAM-RFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           A+QL  RV FRRAM++A+QSAM +    G++V  SGRL GAE+SR+E Y EGRVPL TLR
Sbjct: 120 AEQLSNRVAFRRAMRKAIQSAMRQPNVKGIRVQCSGRLGGAEMSRSEFYREGRVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPA 217
           A IDYG   A+T +G  G+KV++   D V        A
Sbjct: 180 ADIDYGLYEAKTTFGRIGVKVWIYKGDIVGGKRELAAA 217


>gi|126724869|ref|ZP_01740712.1| 30S ribosomal protein S3 [Rhodobacterales bacterium HTCC2150]
 gi|126706033|gb|EBA05123.1| 30S ribosomal protein S3 [Rhodobacterales bacterium HTCC2150]
          Length = 235

 Score =  271 bits (694), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 128/225 (56%), Positives = 172/225 (76%), Gaps = 4/225 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K+NPI  RL VN TW+SRW+A   ++  LL EDL +R+++    KQAG+++++IER 
Sbjct: 1   MGNKVNPIGMRLQVNRTWDSRWYADSKDFSTLLLEDLAMRKFIGEECKQAGISRVIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ +++ARPG+IIGKKG DIE +RKKL++MT+SE+HL++ EV KPE++A L+A++I
Sbjct: 61  HKKCRVTIHTARPGVIIGKKGADIEGLRKKLADMTDSELHLNIVEVRKPEMDAPLVAENI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQ+AMR GA G++V  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVSFRRAMKRAVQNAMRMGALGIRVNVAGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDY    A TAYG  GIKV++  + E+ + D   PAA  R  ++
Sbjct: 181 DIDYSHKEALTAYGIIGIKVWIF-KGEIMEHD---PAARDRRQQE 221


>gi|260581601|ref|ZP_05849398.1| ribosomal protein S3 [Haemophilus influenzae NT127]
 gi|260095194|gb|EEW79085.1| ribosomal protein S3 [Haemophilus influenzae NT127]
          Length = 235

 Score =  271 bits (694), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 112/225 (49%), Positives = 155/225 (68%), Gaps = 1/225 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   W+S WFA   ++   L  D K+R++L   L  A V++I IER 
Sbjct: 1   MGQKVHPHGIRLGIVKPWSSTWFANTQDFADNLEGDFKVRKFLNKELANASVSRITIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  +S +      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRNTVSKIAGVPAQINIAEVKKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQSAMR GA G+KV  SGRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQSAMRLGAKGIKVEVSGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDY TA A T YG  G+KV++  + E+    + +  +E +  +K
Sbjct: 181 DIDYNTAEAHTTYGVIGVKVWIF-KGEILGGMAAVAQSEQQPTDK 224


>gi|120553658|ref|YP_958009.1| 30S ribosomal protein S3 [Marinobacter aquaeolei VT8]
 gi|152060872|sp|A1TYK3|RS3_MARAV RecName: Full=30S ribosomal protein S3
 gi|120323507|gb|ABM17822.1| SSU ribosomal protein S3P [Marinobacter aquaeolei VT8]
          Length = 227

 Score =  271 bits (694), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 106/213 (49%), Positives = 153/213 (71%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K+NP   RLGV    NS W+A   +Y   L  D+++RE+L   L +A V+KI+IER 
Sbjct: 1   MGHKVNPTGIRLGVIKEHNSVWYADKKDYAKNLLNDIQVREFLDKRLVKASVSKIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +N RI +++ARPG++IGKKG D++++R+++S+M    +H+++ EV KP+++A L+AQ++
Sbjct: 61  AQNARITIHTARPGIVIGKKGEDVDRLRREVSDMMGVPVHINIEEVRKPDLDARLVAQNV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+K+   GRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 AGQLERRVMFRRAMKRAVQNAMRQGAKGIKIQVGGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDS 213
            IDY T  A T YG  G+KV++   + +   + 
Sbjct: 181 DIDYATYEAHTTYGVIGVKVWIFKGEILGGMEQ 213


>gi|114797822|ref|YP_761523.1| 30S ribosomal protein S3 [Hyphomonas neptunium ATCC 15444]
 gi|122942159|sp|Q0BYC0|RS3_HYPNA RecName: Full=30S ribosomal protein S3
 gi|114737996|gb|ABI76121.1| ribosomal protein S3 [Hyphomonas neptunium ATCC 15444]
          Length = 245

 Score =  271 bits (694), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 131/224 (58%), Positives = 174/224 (77%), Gaps = 4/224 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI  RLG+N T +SRW+A  +++G LLHED+ IR+ ++  LKQAG++KI+IER 
Sbjct: 1   MGQKVNPIGLRLGINRTADSRWYADSADFGRLLHEDISIRKAIREKLKQAGISKIIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK C I +++ARPGL+IGKKG DIE +RK+L+ MT+ E+ +++ E+ KPEI+ATLIA  I
Sbjct: 61  HKKCLITIHTARPGLVIGKKGGDIEVLRKELAKMTSDEVRVNLVEIRKPEIDATLIADDI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLERR  FRRAMKR++QSAMR GA+GVKV+ SGRL GAE++RTE Y EG VPL TLRA
Sbjct: 121 ARQLERRASFRRAMKRSIQSAMRLGAEGVKVVVSGRLGGAEIARTEKYAEGSVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVE 224
            IDYGTA A T YG  G+KV+V  + E+ + D   P A+ + +E
Sbjct: 181 DIDYGTAEATTTYGIIGVKVWVY-KGEILEHD---PMAQDKRLE 220


>gi|32035719|ref|ZP_00135600.1| COG0092: Ribosomal protein S3 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|126209230|ref|YP_001054455.1| 30S ribosomal protein S3 [Actinobacillus pleuropneumoniae L20]
 gi|165977202|ref|YP_001652795.1| 30S ribosomal protein S3 [Actinobacillus pleuropneumoniae serovar 3
           str. JL03]
 gi|303250018|ref|ZP_07336220.1| 30S ribosomal protein S3 [Actinobacillus pleuropneumoniae serovar 6
           str. Femo]
 gi|303253192|ref|ZP_07339341.1| 30S ribosomal protein S3 [Actinobacillus pleuropneumoniae serovar 2
           str. 4226]
 gi|307246695|ref|ZP_07528765.1| 30S ribosomal protein S3 [Actinobacillus pleuropneumoniae serovar 1
           str. 4074]
 gi|307248837|ref|ZP_07530850.1| 30S ribosomal protein S3 [Actinobacillus pleuropneumoniae serovar 2
           str. S1536]
 gi|307251064|ref|ZP_07532988.1| 30S ribosomal protein S3 [Actinobacillus pleuropneumoniae serovar 4
           str. M62]
 gi|307253450|ref|ZP_07535321.1| 30S ribosomal protein S3 [Actinobacillus pleuropneumoniae serovar 6
           str. Femo]
 gi|307255680|ref|ZP_07537484.1| 30S ribosomal protein S3 [Actinobacillus pleuropneumoniae serovar 9
           str. CVJ13261]
 gi|307257863|ref|ZP_07539620.1| 30S ribosomal protein S3 [Actinobacillus pleuropneumoniae serovar
           10 str. D13039]
 gi|307260132|ref|ZP_07541842.1| 30S ribosomal protein S3 [Actinobacillus pleuropneumoniae serovar
           11 str. 56153]
 gi|307262261|ref|ZP_07543910.1| 30S ribosomal protein S3 [Actinobacillus pleuropneumoniae serovar
           12 str. 1096]
 gi|307264470|ref|ZP_07546055.1| 30S ribosomal protein S3 [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
 gi|152060840|sp|A3N364|RS3_ACTP2 RecName: Full=30S ribosomal protein S3
 gi|126098022|gb|ABN74850.1| 30S ribosomal protein S3 [Actinobacillus pleuropneumoniae serovar
           5b str. L20]
 gi|165877303|gb|ABY70351.1| 30S ribosomal protein S3 [Actinobacillus pleuropneumoniae serovar 3
           str. JL03]
 gi|302647874|gb|EFL78081.1| 30S ribosomal protein S3 [Actinobacillus pleuropneumoniae serovar 2
           str. 4226]
 gi|302651081|gb|EFL81235.1| 30S ribosomal protein S3 [Actinobacillus pleuropneumoniae serovar 6
           str. Femo]
 gi|306852395|gb|EFM84630.1| 30S ribosomal protein S3 [Actinobacillus pleuropneumoniae serovar 1
           str. 4074]
 gi|306854764|gb|EFM86954.1| 30S ribosomal protein S3 [Actinobacillus pleuropneumoniae serovar 2
           str. S1536]
 gi|306856894|gb|EFM89026.1| 30S ribosomal protein S3 [Actinobacillus pleuropneumoniae serovar 4
           str. M62]
 gi|306859129|gb|EFM91171.1| 30S ribosomal protein S3 [Actinobacillus pleuropneumoniae serovar 6
           str. Femo]
 gi|306861357|gb|EFM93347.1| 30S ribosomal protein S3 [Actinobacillus pleuropneumoniae serovar 9
           str. CVJ13261]
 gi|306863769|gb|EFM95695.1| 30S ribosomal protein S3 [Actinobacillus pleuropneumoniae serovar
           10 str. D13039]
 gi|306865778|gb|EFM97656.1| 30S ribosomal protein S3 [Actinobacillus pleuropneumoniae serovar
           11 str. 56153]
 gi|306868024|gb|EFM99851.1| 30S ribosomal protein S3 [Actinobacillus pleuropneumoniae serovar
           12 str. 1096]
 gi|306870167|gb|EFN01926.1| 30S ribosomal protein S3 [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
          Length = 235

 Score =  271 bits (694), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 112/231 (48%), Positives = 153/231 (66%), Gaps = 5/231 (2%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS WFA   ++   L  D K+R++L   L  A V++I IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNSTWFANTQDFADNLDGDFKVRKFLNKELANASVSRITIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  +S +      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRNAVSQIAGVPAQINIAEVKKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD-----SDSTIPAAEHRVVEKD 226
            IDY TA A T YG  G+KV++   + +            PAA+ +   + 
Sbjct: 181 DIDYNTAEAHTTYGVIGVKVWIFKGEILGGMAAVIESEKEPAAQPKKAPRG 231


>gi|86135769|ref|ZP_01054348.1| 30S ribosomal protein S3 [Roseobacter sp. MED193]
 gi|85826643|gb|EAQ46839.1| 30S ribosomal protein S3 [Roseobacter sp. MED193]
          Length = 236

 Score =  271 bits (694), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 126/225 (56%), Positives = 171/225 (76%), Gaps = 4/225 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K+NP+  RL +N TW+SRW+A   ++G LL ED+K+R++++   KQAG+A+++IER 
Sbjct: 1   MGHKVNPVGMRLQINRTWDSRWYADTKDFGDLLLEDIKLRDFIKDECKQAGIARVIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ +++ARPG+IIGKKG DIE +RKKL++MT+SE+HL++ EV KPE++A L+ +SI
Sbjct: 61  HKKCRVTIHTARPGVIIGKKGADIEVLRKKLASMTDSELHLNIVEVRKPELDAQLVGESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA G++V  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVSFRRAMKRAVQSAMRMGALGIRVNVAGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDY    A T YG  GIK ++  + E+ + D   P A  R  ++
Sbjct: 181 DIDYAHNEAMTPYGIIGIKTWIF-KGEIMEHD---PQARDRKAQE 221


>gi|294085964|ref|YP_003552724.1| 30S ribosomal protein S3 [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292665539|gb|ADE40640.1| ribosomal protein S3 [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 231

 Score =  271 bits (694), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 131/227 (57%), Positives = 168/227 (74%), Gaps = 4/227 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+ PI  R+G+N TW+SRW+A G  YG LLHED+K+REYL   LKQA +++++IER 
Sbjct: 1   MGQKVKPIGLRVGINRTWDSRWYA-GRNYGTLLHEDIKLREYLMERLKQAAISRVVIERP 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ RPGLIIGKKG DIEK+R  LS     E+ L++ EV KPEI+A L+A++I
Sbjct: 60  AGRARVTIHAGRPGLIIGKKGQDIEKLRLDLSKRIGGEVSLNIVEVRKPEIDAKLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA GV++  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 120 AQQLERRVGFRRAMKRAVQSAMRLGALGVRINCAGRLGGAEIARTEWYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            +DYG A A T YG+CGIKV+V  + EV   D    A + R+ E+ +
Sbjct: 180 EVDYGEATAFTTYGACGIKVWVF-KGEVMAHDPM--AQDKRLAEQQA 223


>gi|217967375|ref|YP_002352881.1| ribosomal protein S3 [Dictyoglomus turgidum DSM 6724]
 gi|226697701|sp|B8E1D9|RS3_DICTD RecName: Full=30S ribosomal protein S3
 gi|217336474|gb|ACK42267.1| ribosomal protein S3 [Dictyoglomus turgidum DSM 6724]
          Length = 245

 Score =  271 bits (694), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 106/227 (46%), Positives = 151/227 (66%), Gaps = 1/227 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK +P  FRLG+   W S W+A  S+Y +LLHED  IR Y++ +  QAG++ I IER 
Sbjct: 1   MGQKTHPYGFRLGITKDWKSHWYAERSDYSSLLHEDWAIRNYIKKNYYQAGISLIEIERK 60

Query: 61  H-KNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQS 119
                 I +++ARPG++IG+ G++IE IRK L  +TN  + ++V EV  PE++A L+A++
Sbjct: 61  AANRVDITIHTARPGMLIGRGGSEIENIRKNLVKLTNKSVFVNVQEVKNPELDAQLVAEN 120

Query: 120 IAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           IA Q+E+R+ ++RAMK+A+  A+R GA GVKV+ SGRLNGAE++R+E + EGR+PLQTL 
Sbjct: 121 IATQIEKRINYKRAMKQAINRALRAGAKGVKVMCSGRLNGAEIARSEWFREGRIPLQTLT 180

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
           A IDYG A A T  G  G+KV++   D        I     + V K 
Sbjct: 181 ADIDYGFAEAFTISGVIGVKVWIYKGDVPELHKEPIQELPEKAVPKK 227


>gi|221133620|ref|ZP_03559925.1| 30S ribosomal protein S3 [Glaciecola sp. HTCC2999]
          Length = 234

 Score =  271 bits (694), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 106/226 (46%), Positives = 152/226 (67%), Gaps = 5/226 (2%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG++  W S W+A  ++Y   L  D ++R+YL   LK A ++KI+IER 
Sbjct: 1   MGQKVHPTGIRLGISKPWTSTWYANTADYADNLFNDHQVRQYLTKQLKSASLSKIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ ++ +++ARPG++IGKKG D+EK+R  +S +      +++ EV KPE++  L+A SI
Sbjct: 61  AKSIKVTIHTARPGVVIGKKGEDVEKLRNHVSKLAGVPAQINIAEVRKPELDGQLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           + QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++R+E Y EGRVPL T RA
Sbjct: 121 SSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARSEWYREGRVPLHTFRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD-----SDSTIPAAEHR 221
            IDY T+ A T YG  G+KV++   + +            PA + +
Sbjct: 181 DIDYATSEANTTYGIIGVKVWIFKGEVLGGLPLTQEQPAAPAPKKK 226


>gi|109896804|ref|YP_660059.1| 30S ribosomal protein S3 [Pseudoalteromonas atlantica T6c]
 gi|122972344|sp|Q15YN3|RS3_PSEA6 RecName: Full=30S ribosomal protein S3
 gi|109699085|gb|ABG39005.1| SSU ribosomal protein S3P [Pseudoalteromonas atlantica T6c]
 gi|332172255|gb|AEE21509.1| ribosomal protein S3 [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 232

 Score =  271 bits (694), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 109/226 (48%), Positives = 151/226 (66%), Gaps = 2/226 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG++  W S W+A  ++Y   L  D ++R+YL   LK A ++KI+IER 
Sbjct: 1   MGQKVHPTGIRLGISKPWTSTWYANTADYADNLFNDHQVRQYLTKALKTASLSKIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+RK +S +      +++ EV KPE++  L+A SI
Sbjct: 61  AKSIRVTIHTARPGVVIGKKGEDVEKLRKHVSKLAGVPAQINIAEVRKPELDGQLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++R E Y EGRVPL T RA
Sbjct: 121 ASQLERRVMFRRAMKRAVQNAMRIGAKGIKVQVSGRLGGAEIARAEWYREGRVPLHTFRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEV--SDSDSTIPAAEHRVVE 224
            IDY T+ A T YG  G+KV++   + +         PA   +   
Sbjct: 181 DIDYATSEANTTYGIIGVKVWIFKGEVLGGLPLTQEQPAQPKKKGR 226


>gi|239825699|ref|YP_002948323.1| 30S ribosomal protein S3 [Geobacillus sp. WCH70]
 gi|259495250|sp|C5D3S3|RS3_GEOSW RecName: Full=30S ribosomal protein S3
 gi|239805992|gb|ACS23057.1| ribosomal protein S3 [Geobacillus sp. WCH70]
          Length = 218

 Score =  271 bits (694), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 104/219 (47%), Positives = 154/219 (70%), Gaps = 1/219 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP+  R+G+   W+SRW+A   +Y  LLHEDLKIREY+   L+ A V++I IER 
Sbjct: 1   MGQKVNPVGLRIGIIRDWDSRWYAE-KDYADLLHEDLKIREYINKRLQDAAVSRIEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                I +++A+PG++IGK G+++E +RK L+ +T   +H+++ E+ KP+++A L+A++I
Sbjct: 60  ANRVNITIHTAKPGMVIGKGGSEVEALRKALTQLTGKRVHINIVEIKKPDLDAKLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE RV FRRA K+A+Q AMR GA G+K + SGRL GA+++R+E Y EG VPL TLRA
Sbjct: 120 ARQLENRVSFRRAQKQAIQRAMRAGAKGIKTMVSGRLGGADIARSEHYSEGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
            IDY TA A+T YG  G+KV++   + +     T    +
Sbjct: 180 DIDYATAEADTTYGKLGVKVWIYRGEVLPTKKKTEEGGK 218


>gi|49474398|ref|YP_032440.1| 30S ribosomal protein S3 [Bartonella quintana str. Toulouse]
 gi|61215534|sp|Q6FZC8|RS3_BARQU RecName: Full=30S ribosomal protein S3
 gi|49239902|emb|CAF26300.1| 30s ribosomal protein s3 [Bartonella quintana str. Toulouse]
          Length = 236

 Score =  271 bits (694), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 145/224 (64%), Positives = 176/224 (78%), Gaps = 3/224 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI  RLGVN TW+SRW+A   EYG LLHEDL IR Y+   LKQA ++K++IER 
Sbjct: 1   MGQKINPIGLRLGVNRTWDSRWYADSGEYGRLLHEDLSIRLYVLEELKQAAISKVIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ +YSARPGLIIGKKG DIEK+R+KLS MTN+E  L++ E+ KPEI+AT+IAQSI
Sbjct: 61  HKKCRVTIYSARPGLIIGKKGADIEKLRRKLSEMTNAETSLNIVEIHKPEIDATIIAQSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSAMR GA+G+++  SGRL GAE++R E Y EGRVPL TLR+
Sbjct: 121 AQQLERRVAFRRAMKRAVQSAMRLGAEGIRINCSGRLGGAEIARMEWYREGRVPLHTLRS 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVE 224
            +DYGTA A+TAYG CG+KV+V   + +        A+E R VE
Sbjct: 181 DVDYGTAEAKTAYGICGVKVWVFKGEILEYDPI---ASERRSVE 221


>gi|119502930|ref|ZP_01625015.1| 30S ribosomal protein S3 [marine gamma proteobacterium HTCC2080]
 gi|119461276|gb|EAW42366.1| 30S ribosomal protein S3 [marine gamma proteobacterium HTCC2080]
          Length = 223

 Score =  271 bits (693), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 104/213 (48%), Positives = 148/213 (69%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+    NS W+A    Y   L  DL++R+Y+   L  A V++++IER 
Sbjct: 1   MGQKVHPTGIRLGIVKDHNSVWYADSKAYAKNLISDLEVRDYVLKKLDAASVSRVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +  R+ +++ARPG++IGKKG D+EK+R+ LS      +H+++ E+ KP+++A L+AQ++
Sbjct: 61  AQTARLTIHTARPGIVIGKKGEDVEKLRRDLSAKMGVPVHINIEEIRKPDLDARLVAQNV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV+FRRAMKR VQ+AMR GA G+KV   GRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVMFRRAMKRVVQNAMRQGAQGIKVQVGGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDS 213
            IDY T  A T YG  G+KV++   + +   D 
Sbjct: 181 DIDYATYEAHTTYGVIGVKVWIFKGEVIGSEDE 213


>gi|261866789|ref|YP_003254711.1| 30S ribosomal protein S3 [Aggregatibacter actinomycetemcomitans
           D11S-1]
 gi|2500396|sp|P55827|RS3_ACTAC RecName: Full=30S ribosomal protein S3
 gi|1841328|dbj|BAA10953.1| ribosomal protein S3 [Actinobacillus actinomycetemcomitans]
 gi|261412121|gb|ACX81492.1| ribosomal protein S3 [Aggregatibacter actinomycetemcomitans D11S-1]
          Length = 235

 Score =  271 bits (693), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 109/225 (48%), Positives = 154/225 (68%), Gaps = 1/225 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   W+S WFA   ++   L  D K+R++L   L  A V++I IER 
Sbjct: 1   MGQKVHPHGIRLGIVKPWSSTWFANTQDFADNLEGDFKVRQFLNKELANASVSRITIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  ++ +      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRNAVAKIAGVPAQINIAEVKKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMK+AVQ+AMR GA G+KV  SGRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKKAVQNAMRLGAKGIKVEVSGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDY TA A T YG  G+KV++  + E+    + +   E +  +K
Sbjct: 181 DIDYNTAEAHTTYGVIGVKVWIF-KGEILGGMAALAQPEQQPTDK 224


>gi|262273373|ref|ZP_06051187.1| SSU ribosomal protein S3p (S3e) [Grimontia hollisae CIP 101886]
 gi|262222351|gb|EEY73662.1| SSU ribosomal protein S3p (S3e) [Grimontia hollisae CIP 101886]
          Length = 229

 Score =  271 bits (693), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 111/226 (49%), Positives = 154/226 (68%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS WFA   ++   L  D K+R++L   L +A V++I+IER 
Sbjct: 1   MGQKVHPNGIRLGICKPWNSTWFANSQDFADNLDGDFKVRQFLTKELSKASVSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R +++ +      +++ EV KPE++A L+  SI
Sbjct: 61  AKSIRVTIHTARPGVVIGKKGEDVEKLRARVAQLAGVPAQINIAEVRKPELDAQLVGDSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            IDY T+ A T YG  GIKV++   + +       P AE    ++ 
Sbjct: 181 DIDYATSSAHTTYGVIGIKVWIFKGEVLGGMPVAEPQAEKPKKQRK 226


>gi|319775283|ref|YP_004137771.1| 30S ribosomal subunit protein S3 [Haemophilus influenzae F3047]
 gi|317449874|emb|CBY86085.1| 30S ribosomal subunit protein S3 [Haemophilus influenzae F3047]
          Length = 235

 Score =  271 bits (693), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 112/225 (49%), Positives = 156/225 (69%), Gaps = 1/225 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   W+S WFA   ++   L  D K+R++L   L  A V++I IER 
Sbjct: 1   MGQKVHPHGIRLGIVKPWSSTWFANTQDFADNLEGDFKVRKFLNKELANASVSRITIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  +S + +    +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRNAVSKIASVPAQINIAEVKKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQSAMR GA G+KV  SGRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQSAMRLGAKGIKVEVSGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDY TA A T YG  G+KV++  + E+    + +  +E +  +K
Sbjct: 181 DIDYNTAEAHTTYGVIGVKVWIF-KGEILGGMAAVAQSEQQPADK 224


>gi|281602679|gb|ADA75663.1| 30S ribosomal protein S3 [Shigella flexneri 2002017]
          Length = 224

 Score =  271 bits (693), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 112/220 (50%), Positives = 154/220 (70%), Gaps = 1/220 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS WFA   E+   L  D K+R+YL   L +A V++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLTKELAKASVSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+RK ++++      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQINIAEVRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
             QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 TSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEH 220
            IDY T+ A T YG  G+KV++  + E+    + +   E 
Sbjct: 181 DIDYNTSEAHTTYGVIGVKVWIF-KGEILGGMAAVEQPEK 219


>gi|309703726|emb|CBJ03067.1| 30S ribosomal subunit protein S3 [Escherichia coli ETEC H10407]
          Length = 232

 Score =  271 bits (693), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 114/230 (49%), Positives = 156/230 (67%), Gaps = 4/230 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS WFA   E+   L  D K+R+YL   L +A V++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLTKELAKASVSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+RK ++++      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQINIAEVRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
             QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 TSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD----SDSTIPAAEHRVVEKD 226
            IDY T+ A T YG  G+KV++   + +           PAA+ +   K 
Sbjct: 181 DIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEKPAAQPKKQRKG 230


>gi|186477582|ref|YP_001859052.1| 30S ribosomal protein S3 [Burkholderia phymatum STM815]
 gi|226697676|sp|B2JI60|RS3_BURP8 RecName: Full=30S ribosomal protein S3
 gi|184194041|gb|ACC72006.1| ribosomal protein S3 [Burkholderia phymatum STM815]
          Length = 264

 Score =  271 bits (693), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 116/229 (50%), Positives = 165/229 (72%), Gaps = 2/229 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V+  W SRW+A  + + A+L ED+ +REYL+  LK A V +++IER 
Sbjct: 1   MGQKIHPTGFRLAVSRNWASRWYANNNNFAAMLQEDIGVREYLKKKLKNASVGRVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI ++S+RPG++IGKKG DIE ++ +L       +H+++ E+ KPE +A LIA SI
Sbjct: 61  AKNARITIFSSRPGVVIGKKGEDIELLKSELQKRMGVPVHVNIEEIRKPETDAQLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLERR++FRRAMKRA+Q+AMR GA G+K++++GRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 TQQLERRIMFRRAMKRAMQNAMRLGAQGIKIMSAGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTI--PAAEHRVVEKDS 227
            IDY T+ A+T YG  G+KV+V   D +  +D+ +    AE +   +++
Sbjct: 181 DIDYATSEAKTTYGIIGVKVWVYKGDTLGRNDAPVVEEVAEEKRPRRNA 229


>gi|254516917|ref|ZP_05128975.1| ribosomal protein S3 [gamma proteobacterium NOR5-3]
 gi|219674422|gb|EED30790.1| ribosomal protein S3 [gamma proteobacterium NOR5-3]
          Length = 222

 Score =  271 bits (693), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 105/213 (49%), Positives = 151/213 (70%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+     S W+A  + Y   L  DL++R +++  L  A V++I+IER 
Sbjct: 1   MGQKVHPTGIRLGIVKDHTSVWYADRNNYAKQLVNDLQVRSFIEKKLDNASVSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +  RI +++ARPG++IGKKG D++K+RK L+      +H+++ E+ KP+++A L+AQ++
Sbjct: 61  AQTARITIHTARPGIVIGKKGEDVDKLRKVLAEKMGVPVHINIEEIRKPDLDARLVAQNV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV+FRRAMKR VQ+AMR GA+G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVMFRRAMKRVVQNAMRQGAEGIKVQVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDS 213
            IDY T  A T YG  G+KV++   + +   +S
Sbjct: 181 DIDYATYEAATTYGILGVKVWIFKGEVLGADES 213


>gi|331699170|ref|YP_004335409.1| 30S ribosomal protein S3 [Pseudonocardia dioxanivorans CB1190]
 gi|326953859|gb|AEA27556.1| ribosomal protein S3 [Pseudonocardia dioxanivorans CB1190]
          Length = 271

 Score =  271 bits (693), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 103/221 (46%), Positives = 147/221 (66%), Gaps = 2/221 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP  FRLG+   W SRW+A   +Y   + ED++IR  L   +++AG++K+ IERT
Sbjct: 1   MGQKINPHGFRLGITTDWKSRWYAD-KQYAEYVKEDVEIRRMLSKGMERAGISKVEIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG++G + ++IR  L  +T  ++ L++ EV   E +A L+AQ +
Sbjct: 60  RDRVRVDIHTARPGIVIGRRGAEADRIRGALEKLTKKQVQLNILEVKNAESDAQLVAQGV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMR-FGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           A+QL  RV FRRAM++A+QSAMR     G++V  SGRL GAE+SR+E Y EGRVPL TLR
Sbjct: 120 AEQLSNRVAFRRAMRKAIQSAMRSPQVKGIRVQCSGRLGGAEMSRSEFYREGRVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEH 220
           A IDYG   A T +G  G+KV++   D V      +PAA  
Sbjct: 180 ADIDYGLFEARTTFGRIGVKVWIYKGDVVGGRREGVPAAAE 220


>gi|303256456|ref|ZP_07342470.1| ribosomal protein S3 [Burkholderiales bacterium 1_1_47]
 gi|331000650|ref|ZP_08324303.1| ribosomal protein S3 [Parasutterella excrementihominis YIT 11859]
 gi|302859947|gb|EFL83024.1| ribosomal protein S3 [Burkholderiales bacterium 1_1_47]
 gi|329570862|gb|EGG52573.1| ribosomal protein S3 [Parasutterella excrementihominis YIT 11859]
          Length = 264

 Score =  271 bits (692), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 120/225 (53%), Positives = 160/225 (71%), Gaps = 1/225 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP  FRL V   W SRW+A G ++   L EDLK+R+YL   LK A V +ILIER 
Sbjct: 1   MGQKINPTGFRLPVTHDWTSRWYATGRDFARTLAEDLKVRDYLGKKLKNASVGRILIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI ++SARPG++IGKKG DIE ++ +L  +    +H+++ E+ +P+++A LIA SI
Sbjct: 61  AKNARITIFSARPGVVIGKKGEDIEVLKAELQKLMGVPVHVNIEEIRRPDLDAQLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLE+R++FRRAMKRA+Q+AMR GA G+K+++SGRLNGAE++RTE Y EGRVPL TLRA
Sbjct: 121 TQQLEKRIMFRRAMKRAMQNAMRQGALGIKIMSSGRLNGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDYG + A+T YG  G+KV+V   D  +  D    A   R   +
Sbjct: 181 DIDYGFSEAQTTYGIIGVKVWVYKGDN-TGKDVAAEAPAEREDRR 224


>gi|190151120|ref|YP_001969645.1| 30S ribosomal protein S3 [Actinobacillus pleuropneumoniae serovar 7
           str. AP76]
 gi|189916251|gb|ACE62503.1| 30S ribosomal protein S3 [Actinobacillus pleuropneumoniae serovar 7
           str. AP76]
          Length = 235

 Score =  271 bits (692), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 112/231 (48%), Positives = 153/231 (66%), Gaps = 5/231 (2%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS WFA   ++   L  D K+R++L   L  A V++I IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNSTWFANTQDFADNLDGDFKVRKFLNKELANASVSRITIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  +S +      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRNAVSQIAGVPAQINIAEVKKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQNAMRLGAKGIKVEISGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD-----SDSTIPAAEHRVVEKD 226
            IDY TA A T YG  G+KV++   + +            PAA+ +   + 
Sbjct: 181 DIDYNTAEAHTTYGVIGVKVWIFKGEILGGMAAVIESEKEPAAQPKKAPRG 231


>gi|85060250|ref|YP_455952.1| 30S ribosomal protein S3 [Sodalis glossinidius str. 'morsitans']
 gi|123766382|sp|Q2NQM8|RS3_SODGM RecName: Full=30S ribosomal protein S3
 gi|84780770|dbj|BAE75547.1| 30S ribosomal protein S3 [Sodalis glossinidius str. 'morsitans']
          Length = 232

 Score =  271 bits (692), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 110/229 (48%), Positives = 159/229 (69%), Gaps = 3/229 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS W+A   E+   L  D K+R++L   L +A V++++IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNSTWYANTKEFADNLDSDFKVRQFLTKELSKASVSRLVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+RK ++++      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQINIAEVRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           + QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 SSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDS---DSTIPAAEHRVVEKD 226
            IDY T+ A T YG  G+KV++   + +      +   PAA+ +  ++ 
Sbjct: 181 DIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEPAAQPKKQQRK 229


>gi|187476545|ref|YP_784569.1| 30S ribosomal protein S3 [Bordetella avium 197N]
 gi|123766202|sp|Q2L2C0|RS3_BORA1 RecName: Full=30S ribosomal protein S3
 gi|115421131|emb|CAJ47615.1| 30S ribosomal protein S3 [Bordetella avium 197N]
          Length = 264

 Score =  271 bits (692), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 116/216 (53%), Positives = 162/216 (75%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V   W+SRW+A   ++G +L ED+++REYL+  LK A V +++IER 
Sbjct: 1   MGQKIHPTGFRLAVTRNWSSRWYADDKDFGGMLAEDIRVREYLKKKLKSASVGRVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI VYSARPG++IGK+G DIE ++  L  +    +H+++ E+ KPE +A LIA SI
Sbjct: 61  AKNARITVYSARPGVVIGKRGEDIESLKADLQRLMGVPVHVNIEEIRKPETDAQLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           +QQLE+R++FRRAMKRA+Q+AMR GA G+K+++SGRLNG E++RTE Y EGRVPL TL+A
Sbjct: 121 SQQLEKRIMFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGIEIARTEWYREGRVPLHTLKA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIP 216
           +IDYGT+ A T YG  GIKV+V   D +++ +  + 
Sbjct: 181 NIDYGTSEAHTTYGVIGIKVWVYKGDMLANGELPVE 216


>gi|295694843|ref|YP_003588081.1| ribosomal protein S3 [Bacillus tusciae DSM 2912]
 gi|295410445|gb|ADG04937.1| ribosomal protein S3 [Bacillus tusciae DSM 2912]
          Length = 226

 Score =  271 bits (692), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 110/227 (48%), Positives = 152/227 (66%), Gaps = 7/227 (3%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P+  R+G+   W S+W+A   EYG LL ED+KIR+Y+   LK A V+ + IER 
Sbjct: 1   MGQKVSPVGLRIGIIRDWESKWYAGKKEYGKLLLEDVKIRDYIFKRLKDAAVSAVEIERA 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                I V++A+PG++IGK GT++E +R  L++MT   +H+++ EV  PE++A L+A+++
Sbjct: 61  ANRVNITVHTAKPGMVIGKGGTEVEALRAALAHMTGKRVHINIAEVKNPELSAKLVAENV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV FRRAMK+A+Q  MR GA GVK+  SGRL GAE++RTE Y EG VPL TLRA
Sbjct: 121 ASQLERRVAFRRAMKQAIQRTMRAGAKGVKIQVSGRLAGAEIARTEGYSEGTVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDY  A A T YG  G+KV++   + +       P    R  EK S
Sbjct: 181 DIDYALAEAHTTYGRIGVKVWIYRGEIL-------PVKGDRNAEKSS 220


>gi|83648846|ref|YP_437281.1| 30S ribosomal protein S3 [Hahella chejuensis KCTC 2396]
 gi|123753505|sp|Q2S918|RS3_HAHCH RecName: Full=30S ribosomal protein S3
 gi|83636889|gb|ABC32856.1| ribosomal protein S3 [Hahella chejuensis KCTC 2396]
          Length = 227

 Score =  271 bits (692), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 102/217 (47%), Positives = 151/217 (69%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP+  RLG+    NS W+A    Y   L  D+K+RE+L   L++A V+K++IER 
Sbjct: 1   MGQKVNPVGIRLGIVKDHNSVWYADKKNYSDHLLTDIKVREFLMKKLEKASVSKVIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +N +I +++ARPG++IGKKG D++++R+++  +    +H+++ E+ KP+++A L+A  +
Sbjct: 61  PQNAKITIHTARPGIVIGKKGEDVDRLRQEVGELMKVPVHINIEEIRKPDLDAKLVASGV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+K+   GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AGQLERRVMFRRAMKRAVQNAMRQGAKGIKIQVGGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPA 217
            IDY T  A T YG  G+KV++   + +   +     
Sbjct: 181 DIDYATHEAHTTYGVIGVKVWIFKGEILGGIEQVRAE 217


>gi|251793833|ref|YP_003008565.1| 30S ribosomal protein S3 [Aggregatibacter aphrophilus NJ8700]
 gi|247535232|gb|ACS98478.1| ribosomal protein S3 [Aggregatibacter aphrophilus NJ8700]
          Length = 235

 Score =  271 bits (692), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 109/225 (48%), Positives = 154/225 (68%), Gaps = 1/225 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   W+S WFA   ++   L  D K+R++L   L  A V++I IER 
Sbjct: 1   MGQKVHPHGIRLGIVKPWSSTWFANTQDFANNLEGDFKVRQFLNKELANASVSRITIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  ++ +      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRNAVAKIAGVPAQINIAEVKKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMK+AVQ+AMR GA G+KV  SGRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKKAVQNAMRLGAKGIKVEVSGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDY TA A T YG  G+KV++  + E+    + +   E +  +K
Sbjct: 181 DIDYNTAEAHTTYGVIGVKVWIF-KGEILGGMAALAQPEQQPADK 224


>gi|242237865|ref|YP_002986046.1| 30S ribosomal protein S3 [Dickeya dadantii Ech703]
 gi|242129922|gb|ACS84224.1| ribosomal protein S3 [Dickeya dadantii Ech703]
          Length = 233

 Score =  271 bits (692), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 113/230 (49%), Positives = 160/230 (69%), Gaps = 4/230 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+  TWNS W+A   E+   L  D K+R+YL   L++A V++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKTWNSTWYANTKEFADNLDSDFKVRQYLNKELEKASVSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+RK ++++      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRKGVADIAGVPAQINIAEVRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           + QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 SSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD----SDSTIPAAEHRVVEKD 226
            IDY T+ A T YG  G+KV++   + +           PAA+ +  ++ 
Sbjct: 181 DIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEKPAAQPKKQQRK 230


>gi|260914674|ref|ZP_05921140.1| 30S ribosomal protein S3 [Pasteurella dagmatis ATCC 43325]
 gi|260631273|gb|EEX49458.1| 30S ribosomal protein S3 [Pasteurella dagmatis ATCC 43325]
          Length = 235

 Score =  271 bits (692), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 113/225 (50%), Positives = 154/225 (68%), Gaps = 1/225 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   W+S WFA   ++   L  D K+R++L   L  A V++I IER 
Sbjct: 1   MGQKVHPHGIRLGIVKPWSSTWFANTQDFADNLDGDFKVRKFLNKELANASVSRITIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  ++ +      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRNAVAAIAGVPAQINIAEVKKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDY TA A T YG  GIKV++  + E+    + I   E +  EK
Sbjct: 181 DIDYNTAEAHTTYGVIGIKVWIF-KGEILGGMAAIAQPEQQPAEK 224


>gi|169830442|ref|YP_001716424.1| ribosomal protein S3 [Candidatus Desulforudis audaxviator MP104C]
 gi|226697697|sp|B1I1J4|RS3_DESAP RecName: Full=30S ribosomal protein S3
 gi|169637286|gb|ACA58792.1| ribosomal protein S3 [Candidatus Desulforudis audaxviator MP104C]
          Length = 218

 Score =  271 bits (692), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 97/211 (45%), Positives = 154/211 (72%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   W+++W+A   ++  LL ED+KIR+Y++  L  AG+++I IERT
Sbjct: 1   MGQKVDPRGLRLGIVRDWDAKWYAGKKDFSNLLLEDVKIRDYIKSKLLAAGISRIHIERT 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               RI +++A+PG++IG+ GT++E +RK+L  +T  +I +++ E+  PE++A L+A+++
Sbjct: 61  ANRVRIAIHTAKPGVVIGRGGTEVEVLRKELEKLTGRQISINIVEIKTPELDAQLVAENV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QL+RRV FRRAMK+AV  AM+ GA G+++  +GRL GAE++RTE Y EG+VPL TLRA
Sbjct: 121 AAQLQRRVAFRRAMKQAVGRAMKLGAKGIRISVAGRLAGAEIARTEWYSEGKVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDS 211
            IDYG + A+T YG  G+KV++   + + + 
Sbjct: 181 DIDYGFSEAKTTYGKIGVKVWIYRGEILPER 211


>gi|219871736|ref|YP_002476111.1| 30S ribosomal protein S3 [Haemophilus parasuis SH0165]
 gi|219691940|gb|ACL33163.1| 30S ribosomal protein S3 [Haemophilus parasuis SH0165]
          Length = 234

 Score =  271 bits (692), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 112/232 (48%), Positives = 154/232 (66%), Gaps = 6/232 (2%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   W+S WFA   ++   L  D K+R++L   L  A V++I IER 
Sbjct: 1   MGQKVHPHGIRLGIVKPWSSTWFANTQDFADNLEGDFKVRQFLNKELANASVSRITIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  +S +      ++++EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRNAVSKIAGVPAQINISEVKKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 AAQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDE------VSDSDSTIPAAEHRVVEKD 226
            IDY TA A T YG  G+KV++   +       V +S+    A   +   K 
Sbjct: 181 DIDYNTAEAHTTYGVIGVKVWIFKGEILGGMAAVIESEKEPAAQPKKPARKG 232


>gi|160895846|ref|YP_001561428.1| 30S ribosomal protein S3 [Delftia acidovorans SPH-1]
 gi|160361430|gb|ABX33043.1| ribosomal protein S3 [Delftia acidovorans SPH-1]
          Length = 290

 Score =  271 bits (692), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 117/219 (53%), Positives = 159/219 (72%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V+  W SRW+A   ++  +L ED+K+RE+L+  LK A V++ILIER 
Sbjct: 1   MGQKIHPTGFRLAVSRNWASRWYASNRDFAGMLAEDIKVREFLKAKLKNAAVSRILIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI ++SARPG++IGKKG DIE ++K+L+      + +++ EV KPEI+A LIA SI
Sbjct: 61  AKNARITIFSARPGVVIGKKGEDIENLKKELATRLGVPVAVNIEEVRKPEIDAKLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLE+R++FRRAMKRA+Q+AMR GA G+K+++SGRLNG E++R E Y EGRVPL TLRA
Sbjct: 121 CQQLEKRIMFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGIEIARCEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
            IDYG + A+T YG  G+KV+V   D +  +D       
Sbjct: 181 DIDYGFSEAKTTYGVIGVKVWVYKGDTLGRNDLPAAETP 219


>gi|114319625|ref|YP_741308.1| 30S ribosomal protein S3 [Alkalilimnicola ehrlichii MLHE-1]
 gi|122312451|sp|Q0ABG9|RS3_ALHEH RecName: Full=30S ribosomal protein S3
 gi|114226019|gb|ABI55818.1| SSU ribosomal protein S3P [Alkalilimnicola ehrlichii MLHE-1]
          Length = 226

 Score =  271 bits (692), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 108/219 (49%), Positives = 155/219 (70%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K++P  FRLGV   W S W+A  S +G  L+ DL++R +++  L  A V++I IER 
Sbjct: 1   MGHKVHPTGFRLGVTEDWRSMWYAGSSNFGEYLNTDLQVRNFIRKKLAHASVSRIRIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN  + +++ARPG++IGKKG DI+++R +++ +    +H+++ E+ KPE++A L+A+S+
Sbjct: 61  AKNALVTIHTARPGIVIGKKGEDIDRLRGEVARLMGVPVHINIEEIRKPELDAKLVAESV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERR++FRRAMKRAV +AMR GA G+KV  SGRLNGAE++R+E Y EGRVPL TLRA
Sbjct: 121 AQQLERRIMFRRAMKRAVGNAMRLGAQGIKVHVSGRLNGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
           +IDYG A A T YG  G+KV+V   + +          E
Sbjct: 181 NIDYGVAEAHTTYGVIGVKVWVFKGEIIDSDAQPAAGGE 219


>gi|319942179|ref|ZP_08016495.1| 30S ribosomal protein S3 [Sutterella wadsworthensis 3_1_45B]
 gi|319804232|gb|EFW01124.1| 30S ribosomal protein S3 [Sutterella wadsworthensis 3_1_45B]
          Length = 260

 Score =  271 bits (692), Expect = 8e-71,   Method: Composition-based stats.
 Identities = 114/213 (53%), Positives = 153/213 (71%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP  FRL V   W SRW+A G +Y   L EDLK+R +L   L+ A VA++LIER 
Sbjct: 1   MGQKINPTGFRLPVTRNWTSRWYANGRDYPNTLQEDLKVRSFLLKKLRNASVARVLIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
             N RI ++++RPG++IGK+G DIE ++ ++  M    +H+++ EV +PE++A LIA  I
Sbjct: 61  ANNARITIFTSRPGIVIGKQGADIEALKTEVQKMMGVPVHVNIEEVRRPELDAQLIADGI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLE+RV+FRRAMKRA+Q+AMR GA G+KV +SGRLNGA+++R E Y EGRVPLQTLRA
Sbjct: 121 TQQLEKRVMFRRAMKRAMQNAMRLGALGIKVQSSGRLNGADIARDEWYREGRVPLQTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDS 213
           +IDY T+ A T YG  G+KV+V   D     + 
Sbjct: 181 NIDYATSEAHTTYGVVGVKVWVYKGDNFGAEEP 213


>gi|159042844|ref|YP_001531638.1| 30S ribosomal protein S3 [Dinoroseobacter shibae DFL 12]
 gi|189044976|sp|A8LM60|RS3_DINSH RecName: Full=30S ribosomal protein S3
 gi|157910604|gb|ABV92037.1| ribosomal protein S3 RpsC [Dinoroseobacter shibae DFL 12]
          Length = 240

 Score =  271 bits (692), Expect = 8e-71,   Method: Composition-based stats.
 Identities = 126/225 (56%), Positives = 171/225 (76%), Gaps = 1/225 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K+NPI  RL VN TW+SRW+A   +YG LL EDLKIRE+++   KQAG+++++IER 
Sbjct: 1   MGNKVNPIGMRLQVNRTWDSRWYADTKDYGDLLLEDLKIREFIKEECKQAGISRVIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ +++ARPG+IIGKKG DIE +R+K++ MT+SE+HL++ EV KPE++A L+ +SI
Sbjct: 61  HKKCRVTIHTARPGVIIGKKGADIEGLRRKIAAMTDSELHLNIVEVRKPELDAALVGESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQ+A+R GA G++V  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVSFRRAMKRAVQNAVRMGAQGIRVNLAGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            ID+    A TAYG  GIKV++  + E+ + D       H  +++
Sbjct: 181 DIDFANVEATTAYGIIGIKVWIF-KGEIMEHDPQARDRRHAELQE 224


>gi|322515629|ref|ZP_08068607.1| 30S ribosomal protein S3 [Actinobacillus ureae ATCC 25976]
 gi|322118280|gb|EFX90563.1| 30S ribosomal protein S3 [Actinobacillus ureae ATCC 25976]
          Length = 234

 Score =  270 bits (691), Expect = 8e-71,   Method: Composition-based stats.
 Identities = 111/224 (49%), Positives = 153/224 (68%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS WFA   ++   L  D K+R++L   L  A V++I IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNSTWFANTQDFADNLEGDFKVRKFLNKELANASVSRITIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  +S +      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRNAVSQIAGVPAQINIAEVKKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVE 224
            IDY TA A T YG  G+KV++   + +    + I + +   V+
Sbjct: 181 DIDYNTAEAHTTYGVIGVKVWIFKGEILGGMAAVIESEQQPAVQ 224


>gi|197117329|ref|YP_002137756.1| 30S ribosomal protein S3 [Geobacter bemidjiensis Bem]
 gi|322418370|ref|YP_004197593.1| 30S ribosomal protein S3 [Geobacter sp. M18]
 gi|226697716|sp|B5EFQ6|RS3_GEOBB RecName: Full=30S ribosomal protein S3
 gi|197086689|gb|ACH37960.1| ribosomal protein S3 [Geobacter bemidjiensis Bem]
 gi|320124757|gb|ADW12317.1| ribosomal protein S3 [Geobacter sp. M18]
          Length = 211

 Score =  270 bits (691), Expect = 8e-71,   Method: Composition-based stats.
 Identities = 114/212 (53%), Positives = 161/212 (75%), Gaps = 1/212 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI FRLGV  TW+S+W+A   +Y  LLHEDLK+R +L+  L  +GV+KI IER 
Sbjct: 1   MGQKVNPIGFRLGVIKTWDSKWYAE-KDYAKLLHEDLKLRNFLKKRLYHSGVSKIEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               +I +++ARPGLIIGKKG+++E ++K+L+ +T+ E++L++ EV KPE++A L+A+++
Sbjct: 60  AGKAKINIFTARPGLIIGKKGSEVETLKKELAKLTDKEVYLNIQEVRKPELDAQLVAENV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERR+ FRRAMK++V S ++FGA G+++  SGRL GAE+SRTE Y EGRVPL TLRA
Sbjct: 120 AMQLERRIAFRRAMKKSVTSTLKFGAKGIRITCSGRLGGAEMSRTEWYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSD 212
            IDYG A A+T YG  G+KV +   + +S   
Sbjct: 180 DIDYGFAEAKTTYGIIGVKVLLFKGEVLSAKK 211


>gi|325577133|ref|ZP_08147617.1| 30S ribosomal protein S3 [Haemophilus parainfluenzae ATCC 33392]
 gi|301155336|emb|CBW14802.1| 30S ribosomal subunit protein S3 [Haemophilus parainfluenzae T3T1]
 gi|325160715|gb|EGC72836.1| 30S ribosomal protein S3 [Haemophilus parainfluenzae ATCC 33392]
          Length = 235

 Score =  270 bits (691), Expect = 8e-71,   Method: Composition-based stats.
 Identities = 114/225 (50%), Positives = 155/225 (68%), Gaps = 1/225 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   RLG+   WNS WFA   ++   L  D K+R++L   L  A V++I IER 
Sbjct: 1   MGQKVNPNGIRLGIVKPWNSTWFANTQDFADNLDGDFKVRKFLTKELANASVSRITIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  +S +      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRNAVSQIAGVPAQINIAEVKKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQSAMR GA G+KV  SGRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQSAMRLGAKGIKVEVSGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDY TA A T YG  G+KV++  + E+    + +  +E +  +K
Sbjct: 181 DIDYNTAEAHTTYGVIGVKVWIF-KGEILGGMAAVAQSEQQPADK 224


>gi|296131842|ref|YP_003639089.1| ribosomal protein S3 [Thermincola sp. JR]
 gi|296030420|gb|ADG81188.1| ribosomal protein S3 [Thermincola potens JR]
          Length = 220

 Score =  270 bits (691), Expect = 8e-71,   Method: Composition-based stats.
 Identities = 97/218 (44%), Positives = 153/218 (70%), Gaps = 1/218 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   R+G+   W+++W+A   +Y   L ED+K+REY++  L  AG+++I IER 
Sbjct: 1   MGQKVHPKGLRIGIIKDWDAKWYAE-KDYADFLLEDIKVREYVKKKLYAAGISRIEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               ++ +++A+PG++IG+ G+++E +RK L  MT  ++ +++ EV  PE++A L+A++I
Sbjct: 60  ANRLKLTIHTAKPGIVIGRGGSEVEALRKSLEKMTGKQVSVNIVEVKVPELDAQLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV FRRAMK+AV   MR GA G+K+  SGRL GAE++RTE Y EG+VPL TLRA
Sbjct: 120 AAQLERRVSFRRAMKQAVSRTMRMGAQGIKIACSGRLAGAEMARTEWYSEGKVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAA 218
            IDYG A A+T YG  G+K ++   + + +  +++ + 
Sbjct: 180 DIDYGFAEADTTYGKIGVKAWIYRGEVLPEVKTSVASE 217


>gi|254438563|ref|ZP_05052057.1| ribosomal protein S3 [Octadecabacter antarcticus 307]
 gi|254451173|ref|ZP_05064610.1| ribosomal protein S3 [Octadecabacter antarcticus 238]
 gi|198254009|gb|EDY78323.1| ribosomal protein S3 [Octadecabacter antarcticus 307]
 gi|198265579|gb|EDY89849.1| ribosomal protein S3 [Octadecabacter antarcticus 238]
          Length = 238

 Score =  270 bits (691), Expect = 8e-71,   Method: Composition-based stats.
 Identities = 126/225 (56%), Positives = 171/225 (76%), Gaps = 4/225 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K+NPI  RL VN TW+SRW+A   +YG LL EDLKI+ +++    QAG+++++IER 
Sbjct: 1   MGNKVNPIGMRLQVNRTWDSRWYADTKDYGNLLLEDLKIKAFIKKECAQAGISRVIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ +++ARPG+IIGKKG DIE +RKKL+ +T SE+HL++ EV KPE++A L+ +SI
Sbjct: 61  HKKCRVTIHTARPGVIIGKKGADIETLRKKLAALTASELHLNILEVRKPELDAQLVGESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           +QQLERRV FRRAMKRAVQ+AMR GA G++V  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 SQQLERRVSFRRAMKRAVQNAMRMGALGIRVNLAGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDY    A+TAYG  GIK ++  + E+ + D   P+A  R +++
Sbjct: 181 DIDYAHVEAQTAYGIIGIKTWIF-KGEIMEHD---PSAHDRKLQE 221


>gi|311693277|gb|ADP96150.1| 30S ribosomal protein S3 [marine bacterium HP15]
          Length = 227

 Score =  270 bits (691), Expect = 9e-71,   Method: Composition-based stats.
 Identities = 107/213 (50%), Positives = 153/213 (71%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K+NP   RLGV    NS W+A   EY   L  D+++RE+L   L +A V+KI+IER 
Sbjct: 1   MGHKVNPTGIRLGVIKEHNSVWYADKKEYSKNLLNDIQVREFLDKRLVKASVSKIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +N RI +++ARPG++IGKKG D++++R+++S+M    +H+++ EV KP+++A L+AQ++
Sbjct: 61  AQNARITIHTARPGIVIGKKGEDVDRLRREVSDMMGVPVHINIEEVRKPDLDARLVAQNV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+K+   GRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 AGQLERRVMFRRAMKRAVQNAMRQGAKGIKIQVGGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDS 213
            IDY T  A T YG  G+KV++   + +   + 
Sbjct: 181 DIDYATYEAHTTYGVIGVKVWIFKGEILGGMEQ 213


>gi|317049834|ref|YP_004117482.1| 30S ribosomal protein S3 [Pantoea sp. At-9b]
 gi|316951451|gb|ADU70926.1| ribosomal protein S3 [Pantoea sp. At-9b]
          Length = 232

 Score =  270 bits (691), Expect = 9e-71,   Method: Composition-based stats.
 Identities = 112/229 (48%), Positives = 157/229 (68%), Gaps = 3/229 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS WFA   E+   L  D K+R++L   L +A V++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQFLTKELAKASVSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  ++N+      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRTVVANIAGVPAQINIAEVRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
             QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 TSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDS---DSTIPAAEHRVVEKD 226
            IDY T+ A T YG  G+KV++   + +      +   PAA+ +  ++ 
Sbjct: 181 DIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEPAAQPKKQQRK 229


>gi|251787977|ref|YP_003002698.1| 30S ribosomal protein S3 [Dickeya zeae Ech1591]
 gi|271502240|ref|YP_003335266.1| 30S ribosomal protein S3 [Dickeya dadantii Ech586]
 gi|307132833|ref|YP_003884849.1| 30S ribosomal subunit protein S3 [Dickeya dadantii 3937]
 gi|247536598|gb|ACT05219.1| ribosomal protein S3 [Dickeya zeae Ech1591]
 gi|270345795|gb|ACZ78560.1| ribosomal protein S3 [Dickeya dadantii Ech586]
 gi|306530362|gb|ADN00293.1| 30S ribosomal subunit protein S3 [Dickeya dadantii 3937]
          Length = 233

 Score =  270 bits (691), Expect = 9e-71,   Method: Composition-based stats.
 Identities = 113/230 (49%), Positives = 159/230 (69%), Gaps = 4/230 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+  TWNS W+A   E+   L  D K+R+YL   L++A V++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKTWNSTWYANTKEFADNLDSDFKVRQYLNKELEKASVSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+RK ++++      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRKGVADIAGVPAQINIAEVRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
             QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 TSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD----SDSTIPAAEHRVVEKD 226
            IDY T+ A T YG  G+KV++   + +           PAA+ +  ++ 
Sbjct: 181 DIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEKPAAQPKKQQRK 230


>gi|15603274|ref|NP_246348.1| 30S ribosomal protein S3 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|27734533|sp|Q9CL37|RS3_PASMU RecName: Full=30S ribosomal protein S3
 gi|12721784|gb|AAK03493.1| RpS3 [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 235

 Score =  270 bits (691), Expect = 9e-71,   Method: Composition-based stats.
 Identities = 112/225 (49%), Positives = 154/225 (68%), Gaps = 1/225 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   W+S WFA   ++   L  D K+R++L   L  A V++I IER 
Sbjct: 1   MGQKVHPHGIRLGIVKPWSSTWFANTQDFADNLDGDFKVRKFLNKELANASVSRITIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  ++ +      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRNAVAAIAGVPAQINIAEVKKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDY TA A T YG  GIKV++  + E+    + I   E +  +K
Sbjct: 181 DIDYNTAEAHTTYGVIGIKVWIF-KGEILGGMAAIAQPEQQPADK 224


>gi|300718699|ref|YP_003743502.1| 30S ribosomal protein S3 [Erwinia billingiae Eb661]
 gi|299064535|emb|CAX61655.1| 30S ribosomal protein S3 [Erwinia billingiae Eb661]
          Length = 232

 Score =  270 bits (691), Expect = 9e-71,   Method: Composition-based stats.
 Identities = 113/230 (49%), Positives = 159/230 (69%), Gaps = 3/230 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS WFA   E+   L  D K+R++L   L +A V++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKAWNSTWFANTKEFADNLDSDFKVRQFLTKELAKASVSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+RK ++++      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQINIAEVRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
             QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 TSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDS---DSTIPAAEHRVVEKDS 227
            IDY T+ A T YG  G+KV++   + +      +   PAA+ +  ++ S
Sbjct: 181 DIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEPAAQPKKQQRKS 230


>gi|311277731|ref|YP_003939962.1| ribosomal protein S3 [Enterobacter cloacae SCF1]
 gi|308746926|gb|ADO46678.1| ribosomal protein S3 [Enterobacter cloacae SCF1]
          Length = 232

 Score =  270 bits (691), Expect = 9e-71,   Method: Composition-based stats.
 Identities = 113/229 (49%), Positives = 158/229 (68%), Gaps = 3/229 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS WFA   E+   L  D K+R+YL   L +A V++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLTKELAKASVSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+RK ++++      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQINIAEVRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
             QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 TSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDS---DSTIPAAEHRVVEKD 226
            IDY T+ A T YG  G+KV++   + +      +   PAA+ +  ++ 
Sbjct: 181 DIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEPAAQPKKQQRK 229


>gi|291619169|ref|YP_003521911.1| RpsC [Pantoea ananatis LMG 20103]
 gi|291154199|gb|ADD78783.1| RpsC [Pantoea ananatis LMG 20103]
 gi|327395499|dbj|BAK12921.1| 30S ribosomal protein S3 RpsC [Pantoea ananatis AJ13355]
          Length = 232

 Score =  270 bits (691), Expect = 9e-71,   Method: Composition-based stats.
 Identities = 112/229 (48%), Positives = 156/229 (68%), Gaps = 3/229 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS WFA   E+   L  D K+R+YL   L +A V++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLTKELAKASVSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  ++ +      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRTVVAKIAGVPAQINIAEVRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
             QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 TSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDS---DSTIPAAEHRVVEKD 226
            IDY T+ A T YG  G+KV++   + +      +   PAA+ +  ++ 
Sbjct: 181 DIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEPAAQPKKQQRK 229


>gi|33594485|ref|NP_882129.1| 30S ribosomal protein S3 [Bordetella pertussis Tohama I]
 gi|33594757|ref|NP_882400.1| 30S ribosomal protein S3 [Bordetella parapertussis 12822]
 gi|33599028|ref|NP_886588.1| 30S ribosomal protein S3 [Bordetella bronchiseptica RB50]
 gi|61215724|sp|Q7VTC7|RS3_BORPE RecName: Full=30S ribosomal protein S3
 gi|61215729|sp|Q7W2F0|RS3_BORPA RecName: Full=30S ribosomal protein S3
 gi|61215738|sp|Q7WRB9|RS3_BORBR RecName: Full=30S ribosomal protein S3
 gi|33564561|emb|CAE43877.1| 30S ribosomal protein S3 [Bordetella pertussis Tohama I]
 gi|33564833|emb|CAE39776.1| 30S ribosomal protein S3 [Bordetella parapertussis]
 gi|33575074|emb|CAE30537.1| 30S ribosomal protein S3 [Bordetella bronchiseptica RB50]
          Length = 263

 Score =  270 bits (691), Expect = 9e-71,   Method: Composition-based stats.
 Identities = 119/218 (54%), Positives = 161/218 (73%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V   W SRWFA    +G +L ED+++REYL+  LK A V +++IER 
Sbjct: 1   MGQKIHPTGFRLAVTRNWTSRWFADDKAFGTMLAEDIRVREYLKKKLKSASVGRVIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI VYSARPG++IGK+G DIE ++  L  +    +H+++ E+ KPE +A LIA SI
Sbjct: 61  AKNARITVYSARPGVVIGKRGEDIENLKADLQRLMGVPVHVNIEEIRKPETDAQLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           +QQLE+R++FRRAMKRA+Q+AMR GA G+K+++SGRLNG E++RTE Y EGRVPL TL+A
Sbjct: 121 SQQLEKRIMFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGIEIARTEWYREGRVPLHTLKA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAA 218
           +IDYGT+ A T YG  GIKV+V   D +++ +    AA
Sbjct: 181 NIDYGTSEAHTTYGVIGIKVWVYKGDMLANGELPPEAA 218


>gi|87199276|ref|YP_496533.1| 30S ribosomal protein S3 [Novosphingobium aromaticivorans DSM
           12444]
 gi|123749869|sp|Q2G8X4|RS3_NOVAD RecName: Full=30S ribosomal protein S3
 gi|87134957|gb|ABD25699.1| SSU ribosomal protein S3P [Novosphingobium aromaticivorans DSM
           12444]
          Length = 231

 Score =  270 bits (691), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 125/225 (55%), Positives = 166/225 (73%), Gaps = 4/225 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K NPI  RL +N TW+SRW+A G  Y  +L EDLKIR+Y+  +L QA ++K++IER 
Sbjct: 1   MGHKSNPIGLRLQINRTWDSRWYAEGRNYAQMLEEDLKIRKYIVENLPQAAISKVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K CR+ +Y+ARPG+IIGKKG DIEK+R KL+ MT S++ L++ E+ KPEI++ L+AQ +
Sbjct: 61  AKLCRVSIYAARPGVIIGKKGADIEKLRSKLATMTGSDVKLNIVEIRKPEIDSKLVAQGV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QL RRV FRRAMKRAVQSA+R GA+G+K+   GRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 ADQLVRRVAFRRAMKRAVQSALRLGAEGIKITCGGRLGGAEIARVEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
           +IDY  A A TAYG  GIKV++  + E+   D   P A+ R++ +
Sbjct: 181 NIDYAEAEAHTAYGVIGIKVWIF-KGEILGHD---PMAQDRLMME 221


>gi|156932240|ref|YP_001436156.1| 30S ribosomal protein S3 [Cronobacter sakazakii ATCC BAA-894]
 gi|260599633|ref|YP_003212204.1| 30S ribosomal protein S3 [Cronobacter turicensis z3032]
 gi|189044981|sp|A7MPI5|RS3_ENTS8 RecName: Full=30S ribosomal protein S3
 gi|156530494|gb|ABU75320.1| hypothetical protein ESA_00011 [Cronobacter sakazakii ATCC BAA-894]
 gi|260218810|emb|CBA34161.1| 30S ribosomal protein S3 [Cronobacter turicensis z3032]
          Length = 233

 Score =  270 bits (691), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 113/230 (49%), Positives = 157/230 (68%), Gaps = 4/230 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS WFA   E+   L  D K+R+YL   L +A V++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLNKELAKASVSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+RK ++++      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRKGVADIAGVPAQINIAEVRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
             QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 TSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD----SDSTIPAAEHRVVEKD 226
            IDY T+ A T YG  G+KV++   + +           PAA+ +  ++ 
Sbjct: 181 DIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEKPAAQPKKQQRK 230


>gi|138893791|ref|YP_001124244.1| 30S ribosomal protein S3 [Geobacillus thermodenitrificans NG80-2]
 gi|196251018|ref|ZP_03149700.1| ribosomal protein S3 [Geobacillus sp. G11MC16]
 gi|152060863|sp|A4IJJ5|RS3_GEOTN RecName: Full=30S ribosomal protein S3
 gi|134265304|gb|ABO65499.1| Ribosomal protein S3 [Geobacillus thermodenitrificans NG80-2]
 gi|196209490|gb|EDY04267.1| ribosomal protein S3 [Geobacillus sp. G11MC16]
          Length = 218

 Score =  270 bits (691), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 101/219 (46%), Positives = 152/219 (69%), Gaps = 1/219 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI  R+G+   W SRW+A   +Y  LLHEDLK+REY+   L+ A V+++ IER 
Sbjct: 1   MGQKVNPIGLRIGIIRDWESRWYAE-KDYADLLHEDLKVREYINKRLQDAAVSRVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                + +++A+PG++IGK G+++E +RK L+ +T   +H+++ E+ KP+++A L+A++I
Sbjct: 60  ANRVNVTIHTAKPGMVIGKGGSEVEALRKALAQLTGKRVHINIVEIKKPDLDAKLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE RV FRRA K+A+Q AMR GA G+K + SGRL GA+++R+E Y EG VPL TLRA
Sbjct: 120 ARQLENRVSFRRAQKQAIQRAMRAGAKGIKTMVSGRLGGADIARSEHYSEGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
            IDY TA A+T YG  G+KV++   + +          +
Sbjct: 180 DIDYATAEADTTYGKIGVKVWIYRGEVLPTKKKAEEGGK 218


>gi|254483419|ref|ZP_05096648.1| ribosomal protein S3 [marine gamma proteobacterium HTCC2148]
 gi|214036293|gb|EEB76971.1| ribosomal protein S3 [marine gamma proteobacterium HTCC2148]
          Length = 223

 Score =  270 bits (690), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 104/219 (47%), Positives = 152/219 (69%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI  RLG+    NS W+A    Y   L  DL++REY++  L+ A V++I+IER 
Sbjct: 1   MGQKVHPIGIRLGIVKEHNSIWYADSKNYAKQLINDLQVREYIEKALEHASVSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +  RI +++ARPG++IGKKG D++ +RK L+      +H+++ E+ KP+++A L+AQ++
Sbjct: 61  AQTARITIHTARPGIVIGKKGEDVDALRKILTEKMGVPVHINIEEIRKPDLDAKLVAQNV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV+FRRAMKR VQ+AMR GA G+K+   GRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVMFRRAMKRVVQNAMRQGAQGIKIQVGGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
            IDY T  A T YG  G+KV++   + +   ++     +
Sbjct: 181 DIDYATYEAATTYGIIGVKVWIFKGEVIGADEAAEAPKK 219


>gi|322831078|ref|YP_004211105.1| ribosomal protein S3 [Rahnella sp. Y9602]
 gi|321166279|gb|ADW71978.1| ribosomal protein S3 [Rahnella sp. Y9602]
          Length = 232

 Score =  270 bits (690), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 110/229 (48%), Positives = 158/229 (68%), Gaps = 3/229 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS W+A   ++   L  D K+R++L   L +A V++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNSTWYANTKDFADNLDGDFKVRQFLTKELAKASVSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+RK ++++      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQINIAEVRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
             QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 TSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDS---DSTIPAAEHRVVEKD 226
            IDY T+ A T YG  G+KV++   + +      +   PAA+ +  ++ 
Sbjct: 181 DIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEPAAQPKKQQRK 229


>gi|152972221|ref|YP_001337367.1| 30S ribosomal protein S3 [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
 gi|188535272|ref|YP_001909069.1| 30S ribosomal protein S3 [Erwinia tasmaniensis Et1/99]
 gi|206580744|ref|YP_002236287.1| ribosomal protein S3 [Klebsiella pneumoniae 342]
 gi|238896810|ref|YP_002921555.1| 30S ribosomal protein S3 [Klebsiella pneumoniae NTUH-K2044]
 gi|259909993|ref|YP_002650349.1| 30S ribosomal protein S3 [Erwinia pyrifoliae Ep1/96]
 gi|262045171|ref|ZP_06018198.1| 30S ribosomal protein S3 [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|288933272|ref|YP_003437331.1| ribosomal protein S3 [Klebsiella variicola At-22]
 gi|290512075|ref|ZP_06551443.1| 30S ribosomal protein S3 [Klebsiella sp. 1_1_55]
 gi|292489843|ref|YP_003532733.1| 30S ribosomal protein S3 [Erwinia amylovora CFBP1430]
 gi|292900885|ref|YP_003540254.1| 30S ribosomal protein S3 [Erwinia amylovora ATCC 49946]
 gi|330002288|ref|ZP_08304282.1| ribosomal protein S3 [Klebsiella sp. MS 92-3]
 gi|189045015|sp|A6TEW6|RS3_KLEP7 RecName: Full=30S ribosomal protein S3
 gi|226697710|sp|B2VK58|RS3_ERWT9 RecName: Full=30S ribosomal protein S3
 gi|226697722|sp|B5XNA0|RS3_KLEP3 RecName: Full=30S ribosomal protein S3
 gi|150957070|gb|ABR79100.1| 30S ribosomal protein S3 [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
 gi|188030314|emb|CAO98203.1| 30S ribosomal protein S3 [Erwinia tasmaniensis Et1/99]
 gi|206569802|gb|ACI11578.1| ribosomal protein S3 [Klebsiella pneumoniae 342]
 gi|224965615|emb|CAX57147.1| 30S ribosomal protein S3 [Erwinia pyrifoliae Ep1/96]
 gi|238549137|dbj|BAH65488.1| 30S ribosomal protein S3 [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
 gi|259037491|gb|EEW38735.1| 30S ribosomal protein S3 [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|283480090|emb|CAY76006.1| 30S ribosomal protein S3 [Erwinia pyrifoliae DSM 12163]
 gi|288888001|gb|ADC56319.1| ribosomal protein S3 [Klebsiella variicola At-22]
 gi|289775865|gb|EFD83865.1| 30S ribosomal protein S3 [Klebsiella sp. 1_1_55]
 gi|291200733|emb|CBJ47866.1| 30S ribosomal protein S3 [Erwinia amylovora ATCC 49946]
 gi|291555280|emb|CBA23577.1| 30S ribosomal protein S3 [Erwinia amylovora CFBP1430]
 gi|310765592|gb|ADP10542.1| 30S ribosomal protein S3 [Erwinia sp. Ejp617]
 gi|312174025|emb|CBX82278.1| 30S ribosomal protein S3 [Erwinia amylovora ATCC BAA-2158]
 gi|328537361|gb|EGF63611.1| ribosomal protein S3 [Klebsiella sp. MS 92-3]
          Length = 232

 Score =  270 bits (690), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 112/229 (48%), Positives = 158/229 (68%), Gaps = 3/229 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS WFA   E+   L  D K+R++L   L +A V++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQFLTKELAKASVSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+RK ++++      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQINIAEVRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
             QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 TSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDS---DSTIPAAEHRVVEKD 226
            IDY T+ A T YG  G+KV++   + +      +   PAA+ +  ++ 
Sbjct: 181 DIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEPAAQPKKQQRK 229


>gi|167854927|ref|ZP_02477703.1| 30S ribosomal protein S3 [Haemophilus parasuis 29755]
 gi|167853994|gb|EDS25232.1| 30S ribosomal protein S3 [Haemophilus parasuis 29755]
          Length = 234

 Score =  270 bits (690), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 112/232 (48%), Positives = 154/232 (66%), Gaps = 6/232 (2%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   W+S WFA   ++   L  D K+R++L   L  A V++I IER 
Sbjct: 1   MGQKVHPHGIRLGIVKPWSSTWFANTQDFADNLGGDFKVRQFLNKELANASVSRITIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  +S +      ++++EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRNAVSKIAGVPAQINISEVKKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 AAQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDE------VSDSDSTIPAAEHRVVEKD 226
            IDY TA A T YG  G+KV++   +       V +S+    A   +   K 
Sbjct: 181 DIDYNTAEAHTTYGVIGVKVWIFKGEILGGMAAVIESEKEPAAQPKKPARKG 232


>gi|227115266|ref|ZP_03828922.1| 30S ribosomal protein S3 [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
 gi|227328943|ref|ZP_03832967.1| 30S ribosomal protein S3 [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
 gi|253690177|ref|YP_003019367.1| ribosomal protein S3 [Pectobacterium carotovorum subsp. carotovorum
           PC1]
 gi|261823226|ref|YP_003261332.1| 30S ribosomal protein S3 [Pectobacterium wasabiae WPP163]
 gi|259495254|sp|C6DG68|RS3_PECCP RecName: Full=30S ribosomal protein S3
 gi|251756755|gb|ACT14831.1| ribosomal protein S3 [Pectobacterium carotovorum subsp. carotovorum
           PC1]
 gi|261607239|gb|ACX89725.1| ribosomal protein S3 [Pectobacterium wasabiae WPP163]
          Length = 233

 Score =  270 bits (690), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 112/230 (48%), Positives = 158/230 (68%), Gaps = 4/230 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS W+A   E+   L  D K+R+YL   L++A V++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNSTWYANTKEFADNLDSDFKVRKYLTKELEKASVSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+RK ++++      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQINIAEVRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
             QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 TSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD----SDSTIPAAEHRVVEKD 226
            IDY T+ A T YG  G+KV++   + +           PAA+ +  ++ 
Sbjct: 181 DIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEKPAAQPKKQQRK 230


>gi|293393305|ref|ZP_06637619.1| 30S ribosomal protein S3 [Serratia odorifera DSM 4582]
 gi|291424215|gb|EFE97430.1| 30S ribosomal protein S3 [Serratia odorifera DSM 4582]
          Length = 232

 Score =  269 bits (689), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 111/229 (48%), Positives = 158/229 (68%), Gaps = 3/229 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS W+A   E+   L  D K+R++L   L +A V++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNSTWYANTKEFADNLDSDFKVRQFLTKELAKASVSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+RK ++++      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQINIAEVRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
             QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 TSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDS---DSTIPAAEHRVVEKD 226
            IDY T+ A T YG  G+KV++   + +      +   PAA+ +  ++ 
Sbjct: 181 DIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEPAAQPKKQQRK 229


>gi|82701906|ref|YP_411472.1| 30S ribosomal protein S3 [Nitrosospira multiformis ATCC 25196]
 gi|91207822|sp|Q2YAZ1|RS3_NITMU RecName: Full=30S ribosomal protein S3
 gi|82409971|gb|ABB74080.1| SSU ribosomal protein S3P [Nitrosospira multiformis ATCC 25196]
          Length = 286

 Score =  269 bits (689), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 114/214 (53%), Positives = 158/214 (73%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V   W+S+W+A G  +  +L+ED+K+REYL+  L  A V +++IER 
Sbjct: 1   MGQKIHPTGFRLSVLKNWSSKWYANGKSFPGMLNEDIKVREYLKKKLAHASVGRVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI +YS+RPG++IGKKG DIE +R  L  +    +H+++ E+ KPEI+A LIA +I
Sbjct: 61  SKNARITIYSSRPGVVIGKKGEDIEVLRGALQKLMGVPVHVNIEEIRKPEIDAQLIADNI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLE+R++FRRAMKRA+Q+AMR GA G+K+++SGRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLEKRIMFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDST 214
            +DYG + A+T YG  GIKV+V   + +   +  
Sbjct: 181 DLDYGVSEAKTTYGVIGIKVWVFKGEVIGRGEQA 214


>gi|15833433|ref|NP_312206.1| 30S ribosomal protein S3 [Escherichia coli O157:H7 str. Sakai]
 gi|16131193|ref|NP_417773.1| 30S ribosomal subunit protein S3 [Escherichia coli str. K-12
           substr. MG1655]
 gi|16762849|ref|NP_458466.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|16766723|ref|NP_462338.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|26249904|ref|NP_755944.1| 30S ribosomal protein S3 [Escherichia coli CFT073]
 gi|29144336|ref|NP_807678.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|30065385|ref|NP_839556.1| 30S ribosomal protein S3 [Shigella flexneri 2a str. 2457T]
 gi|56415353|ref|YP_152428.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62181938|ref|YP_218355.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|74313833|ref|YP_312252.1| 30S ribosomal protein S3 [Shigella sonnei Ss046]
 gi|82545677|ref|YP_409624.1| 30S ribosomal protein S3 [Shigella boydii Sb227]
 gi|82778610|ref|YP_404959.1| 30S ribosomal protein S3 [Shigella dysenteriae Sd197]
 gi|89110696|ref|AP_004476.1| 30S ribosomal subunit protein S3 [Escherichia coli str. K-12
           substr. W3110]
 gi|91212747|ref|YP_542733.1| 30S ribosomal protein S3 [Escherichia coli UTI89]
 gi|110643553|ref|YP_671283.1| 30S ribosomal protein S3 [Escherichia coli 536]
 gi|110807162|ref|YP_690682.1| 30S ribosomal protein S3 [Shigella flexneri 5 str. 8401]
 gi|117625593|ref|YP_858916.1| 30S ribosomal protein S3 [Escherichia coli APEC O1]
 gi|146313379|ref|YP_001178453.1| 30S ribosomal protein S3 [Enterobacter sp. 638]
 gi|157148891|ref|YP_001456209.1| 30S ribosomal protein S3 [Citrobacter koseri ATCC BAA-895]
 gi|157157923|ref|YP_001464782.1| 30S ribosomal protein S3 [Escherichia coli E24377A]
 gi|157162788|ref|YP_001460106.1| 30S ribosomal protein S3 [Escherichia coli HS]
 gi|161506014|ref|YP_001573126.1| 30S ribosomal protein S3 [Salmonella enterica subsp. arizonae
           serovar 62:z4,z23:-- str. RSK2980]
 gi|161616460|ref|YP_001590425.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Paratyphi B str. SPB7]
 gi|168468007|ref|ZP_02701844.1| ribosomal protein S3 [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|168753080|ref|ZP_02778087.1| ribosomal protein S3 [Escherichia coli O157:H7 str. EC4401]
 gi|168769178|ref|ZP_02794185.1| ribosomal protein S3 [Escherichia coli O157:H7 str. EC4486]
 gi|168784357|ref|ZP_02809364.1| ribosomal protein S3 [Escherichia coli O157:H7 str. EC4076]
 gi|170018450|ref|YP_001723404.1| 30S ribosomal protein S3 [Escherichia coli ATCC 8739]
 gi|170683377|ref|YP_001745576.1| 30S ribosomal protein S3 [Escherichia coli SMS-3-5]
 gi|170769550|ref|ZP_02904003.1| ribosomal protein S3 [Escherichia albertii TW07627]
 gi|187732278|ref|YP_001881998.1| 30S ribosomal protein S3 [Shigella boydii CDC 3083-94]
 gi|188492004|ref|ZP_02999274.1| ribosomal protein S3 [Escherichia coli 53638]
 gi|191174669|ref|ZP_03036144.1| ribosomal protein S3 [Escherichia coli F11]
 gi|194445051|ref|YP_002042684.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194451812|ref|YP_002047457.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194737846|ref|YP_002116376.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|195939863|ref|ZP_03085245.1| 30S ribosomal protein S3 [Escherichia coli O157:H7 str. EC4024]
 gi|197249433|ref|YP_002148353.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197264520|ref|ZP_03164594.1| ribosomal protein S3 [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|197364283|ref|YP_002143920.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|198242497|ref|YP_002217396.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|200388649|ref|ZP_03215261.1| ribosomal protein S3 [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|205354938|ref|YP_002228739.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|207858676|ref|YP_002245327.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|208806555|ref|ZP_03248892.1| ribosomal protein S3 [Escherichia coli O157:H7 str. EC4206]
 gi|208811995|ref|ZP_03253324.1| ribosomal protein S3 [Escherichia coli O157:H7 str. EC4045]
 gi|208821473|ref|ZP_03261793.1| ribosomal protein S3 [Escherichia coli O157:H7 str. EC4042]
 gi|209400495|ref|YP_002272770.1| ribosomal protein S3 [Escherichia coli O157:H7 str. EC4115]
 gi|209920780|ref|YP_002294864.1| 30S ribosomal protein S3 [Escherichia coli SE11]
 gi|213161928|ref|ZP_03347638.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
 gi|213417257|ref|ZP_03350401.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Typhi str. E01-6750]
 gi|213425756|ref|ZP_03358506.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
 gi|213581214|ref|ZP_03363040.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-0664]
 gi|213612415|ref|ZP_03370241.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-2068]
 gi|213646530|ref|ZP_03376583.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|215488614|ref|YP_002331045.1| 30S ribosomal protein S3 [Escherichia coli O127:H6 str. E2348/69]
 gi|217324648|ref|ZP_03440732.1| ribosomal protein S3 [Escherichia coli O157:H7 str. TW14588]
 gi|218550589|ref|YP_002384380.1| 30S ribosomal protein S3 [Escherichia fergusonii ATCC 35469]
 gi|218555871|ref|YP_002388784.1| 30S ribosomal protein S3 [Escherichia coli IAI1]
 gi|218560375|ref|YP_002393288.1| 30S ribosomal protein S3 [Escherichia coli S88]
 gi|218691600|ref|YP_002399812.1| 30S ribosomal protein S3 [Escherichia coli ED1a]
 gi|218697006|ref|YP_002404673.1| 30S ribosomal protein S3 [Escherichia coli 55989]
 gi|218702076|ref|YP_002409705.1| 30S ribosomal protein S3 [Escherichia coli IAI39]
 gi|218706921|ref|YP_002414440.1| 30S ribosomal protein S3 [Escherichia coli UMN026]
 gi|224585229|ref|YP_002639028.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|227883445|ref|ZP_04001250.1| 30S ribosomal protein S3 [Escherichia coli 83972]
 gi|237703044|ref|ZP_04533525.1| 30S ribosomal subunit protein S3 [Escherichia sp. 3_2_53FAA]
 gi|237728649|ref|ZP_04559130.1| 30S ribosomal protein S3 [Citrobacter sp. 30_2]
 gi|238902405|ref|YP_002928201.1| 30S ribosomal subunit protein S3 [Escherichia coli BW2952]
 gi|238913851|ref|ZP_04657688.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
 gi|253771862|ref|YP_003034693.1| 30S ribosomal protein S3 [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|254038475|ref|ZP_04872531.1| 30S ribosomal subunit protein S3 [Escherichia sp. 1_1_43]
 gi|254163242|ref|YP_003046350.1| 30S ribosomal protein S3 [Escherichia coli B str. REL606]
 gi|254795251|ref|YP_003080088.1| 30S ribosomal protein S3 [Escherichia coli O157:H7 str. TW14359]
 gi|256020673|ref|ZP_05434538.1| 30S ribosomal protein S3 [Shigella sp. D9]
 gi|256025958|ref|ZP_05439823.1| 30S ribosomal protein S3 [Escherichia sp. 4_1_40B]
 gi|260846112|ref|YP_003223890.1| 30S ribosomal subunit protein S3 [Escherichia coli O103:H2 str.
           12009]
 gi|260857435|ref|YP_003231326.1| 30S ribosomal subunit protein S3 [Escherichia coli O26:H11 str.
           11368]
 gi|260870057|ref|YP_003236459.1| 30S ribosomal subunit protein S3 [Escherichia coli O111:H- str.
           11128]
 gi|261224619|ref|ZP_05938900.1| 30S ribosomal subunit protein S3 [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261254487|ref|ZP_05947020.1| 30S ribosomal subunit protein S3 [Escherichia coli O157:H7 str.
           FRIK966]
 gi|261342784|ref|ZP_05970642.1| ribosomal protein S3 [Enterobacter cancerogenus ATCC 35316]
 gi|283788050|ref|YP_003367915.1| 30S ribosomal subunit protein S3 [Citrobacter rodentium ICC168]
 gi|283835731|ref|ZP_06355472.1| hypothetical protein CIT292_10123 [Citrobacter youngae ATCC 29220]
 gi|291284672|ref|YP_003501490.1| 30S ribosomal protein S3 [Escherichia coli O55:H7 str. CB9615]
 gi|293406911|ref|ZP_06650835.1| 30S ribosomal protein S3 [Escherichia coli FVEC1412]
 gi|293412733|ref|ZP_06655401.1| 30S ribosomal protein S3 [Escherichia coli B354]
 gi|293416731|ref|ZP_06659368.1| 30S ribosomal protein S3 [Escherichia coli B185]
 gi|293453632|ref|ZP_06664051.1| 30S ribosomal protein S3 [Escherichia coli B088]
 gi|296105022|ref|YP_003615168.1| 30S ribosomal protein S3 [Enterobacter cloacae subsp. cloacae ATCC
           13047]
 gi|297516602|ref|ZP_06934988.1| 30S ribosomal protein S3 [Escherichia coli OP50]
 gi|298382651|ref|ZP_06992246.1| 30S ribosomal protein S3 [Escherichia coli FVEC1302]
 gi|300815476|ref|ZP_07095701.1| ribosomal protein S3 [Escherichia coli MS 107-1]
 gi|300822883|ref|ZP_07103019.1| ribosomal protein S3 [Escherichia coli MS 119-7]
 gi|300896662|ref|ZP_07115178.1| ribosomal protein S3 [Escherichia coli MS 198-1]
 gi|300903562|ref|ZP_07121484.1| ribosomal protein S3 [Escherichia coli MS 84-1]
 gi|300918287|ref|ZP_07134891.1| ribosomal protein S3 [Escherichia coli MS 115-1]
 gi|300921877|ref|ZP_07138033.1| ribosomal protein S3 [Escherichia coli MS 182-1]
 gi|300932207|ref|ZP_07147486.1| ribosomal protein S3 [Escherichia coli MS 187-1]
 gi|300935312|ref|ZP_07150322.1| ribosomal protein S3 [Escherichia coli MS 21-1]
 gi|300946536|ref|ZP_07160801.1| ribosomal protein S3 [Escherichia coli MS 116-1]
 gi|300954811|ref|ZP_07167238.1| ribosomal protein S3 [Escherichia coli MS 175-1]
 gi|300973993|ref|ZP_07172400.1| ribosomal protein S3 [Escherichia coli MS 200-1]
 gi|300979885|ref|ZP_07174761.1| ribosomal protein S3 [Escherichia coli MS 45-1]
 gi|301018822|ref|ZP_07183066.1| ribosomal protein S3 [Escherichia coli MS 69-1]
 gi|301021136|ref|ZP_07185176.1| ribosomal protein S3 [Escherichia coli MS 196-1]
 gi|301046085|ref|ZP_07193263.1| ribosomal protein S3 [Escherichia coli MS 185-1]
 gi|301305523|ref|ZP_07211615.1| ribosomal protein S3 [Escherichia coli MS 124-1]
 gi|301325119|ref|ZP_07218653.1| ribosomal protein S3 [Escherichia coli MS 78-1]
 gi|301643866|ref|ZP_07243897.1| ribosomal protein S3 [Escherichia coli MS 146-1]
 gi|306816343|ref|ZP_07450481.1| 30S ribosomal protein S3 [Escherichia coli NC101]
 gi|307139997|ref|ZP_07499353.1| 30S ribosomal protein S3 [Escherichia coli H736]
 gi|307315107|ref|ZP_07594690.1| ribosomal protein S3 [Escherichia coli W]
 gi|309785636|ref|ZP_07680267.1| ribosomal protein S3 [Shigella dysenteriae 1617]
 gi|309794589|ref|ZP_07689011.1| ribosomal protein S3 [Escherichia coli MS 145-7]
 gi|312968361|ref|ZP_07782571.1| ribosomal protein S3 [Escherichia coli 2362-75]
 gi|312972425|ref|ZP_07786599.1| ribosomal protein S3 [Escherichia coli 1827-70]
 gi|331644010|ref|ZP_08345139.1| ribosomal protein S3 [Escherichia coli H736]
 gi|331649111|ref|ZP_08350197.1| ribosomal protein S3 [Escherichia coli M605]
 gi|331654907|ref|ZP_08355906.1| ribosomal protein S3 [Escherichia coli M718]
 gi|331659604|ref|ZP_08360542.1| ribosomal protein S3 [Escherichia coli TA206]
 gi|331664927|ref|ZP_08365828.1| ribosomal protein S3 [Escherichia coli TA143]
 gi|331670143|ref|ZP_08370982.1| ribosomal protein S3 [Escherichia coli TA271]
 gi|331674817|ref|ZP_08375574.1| ribosomal protein S3 [Escherichia coli TA280]
 gi|331679383|ref|ZP_08380053.1| ribosomal protein S3 [Escherichia coli H591]
 gi|331684956|ref|ZP_08385542.1| ribosomal protein S3 [Escherichia coli H299]
 gi|62287194|sp|Q5PIV8|RS3_SALPA RecName: Full=30S ribosomal protein S3
 gi|62288973|sp|P0A7V3|RS3_ECOLI RecName: Full=30S ribosomal protein S3
 gi|62288974|sp|P0A7V4|RS3_ECOL6 RecName: Full=30S ribosomal protein S3
 gi|62288975|sp|P0A7V5|RS3_ECO57 RecName: Full=30S ribosomal protein S3
 gi|62288976|sp|P0A7V6|RS3_SALTY RecName: Full=30S ribosomal protein S3
 gi|62288977|sp|P0A7V7|RS3_SALTI RecName: Full=30S ribosomal protein S3
 gi|75505516|sp|Q57J38|RS3_SALCH RecName: Full=30S ribosomal protein S3
 gi|91207838|sp|Q31VW2|RS3_SHIBS RecName: Full=30S ribosomal protein S3
 gi|91207839|sp|Q32B37|RS3_SHIDS RecName: Full=30S ribosomal protein S3
 gi|91207840|sp|Q3YWU5|RS3_SHISS RecName: Full=30S ribosomal protein S3
 gi|122366320|sp|Q0SZY8|RS3_SHIF8 RecName: Full=30S ribosomal protein S3
 gi|122957942|sp|Q0TCE7|RS3_ECOL5 RecName: Full=30S ribosomal protein S3
 gi|122990715|sp|Q1R612|RS3_ECOUT RecName: Full=30S ribosomal protein S3
 gi|152060860|sp|A1AGK2|RS3_ECOK1 RecName: Full=30S ribosomal protein S3
 gi|189044965|sp|A8AQL0|RS3_CITK8 RecName: Full=30S ribosomal protein S3
 gi|189044977|sp|A7ZSK3|RS3_ECO24 RecName: Full=30S ribosomal protein S3
 gi|189044978|sp|A8A5B9|RS3_ECOHS RecName: Full=30S ribosomal protein S3
 gi|189044979|sp|B1IPY5|RS3_ECOLC RecName: Full=30S ribosomal protein S3
 gi|189044980|sp|A4WFC2|RS3_ENT38 RecName: Full=30S ribosomal protein S3
 gi|189045331|sp|A9MN54|RS3_SALAR RecName: Full=30S ribosomal protein S3
 gi|189045332|sp|A9MSZ2|RS3_SALPB RecName: Full=30S ribosomal protein S3
 gi|226697702|sp|B7MCS9|RS3_ECO45 RecName: Full=30S ribosomal protein S3
 gi|226697703|sp|B5YTN5|RS3_ECO5E RecName: Full=30S ribosomal protein S3
 gi|226697704|sp|B7NLN3|RS3_ECO7I RecName: Full=30S ribosomal protein S3
 gi|226697705|sp|B7M1M8|RS3_ECO8A RecName: Full=30S ribosomal protein S3
 gi|226697706|sp|B7NDT5|RS3_ECOLU RecName: Full=30S ribosomal protein S3
 gi|226697707|sp|B6I228|RS3_ECOSE RecName: Full=30S ribosomal protein S3
 gi|226697708|sp|B1LHC8|RS3_ECOSM RecName: Full=30S ribosomal protein S3
 gi|226697711|sp|B7LRT0|RS3_ESCF3 RecName: Full=30S ribosomal protein S3
 gi|226697752|sp|B5F7T9|RS3_SALA4 RecName: Full=30S ribosomal protein S3
 gi|226697753|sp|B5FJK8|RS3_SALDC RecName: Full=30S ribosomal protein S3
 gi|226697754|sp|B5R285|RS3_SALEP RecName: Full=30S ribosomal protein S3
 gi|226697755|sp|B5RH21|RS3_SALG2 RecName: Full=30S ribosomal protein S3
 gi|226697756|sp|B4TKK9|RS3_SALHS RecName: Full=30S ribosomal protein S3
 gi|226697757|sp|B4SUT4|RS3_SALNS RecName: Full=30S ribosomal protein S3
 gi|226697758|sp|B5BGY0|RS3_SALPK RecName: Full=30S ribosomal protein S3
 gi|226697759|sp|B4TXD6|RS3_SALSV RecName: Full=30S ribosomal protein S3
 gi|226697760|sp|B2U2T2|RS3_SHIB3 RecName: Full=30S ribosomal protein S3
 gi|254764529|sp|B7UK38|RS3_ECO27 RecName: Full=30S ribosomal protein S3
 gi|254764530|sp|B7L4K3|RS3_ECO55 RecName: Full=30S ribosomal protein S3
 gi|254764531|sp|B7N198|RS3_ECO81 RecName: Full=30S ribosomal protein S3
 gi|254764544|sp|C0Q0B0|RS3_SALPC RecName: Full=30S ribosomal protein S3
 gi|259495244|sp|C4ZUG9|RS3_ECOBW RecName: Full=30S ribosomal protein S3
 gi|25294476|pir||AG1006 30S ribosomal chain protein S3 [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|116666550|pdb|1VS5|C Chain C, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With The Antibiotic
           Kasugamyin At 3.5a Resolution. This File Contains The
           30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 gi|116666602|pdb|1VS7|C Chain C, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With The Antibiotic
           Kasugamyin At 3.5a Resolution. This File Contains The
           30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 gi|256032364|pdb|3E1A|O Chain O, Structure Of The 30s Subunit And The Trnas Of E. Coli
           Ribosome In Pre-Accommodation State
 gi|256032421|pdb|3E1C|O Chain O, Structure Of The 30s Subunit And The Trnas Of E. Coli
           Ribosome In Post-Accommodation State
 gi|257097324|pdb|3I1M|C Chain C, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 gi|257097376|pdb|3I1O|C Chain C, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 gi|257097428|pdb|3I1Q|C Chain C, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 gi|257097482|pdb|3I1S|C Chain C, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 gi|257097536|pdb|3I1Z|C Chain C, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 gi|257097591|pdb|3I21|C Chain C, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 gi|290560309|pdb|3KC4|C Chain C, Ribosome-Secy Complex. This Entry 3kc4 Contains 30s
           Ribosomal Subnit. The 50s Ribosomal Subunit Can Be Found
           In Pdb Entry 3kcr
 gi|308198689|pdb|3OR9|C Chain C, Crystal Structure Of The E. Coli Ribosome Bound To
           Cem-101. This File Contains The 30s Subunit Of The First
           70s Ribosome.
 gi|308198710|pdb|3ORA|C Chain C, Crystal Structure Of The E. Coli Ribosome Bound To
           Cem-101. This File Contains The 30s Subunit Of The
           Second 70s Ribosome.
 gi|326634281|pdb|3IZV|G Chain G, Structural Insights Into Cognate Vs. Near-Cognate
           Discrimination During Decoding. This Entry Contains The
           Small Subunit Of A Ribosome Programmed With A
           Near-Cognate Codon, AT-Site Trna, P-Site Trna, Mrna And
           Ef-Tu
 gi|326634306|pdb|3IZW|G Chain G, Structural Insights Into Cognate Vs. Near-Cognate
           Discrimination During Decoding.This Entry Contains The
           Small Subunit Of A Ribosome Programmed With A Cognate
           Codon, AT-Site Trna, P-Site Trna, Mrna And Ef-Tu
 gi|26110332|gb|AAN82518.1|AE016767_278 30S ribosomal protein S3 [Escherichia coli CFT073]
 gi|42832|emb|CAA26466.1| unnamed protein product [Escherichia coli]
 gi|606248|gb|AAA58111.1| 30S ribosomal subunit protein S3 [Escherichia coli str. K-12
           substr. MG1655]
 gi|1789710|gb|AAC76339.1| 30S ribosomal subunit protein S3 [Escherichia coli str. K-12
           substr. MG1655]
 gi|13363652|dbj|BAB37602.1| 30S ribosomal subunit protein S3 [Escherichia coli O157:H7 str.
           Sakai]
 gi|16421991|gb|AAL22297.1| 30S ribosomal subunit protein S3 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|16505155|emb|CAD08179.1| 30S ribosomal subunit protein S3 [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29139974|gb|AAO71538.1| 30S ribosomal subunit protein S3 [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|30043647|gb|AAP19367.1| 30S ribosomal subunit protein S3 [Shigella flexneri 2a str. 2457T]
 gi|56129610|gb|AAV79116.1| 30S ribosomal subunit protein S3 [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|62129571|gb|AAX67274.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|73857310|gb|AAZ90017.1| 30S ribosomal subunit protein S3 [Shigella sonnei Ss046]
 gi|81242758|gb|ABB63468.1| 30S ribosomal subunit protein S3 [Shigella dysenteriae Sd197]
 gi|81247088|gb|ABB67796.1| 30S ribosomal subunit protein S3 [Shigella boydii Sb227]
 gi|85676727|dbj|BAE77977.1| 30S ribosomal subunit protein S3 [Escherichia coli str. K12 substr.
           W3110]
 gi|91074321|gb|ABE09202.1| 30S ribosomal subunit protein S3 [Escherichia coli UTI89]
 gi|110345145|gb|ABG71382.1| 30S ribosomal protein S3 [Escherichia coli 536]
 gi|110616710|gb|ABF05377.1| 30S ribosomal subunit protein S3 [Shigella flexneri 5 str. 8401]
 gi|115514717|gb|ABJ02792.1| 30S ribosomal subunit protein S3 [Escherichia coli APEC O1]
 gi|145320255|gb|ABP62402.1| SSU ribosomal protein S3P [Enterobacter sp. 638]
 gi|157068468|gb|ABV07723.1| ribosomal protein S3 [Escherichia coli HS]
 gi|157079953|gb|ABV19661.1| ribosomal protein S3 [Escherichia coli E24377A]
 gi|157086096|gb|ABV15774.1| hypothetical protein CKO_04729 [Citrobacter koseri ATCC BAA-895]
 gi|160867361|gb|ABX23984.1| hypothetical protein SARI_04195 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
 gi|161365824|gb|ABX69592.1| hypothetical protein SPAB_04275 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|169753378|gb|ACA76077.1| ribosomal protein S3 [Escherichia coli ATCC 8739]
 gi|170121607|gb|EDS90538.1| ribosomal protein S3 [Escherichia albertii TW07627]
 gi|170521095|gb|ACB19273.1| ribosomal protein S3 [Escherichia coli SMS-3-5]
 gi|187429270|gb|ACD08544.1| ribosomal protein S3 [Shigella boydii CDC 3083-94]
 gi|188487203|gb|EDU62306.1| ribosomal protein S3 [Escherichia coli 53638]
 gi|188998459|gb|EDU67457.1| ribosomal protein S3 [Escherichia coli O157:H7 str. EC4076]
 gi|189358885|gb|EDU77304.1| ribosomal protein S3 [Escherichia coli O157:H7 str. EC4401]
 gi|189361723|gb|EDU80142.1| ribosomal protein S3 [Escherichia coli O157:H7 str. EC4486]
 gi|190905052|gb|EDV64716.1| ribosomal protein S3 [Escherichia coli F11]
 gi|194403714|gb|ACF63936.1| ribosomal protein S3 [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194410116|gb|ACF70335.1| ribosomal protein S3 [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194713348|gb|ACF92569.1| ribosomal protein S3 [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|195628911|gb|EDX48321.1| ribosomal protein S3 [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|197095760|emb|CAR61330.1| 30S ribosomal subunit protein S3 [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|197213136|gb|ACH50533.1| ribosomal protein S3 [Salmonella enterica subsp. enterica serovar
           Agona str. SL483]
 gi|197242775|gb|EDY25395.1| ribosomal protein S3 [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|197937013|gb|ACH74346.1| ribosomal protein S3 [Salmonella enterica subsp. enterica serovar
           Dublin str. CT_02021853]
 gi|199605747|gb|EDZ04292.1| ribosomal protein S3 [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|205274719|emb|CAR39775.1| 30S ribosomal subunit protein S3 [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|206710479|emb|CAR34837.1| 30S ribosomal subunit protein S3 [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|208726356|gb|EDZ75957.1| ribosomal protein S3 [Escherichia coli O157:H7 str. EC4206]
 gi|208733272|gb|EDZ81959.1| ribosomal protein S3 [Escherichia coli O157:H7 str. EC4045]
 gi|208741596|gb|EDZ89278.1| ribosomal protein S3 [Escherichia coli O157:H7 str. EC4042]
 gi|209161895|gb|ACI39328.1| ribosomal protein S3 [Escherichia coli O157:H7 str. EC4115]
 gi|209757098|gb|ACI76861.1| 30S ribosomal subunit protein S3 [Escherichia coli]
 gi|209757100|gb|ACI76862.1| 30S ribosomal subunit protein S3 [Escherichia coli]
 gi|209757102|gb|ACI76863.1| 30S ribosomal subunit protein S3 [Escherichia coli]
 gi|209757104|gb|ACI76864.1| 30S ribosomal subunit protein S3 [Escherichia coli]
 gi|209757106|gb|ACI76865.1| 30S ribosomal subunit protein S3 [Escherichia coli]
 gi|209914039|dbj|BAG79113.1| 30S ribosomal protein S3 [Escherichia coli SE11]
 gi|215266686|emb|CAS11125.1| 30S ribosomal subunit protein S3 [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217320869|gb|EEC29293.1| ribosomal protein S3 [Escherichia coli O157:H7 str. TW14588]
 gi|218353738|emb|CAV00027.1| 30S ribosomal subunit protein S3 [Escherichia coli 55989]
 gi|218358130|emb|CAQ90777.1| 30S ribosomal subunit protein S3 [Escherichia fergusonii ATCC
           35469]
 gi|218362639|emb|CAR00265.1| 30S ribosomal subunit protein S3 [Escherichia coli IAI1]
 gi|218367144|emb|CAR04918.1| 30S ribosomal subunit protein S3 [Escherichia coli S88]
 gi|218372062|emb|CAR19922.1| 30S ribosomal subunit protein S3 [Escherichia coli IAI39]
 gi|218429164|emb|CAR10116.2| 30S ribosomal subunit protein S3 [Escherichia coli ED1a]
 gi|218434018|emb|CAR14935.1| 30S ribosomal subunit protein S3 [Escherichia coli UMN026]
 gi|222035023|emb|CAP77766.1| 30S ribosomal protein S3 [Escherichia coli LF82]
 gi|224469757|gb|ACN47587.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|226838981|gb|EEH71004.1| 30S ribosomal subunit protein S3 [Escherichia sp. 1_1_43]
 gi|226902308|gb|EEH88567.1| 30S ribosomal subunit protein S3 [Escherichia sp. 3_2_53FAA]
 gi|226909271|gb|EEH95189.1| 30S ribosomal protein S3 [Citrobacter sp. 30_2]
 gi|227839589|gb|EEJ50055.1| 30S ribosomal protein S3 [Escherichia coli 83972]
 gi|238859798|gb|ACR61796.1| 30S ribosomal subunit protein S3 [Escherichia coli BW2952]
 gi|242378841|emb|CAQ33633.1| 30S ribosomal subunit protein S3, subunit of 30S ribosomal subunit
           and ribosome [Escherichia coli BL21(DE3)]
 gi|253322906|gb|ACT27508.1| ribosomal protein S3 [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253975143|gb|ACT40814.1| 30S ribosomal protein S3 [Escherichia coli B str. REL606]
 gi|253979299|gb|ACT44969.1| 30S ribosomal protein S3 [Escherichia coli BL21(DE3)]
 gi|254594651|gb|ACT74012.1| 30S ribosomal subunit protein S3 [Escherichia coli O157:H7 str.
           TW14359]
 gi|257756084|dbj|BAI27586.1| 30S ribosomal subunit protein S3 [Escherichia coli O26:H11 str.
           11368]
 gi|257761259|dbj|BAI32756.1| 30S ribosomal subunit protein S3 [Escherichia coli O103:H2 str.
           12009]
 gi|257766413|dbj|BAI37908.1| 30S ribosomal subunit protein S3 [Escherichia coli O111:H- str.
           11128]
 gi|260447667|gb|ACX38089.1| ribosomal protein S3 [Escherichia coli DH1]
 gi|261248590|emb|CBG26428.1| 30S ribosomal subunit protein S3 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|267995643|gb|ACY90528.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|281180349|dbj|BAI56679.1| 30S ribosomal protein S3 [Escherichia coli SE15]
 gi|282951504|emb|CBG91203.1| 30S ribosomal subunit protein S3 [Citrobacter rodentium ICC168]
 gi|284923320|emb|CBG36414.1| 30S ribosomal subunit protein S3 [Escherichia coli 042]
 gi|288314962|gb|EFC53900.1| ribosomal protein S3 [Enterobacter cancerogenus ATCC 35316]
 gi|290764545|gb|ADD58506.1| 30S ribosomal protein S3 [Escherichia coli O55:H7 str. CB9615]
 gi|291068410|gb|EFE06519.1| ribosomal protein S3 [Citrobacter youngae ATCC 29220]
 gi|291321758|gb|EFE61189.1| 30S ribosomal protein S3 [Escherichia coli B088]
 gi|291425722|gb|EFE98756.1| 30S ribosomal protein S3 [Escherichia coli FVEC1412]
 gi|291431307|gb|EFF04292.1| 30S ribosomal protein S3 [Escherichia coli B185]
 gi|291468380|gb|EFF10873.1| 30S ribosomal protein S3 [Escherichia coli B354]
 gi|294489965|gb|ADE88721.1| ribosomal protein S3 [Escherichia coli IHE3034]
 gi|295059481|gb|ADF64219.1| 30S ribosomal protein S3 [Enterobacter cloacae subsp. cloacae ATCC
           13047]
 gi|295096955|emb|CBK86045.1| SSU ribosomal protein S3P [Enterobacter cloacae subsp. cloacae NCTC
           9394]
 gi|298276487|gb|EFI18005.1| 30S ribosomal protein S3 [Escherichia coli FVEC1302]
 gi|299881666|gb|EFI89877.1| ribosomal protein S3 [Escherichia coli MS 196-1]
 gi|300301911|gb|EFJ58296.1| ribosomal protein S3 [Escherichia coli MS 185-1]
 gi|300309003|gb|EFJ63523.1| ribosomal protein S3 [Escherichia coli MS 200-1]
 gi|300318240|gb|EFJ68024.1| ribosomal protein S3 [Escherichia coli MS 175-1]
 gi|300359493|gb|EFJ75363.1| ribosomal protein S3 [Escherichia coli MS 198-1]
 gi|300399532|gb|EFJ83070.1| ribosomal protein S3 [Escherichia coli MS 69-1]
 gi|300404435|gb|EFJ87973.1| ribosomal protein S3 [Escherichia coli MS 84-1]
 gi|300409396|gb|EFJ92934.1| ribosomal protein S3 [Escherichia coli MS 45-1]
 gi|300414548|gb|EFJ97858.1| ribosomal protein S3 [Escherichia coli MS 115-1]
 gi|300421725|gb|EFK05036.1| ribosomal protein S3 [Escherichia coli MS 182-1]
 gi|300453782|gb|EFK17402.1| ribosomal protein S3 [Escherichia coli MS 116-1]
 gi|300459468|gb|EFK22961.1| ribosomal protein S3 [Escherichia coli MS 21-1]
 gi|300460031|gb|EFK23524.1| ribosomal protein S3 [Escherichia coli MS 187-1]
 gi|300524649|gb|EFK45718.1| ribosomal protein S3 [Escherichia coli MS 119-7]
 gi|300532368|gb|EFK53430.1| ribosomal protein S3 [Escherichia coli MS 107-1]
 gi|300839218|gb|EFK66978.1| ribosomal protein S3 [Escherichia coli MS 124-1]
 gi|300847998|gb|EFK75758.1| ribosomal protein S3 [Escherichia coli MS 78-1]
 gi|301077769|gb|EFK92575.1| ribosomal protein S3 [Escherichia coli MS 146-1]
 gi|301159977|emb|CBW19496.1| 30S ribosomal subunit protein S3 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|305850739|gb|EFM51196.1| 30S ribosomal protein S3 [Escherichia coli NC101]
 gi|306905456|gb|EFN35991.1| ribosomal protein S3 [Escherichia coli W]
 gi|307555402|gb|ADN48177.1| 30S ribosomal protein S3 [Escherichia coli ABU 83972]
 gi|307628349|gb|ADN72653.1| 30S ribosomal protein S3 [Escherichia coli UM146]
 gi|308121639|gb|EFO58901.1| ribosomal protein S3 [Escherichia coli MS 145-7]
 gi|308926756|gb|EFP72232.1| ribosomal protein S3 [Shigella dysenteriae 1617]
 gi|310334802|gb|EFQ01007.1| ribosomal protein S3 [Escherichia coli 1827-70]
 gi|312287186|gb|EFR15096.1| ribosomal protein S3 [Escherichia coli 2362-75]
 gi|312914457|dbj|BAJ38431.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|312947865|gb|ADR28692.1| 30S ribosomal protein S3 [Escherichia coli O83:H1 str. NRG 857C]
 gi|313647376|gb|EFS11828.1| ribosomal protein S3 [Shigella flexneri 2a str. 2457T]
 gi|315062606|gb|ADT76933.1| 30S ribosomal subunit protein S3 [Escherichia coli W]
 gi|315137889|dbj|BAJ45048.1| 30S ribosomal protein S3 [Escherichia coli DH1]
 gi|315255897|gb|EFU35865.1| ribosomal protein S3 [Escherichia coli MS 85-1]
 gi|315284611|gb|EFU44056.1| ribosomal protein S3 [Escherichia coli MS 110-3]
 gi|315292369|gb|EFU51721.1| ribosomal protein S3 [Escherichia coli MS 153-1]
 gi|315298612|gb|EFU57867.1| ribosomal protein S3 [Escherichia coli MS 16-3]
 gi|315616991|gb|EFU97603.1| ribosomal protein S3 [Escherichia coli 3431]
 gi|320087879|emb|CBY97642.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
 gi|320180148|gb|EFW55087.1| SSU ribosomal protein S3p (S3e) [Shigella boydii ATCC 9905]
 gi|320187032|gb|EFW61744.1| SSU ribosomal protein S3p (S3e) [Shigella flexneri CDC 796-83]
 gi|320191655|gb|EFW66305.1| SSU ribosomal protein S3p (S3e) [Escherichia coli O157:H7 str.
           EC1212]
 gi|320199498|gb|EFW74088.1| SSU ribosomal protein S3p (S3e) [Escherichia coli EC4100B]
 gi|320639619|gb|EFX09213.1| 30S ribosomal protein S3 [Escherichia coli O157:H7 str. G5101]
 gi|320645117|gb|EFX14133.1| 30S ribosomal protein S3 [Escherichia coli O157:H- str. 493-89]
 gi|320650428|gb|EFX18894.1| 30S ribosomal protein S3 [Escherichia coli O157:H- str. H 2687]
 gi|320655953|gb|EFX23873.1| 30S ribosomal protein S3 [Escherichia coli O55:H7 str. 3256-97 TW
           07815]
 gi|320661405|gb|EFX28820.1| 30S ribosomal protein S3 [Escherichia coli O55:H7 str. USDA 5905]
 gi|320666427|gb|EFX33410.1| 30S ribosomal protein S3 [Escherichia coli O157:H7 str. LSU-61]
 gi|321226481|gb|EFX51531.1| SSU ribosomal protein S3p (S3e) [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|322615025|gb|EFY11949.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322617312|gb|EFY14213.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322625534|gb|EFY22359.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322626376|gb|EFY23185.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322632112|gb|EFY28865.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322635009|gb|EFY31732.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322643290|gb|EFY39857.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322646626|gb|EFY43133.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322649972|gb|EFY46391.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322652689|gb|EFY49029.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322659554|gb|EFY55798.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322665504|gb|EFY61691.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322670398|gb|EFY66537.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322670471|gb|EFY66605.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322675047|gb|EFY71130.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322681584|gb|EFY77613.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322685928|gb|EFY81917.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|322716425|gb|EFZ07996.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
 gi|323131792|gb|ADX19222.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|323154152|gb|EFZ40355.1| ribosomal protein S3 [Escherichia coli EPECa14]
 gi|323162993|gb|EFZ48828.1| ribosomal protein S3 [Escherichia coli E128010]
 gi|323164878|gb|EFZ50669.1| ribosomal protein S3 [Shigella sonnei 53G]
 gi|323173950|gb|EFZ59578.1| ribosomal protein S3 [Escherichia coli LT-68]
 gi|323179150|gb|EFZ64724.1| ribosomal protein S3 [Escherichia coli 1180]
 gi|323182792|gb|EFZ68193.1| ribosomal protein S3 [Escherichia coli 1357]
 gi|323189081|gb|EFZ74365.1| ribosomal protein S3 [Escherichia coli RN587/1]
 gi|323194036|gb|EFZ79236.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323196446|gb|EFZ81597.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323202315|gb|EFZ87360.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323207336|gb|EFZ92286.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323211228|gb|EFZ96073.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323216063|gb|EGA00794.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323223446|gb|EGA07774.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323226824|gb|EGA11014.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323231814|gb|EGA15924.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323233233|gb|EGA17328.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323237300|gb|EGA21365.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323245535|gb|EGA29534.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323249041|gb|EGA32963.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323250664|gb|EGA34545.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323256893|gb|EGA40607.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323263042|gb|EGA46589.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323266042|gb|EGA49537.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323272799|gb|EGA56202.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
 gi|323376807|gb|ADX49075.1| ribosomal protein S3 [Escherichia coli KO11]
 gi|323934488|gb|EGB30896.1| ribosomal protein S3 [Escherichia coli E1520]
 gi|323939264|gb|EGB35476.1| ribosomal protein S3 [Escherichia coli E482]
 gi|323944265|gb|EGB40341.1| ribosomal protein S3 [Escherichia coli H120]
 gi|323950228|gb|EGB46110.1| ribosomal protein S3 [Escherichia coli H252]
 gi|323954563|gb|EGB50346.1| ribosomal protein S3 [Escherichia coli H263]
 gi|323959535|gb|EGB55188.1| ribosomal protein S3 [Escherichia coli H489]
 gi|323966276|gb|EGB61711.1| ribosomal protein S3 [Escherichia coli M863]
 gi|323970118|gb|EGB65392.1| ribosomal protein S3 [Escherichia coli TA007]
 gi|323974733|gb|EGB69846.1| ribosomal protein S3 [Escherichia coli TW10509]
 gi|324009005|gb|EGB78224.1| ribosomal protein S3 [Escherichia coli MS 57-2]
 gi|324014930|gb|EGB84149.1| ribosomal protein S3 [Escherichia coli MS 60-1]
 gi|324017868|gb|EGB87087.1| ribosomal protein S3 [Escherichia coli MS 117-3]
 gi|324111993|gb|EGC05972.1| ribosomal protein S3 [Escherichia fergusonii B253]
 gi|324116296|gb|EGC10216.1| ribosomal protein S3 [Escherichia coli E1167]
 gi|325498880|gb|EGC96739.1| 30S ribosomal protein S3 [Escherichia fergusonii ECD227]
 gi|326342559|gb|EGD66333.1| SSU ribosomal protein S3p (S3e) [Escherichia coli O157:H7 str.
           1044]
 gi|326344546|gb|EGD68295.1| SSU ribosomal protein S3p (S3e) [Escherichia coli O157:H7 str.
           1125]
 gi|326625177|gb|EGE31522.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
 gi|326630087|gb|EGE36430.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
 gi|327250962|gb|EGE62655.1| ribosomal protein S3 [Escherichia coli STEC_7v]
 gi|330909356|gb|EGH37870.1| SSU ribosomal protein S3p (S3e) [Escherichia coli AA86]
 gi|331036304|gb|EGI08530.1| ribosomal protein S3 [Escherichia coli H736]
 gi|331041609|gb|EGI13753.1| ribosomal protein S3 [Escherichia coli M605]
 gi|331046922|gb|EGI19000.1| ribosomal protein S3 [Escherichia coli M718]
 gi|331052819|gb|EGI24852.1| ribosomal protein S3 [Escherichia coli TA206]
 gi|331057437|gb|EGI29423.1| ribosomal protein S3 [Escherichia coli TA143]
 gi|331062205|gb|EGI34125.1| ribosomal protein S3 [Escherichia coli TA271]
 gi|331067726|gb|EGI39124.1| ribosomal protein S3 [Escherichia coli TA280]
 gi|331072555|gb|EGI43880.1| ribosomal protein S3 [Escherichia coli H591]
 gi|331077327|gb|EGI48539.1| ribosomal protein S3 [Escherichia coli H299]
 gi|332085465|gb|EGI90631.1| ribosomal protein S3 [Shigella boydii 5216-82]
 gi|332086053|gb|EGI91217.1| ribosomal protein S3 [Shigella dysenteriae 155-74]
 gi|332090373|gb|EGI95471.1| ribosomal protein S3 [Shigella boydii 3594-74]
 gi|332104221|gb|EGJ07567.1| 30S ribosomal protein S3 [Shigella sp. D9]
          Length = 233

 Score =  269 bits (689), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 113/230 (49%), Positives = 157/230 (68%), Gaps = 4/230 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS WFA   E+   L  D K+R+YL   L +A V++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLTKELAKASVSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+RK ++++      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQINIAEVRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
             QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 TSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD----SDSTIPAAEHRVVEKD 226
            IDY T+ A T YG  G+KV++   + +           PAA+ +  ++ 
Sbjct: 181 DIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEKPAAQPKKQQRK 230


>gi|220930971|ref|YP_002507879.1| ribosomal protein S3 [Halothermothrix orenii H 168]
 gi|254764533|sp|B8D0D0|RS3_HALOH RecName: Full=30S ribosomal protein S3
 gi|219992281|gb|ACL68884.1| ribosomal protein S3 [Halothermothrix orenii H 168]
          Length = 214

 Score =  269 bits (689), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 101/214 (47%), Positives = 153/214 (71%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   R+GV   W+++W+A  + Y  LL EDLKIR +++  +  AG+++I+IER 
Sbjct: 1   MGQKVHPHGLRVGVIKDWDAKWYADKNNYADLLQEDLKIRNHVKNKMYDAGISRIVIERV 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               ++ VY+ARPG++IG+ G++++ +RK +  MT   + ++V EV  PE++A L+A++I
Sbjct: 61  ANRLKLDVYTARPGMVIGRGGSEVDALRKDIEQMTGKNVQINVVEVEDPELDAQLVAENI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERR+ FRRAMK+A+  AMR GA+G KV +SGRL GAE++RTE Y +GRVPL TLRA
Sbjct: 121 AAQLERRISFRRAMKQAMNRAMRMGAEGFKVQSSGRLGGAEMARTEGYSDGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDST 214
            IDYG A A T YG  G+KV+++  + + + +  
Sbjct: 181 DIDYGFAEAYTTYGKIGVKVWINKGEVLPEVEDK 214


>gi|326315230|ref|YP_004232902.1| 30S ribosomal protein S3 [Acidovorax avenae subsp. avenae ATCC
           19860]
 gi|323372066|gb|ADX44335.1| ribosomal protein S3 [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 293

 Score =  269 bits (689), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 120/218 (55%), Positives = 163/218 (74%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V+  W SRW+A   ++  +L ED+K+REYL+  LK A V++ILIER 
Sbjct: 1   MGQKIHPTGFRLAVSRNWASRWYASNRDFAGMLAEDIKVREYLKAKLKNAAVSRILIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI +YSARPG++IGKKG DIE ++K+L++     + +++ EV KPEI+A LIA SI
Sbjct: 61  AKNARITIYSARPGVVIGKKGEDIENLKKELASRLGVPVAVNIEEVRKPEIDAKLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLE+R++FRRAMKRA+Q+AMR GA G+K++++GRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 TQQLEKRIMFRRAMKRAMQNAMRLGAQGIKIMSAGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAA 218
            IDYGT+ A+T YG  G+KV+V   D +  +D  +   
Sbjct: 181 DIDYGTSEAKTTYGVIGVKVWVYKGDTLGRNDLPVAET 218


>gi|238754181|ref|ZP_04615539.1| 30S ribosomal protein S3 [Yersinia ruckeri ATCC 29473]
 gi|238707677|gb|EEQ00037.1| 30S ribosomal protein S3 [Yersinia ruckeri ATCC 29473]
          Length = 232

 Score =  269 bits (689), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 111/229 (48%), Positives = 158/229 (68%), Gaps = 3/229 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS W+A   E+   L  D K+R++L   L +A V++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNSTWYANTKEFADNLDSDFKVRQFLTKELVKASVSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+RK ++++      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQINIAEVRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
             QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 TSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDS---DSTIPAAEHRVVEKD 226
            IDY T+ A T YG  G+KV++   + +      +   PAA+ +  ++ 
Sbjct: 181 DIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEPAAQPKKQQRK 229


>gi|253701916|ref|YP_003023105.1| 30S ribosomal protein S3 [Geobacter sp. M21]
 gi|259495249|sp|C6E4Q1|RS3_GEOSM RecName: Full=30S ribosomal protein S3
 gi|251776766|gb|ACT19347.1| ribosomal protein S3 [Geobacter sp. M21]
          Length = 211

 Score =  269 bits (689), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 114/212 (53%), Positives = 160/212 (75%), Gaps = 1/212 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI FRLGV  TW+S+W+A   +Y  LLHEDLK+R +L+  L  +GV+KI IER 
Sbjct: 1   MGQKVNPIGFRLGVIKTWDSKWYAE-KDYAKLLHEDLKLRNFLKKRLYHSGVSKIEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               +I +++ARPGLIIGKKG+++E ++K+L+ +T  E++L++ EV KPE++A L+A+++
Sbjct: 60  AGKAKINIFTARPGLIIGKKGSEVETLKKELAKLTEKEVYLNIQEVRKPELDAQLVAENV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERR+ FRRAMK++V S ++FGA G+++  SGRL GAE+SRTE Y EGRVPL TLRA
Sbjct: 120 AMQLERRIAFRRAMKKSVTSTLKFGAKGIRITCSGRLGGAEMSRTEWYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSD 212
            IDYG A A+T YG  G+KV +   + +S   
Sbjct: 180 DIDYGFAEAKTTYGIIGVKVLLFKGEVLSAKK 211


>gi|161510956|ref|YP_089234.2| 30S ribosomal protein S3 [Mannheimia succiniciproducens MBEL55E]
 gi|61215475|sp|Q65QW1|RS3_MANSM RecName: Full=30S ribosomal protein S3
          Length = 235

 Score =  269 bits (689), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 110/230 (47%), Positives = 152/230 (66%), Gaps = 6/230 (2%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   RLG+   W+S WFA   ++ + L  D K+R++L   L  A V++I IER 
Sbjct: 1   MGQKVNPHGIRLGIVKPWSSTWFANTQDFASNLDGDFKVRKFLNKELANASVSRITIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  ++ +      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRNAVAKIAGVPAQINIAEVKKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD------SDSTIPAAEHRVVE 224
            IDY T+ A T YG  G+KV++   + +             PAA  +   
Sbjct: 181 DIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAIAQQPEQQPAAPKKAPR 230


>gi|213861394|ref|ZP_03385864.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Typhi str. M223]
          Length = 220

 Score =  269 bits (689), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 112/220 (50%), Positives = 154/220 (70%), Gaps = 1/220 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS WFA   E+   L  D K+R+YL   L +A V++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLTKELAKASVSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+RK ++++      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQINIAEVRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
             QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 TSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEH 220
            IDY T+ A T YG  G+KV++  + E+    + +   E 
Sbjct: 181 DIDYNTSEAHTTYGVIGVKVWIF-KGEILGGMAAVEQPEK 219


>gi|310817003|ref|YP_003964967.1| 30S ribosomal protein S3 [Ketogulonicigenium vulgare Y25]
 gi|308755738|gb|ADO43667.1| 30S ribosomal protein S3 [Ketogulonicigenium vulgare Y25]
          Length = 238

 Score =  269 bits (689), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 129/225 (57%), Positives = 173/225 (76%), Gaps = 4/225 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K+NP+  RL VN TW+SRW+A   +YG LL EDLKI+++++   KQAG++ ++IER 
Sbjct: 1   MGNKVNPVGMRLQVNRTWDSRWYADTKDYGNLLLEDLKIKDFVRKEAKQAGISHVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ +++ARPG+IIGKKG DIE +RKKLS +T+SE+HL++ EV KPE++A L+ +SI
Sbjct: 61  HKKCRVTIHAARPGVIIGKKGADIETLRKKLSALTDSELHLNIVEVRKPELDAALVGESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQ+AMR GA G++V  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVSFRRAMKRAVQNAMRMGALGIRVNVAGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDY  + A+TAYG  GIKV++  + E+ + D   P A  R + +
Sbjct: 181 DIDYALSEAQTAYGIIGIKVWIF-KGEILEHD---PQAHDRRITE 221


>gi|92112560|ref|YP_572488.1| 30S ribosomal protein S3 [Chromohalobacter salexigens DSM 3043]
 gi|122990610|sp|Q1R0G9|RS3_CHRSD RecName: Full=30S ribosomal protein S3
 gi|91795650|gb|ABE57789.1| SSU ribosomal protein S3P [Chromohalobacter salexigens DSM 3043]
          Length = 232

 Score =  269 bits (689), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 108/224 (48%), Positives = 149/224 (66%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   RLG+     S W+A    Y   L+ DL++R +L+  LK A V+ I IER 
Sbjct: 1   MGQKVNPTGIRLGIVKDHRSVWYAERGAYADKLNNDLEVRRFLEQRLKNASVSDITIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
             N RI +++ARPG++IGKKG D++++R+ +S M    +H+++ EV KPE++A L+AQ++
Sbjct: 61  ANNARITIHTARPGIVIGKKGEDVDRLRRDVSEMMGVPVHVNIEEVRKPELDAQLVAQNV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
             QLERRV+FRRAMKRAVQ+AMR GA G+K+  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 CGQLERRVMFRRAMKRAVQNAMRLGAGGIKIQLSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVE 224
            IDY T  A T YG  G+KV+V   + +   +      +     
Sbjct: 181 DIDYATYEAHTTYGVIGVKVWVFKGEILGGIEEVRAKQKQAQAP 224


>gi|206901441|ref|YP_002250707.1| ribosomal protein S3 [Dictyoglomus thermophilum H-6-12]
 gi|226697700|sp|B5YDU9|RS3_DICT6 RecName: Full=30S ribosomal protein S3
 gi|206740544|gb|ACI19602.1| ribosomal protein S3 [Dictyoglomus thermophilum H-6-12]
          Length = 245

 Score =  269 bits (689), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 106/227 (46%), Positives = 151/227 (66%), Gaps = 1/227 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK +P  FRLG+   W S W+A  S+Y +LLHED  IR YL+ +  QAG++ I IER 
Sbjct: 1   MGQKTHPYGFRLGITKDWKSHWYAERSDYSSLLHEDWAIRNYLKKNYYQAGISLIEIERK 60

Query: 61  H-KNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQS 119
                 I +++ARPG++IG+ G++IE IRK L  +TN  + ++V EV  PE++A L+A++
Sbjct: 61  AANRVDITIHTARPGMLIGRGGSEIENIRKNLIKLTNKNVFVNVQEVKNPELDAQLVAEN 120

Query: 120 IAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           IA Q+E+R+ ++RAMK+A+  A+R GA G+KV+ SGRLNGAE++R+E + EGR+PLQTL 
Sbjct: 121 IAMQIEKRINYKRAMKQAINRALRAGAKGIKVMCSGRLNGAEIARSEWFREGRIPLQTLT 180

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
           A IDYG A A T  G  G+KV++   D        I     + V K 
Sbjct: 181 ADIDYGFAEAFTISGVIGVKVWIYKGDVPELHKEAIQELPEKAVPKK 227


>gi|157372770|ref|YP_001480759.1| 30S ribosomal protein S3 [Serratia proteamaculans 568]
 gi|172047789|sp|A8GKJ1|RS3_SERP5 RecName: Full=30S ribosomal protein S3
 gi|157324534|gb|ABV43631.1| ribosomal protein S3 [Serratia proteamaculans 568]
          Length = 232

 Score =  269 bits (689), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 112/229 (48%), Positives = 158/229 (68%), Gaps = 3/229 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS W+A   E+   L  D K+R++L   L +A V++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNSTWYANTKEFADNLDSDFKVRQFLIKELAKASVSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+RK ++N+      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRKVVANIAGVPAQINIAEVRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
             QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 TSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDS---DSTIPAAEHRVVEKD 226
            IDY T+ A T YG  G+KV++   + +      +   PAA+ +  ++ 
Sbjct: 181 DIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEPAAQPKKQQRK 229


>gi|78064930|ref|YP_367699.1| 30S ribosomal protein S3 [Burkholderia sp. 383]
 gi|107024297|ref|YP_622624.1| 30S ribosomal protein S3 [Burkholderia cenocepacia AU 1054]
 gi|115350328|ref|YP_772167.1| 30S ribosomal protein S3 [Burkholderia ambifaria AMMD]
 gi|116688378|ref|YP_834001.1| 30S ribosomal protein S3 [Burkholderia cenocepacia HI2424]
 gi|134294449|ref|YP_001118184.1| 30S ribosomal protein S3 [Burkholderia vietnamiensis G4]
 gi|170700700|ref|ZP_02891695.1| ribosomal protein S3 [Burkholderia ambifaria IOP40-10]
 gi|170731688|ref|YP_001763635.1| 30S ribosomal protein S3 [Burkholderia cenocepacia MC0-3]
 gi|171318354|ref|ZP_02907512.1| ribosomal protein S3 [Burkholderia ambifaria MEX-5]
 gi|172059347|ref|YP_001806999.1| 30S ribosomal protein S3 [Burkholderia ambifaria MC40-6]
 gi|206558647|ref|YP_002229407.1| 30S ribosomal protein S3 [Burkholderia cenocepacia J2315]
 gi|91207644|sp|Q39KG1|RS3_BURS3 RecName: Full=30S ribosomal protein S3
 gi|122324260|sp|Q0BJ40|RS3_BURCM RecName: Full=30S ribosomal protein S3
 gi|123071807|sp|Q1BRV4|RS3_BURCA RecName: Full=30S ribosomal protein S3
 gi|152060850|sp|A0K3N1|RS3_BURCH RecName: Full=30S ribosomal protein S3
 gi|189044961|sp|A4JAP6|RS3_BURVG RecName: Full=30S ribosomal protein S3
 gi|226697672|sp|B1YRD6|RS3_BURA4 RecName: Full=30S ribosomal protein S3
 gi|226697673|sp|B1JU28|RS3_BURCC RecName: Full=30S ribosomal protein S3
 gi|226697674|sp|B4E5C6|RS3_BURCJ RecName: Full=30S ribosomal protein S3
 gi|77965675|gb|ABB07055.1| SSU ribosomal protein S3P [Burkholderia sp. 383]
 gi|105894486|gb|ABF77651.1| SSU ribosomal protein S3P [Burkholderia cenocepacia AU 1054]
 gi|115280316|gb|ABI85833.1| SSU ribosomal protein S3P [Burkholderia ambifaria AMMD]
 gi|116646467|gb|ABK07108.1| SSU ribosomal protein S3P [Burkholderia cenocepacia HI2424]
 gi|134137606|gb|ABO53349.1| SSU ribosomal protein S3P [Burkholderia vietnamiensis G4]
 gi|169814930|gb|ACA89513.1| ribosomal protein S3 [Burkholderia cenocepacia MC0-3]
 gi|170134370|gb|EDT02703.1| ribosomal protein S3 [Burkholderia ambifaria IOP40-10]
 gi|171096432|gb|EDT41331.1| ribosomal protein S3 [Burkholderia ambifaria MEX-5]
 gi|171991864|gb|ACB62783.1| ribosomal protein S3 [Burkholderia ambifaria MC40-6]
 gi|198034684|emb|CAR50551.1| 30S ribosomal protein S3 [Burkholderia cenocepacia J2315]
          Length = 266

 Score =  269 bits (689), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 117/229 (51%), Positives = 166/229 (72%), Gaps = 2/229 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V+  W SRW+A  + + A+L ED+ +REYL+  LK A V +++IER 
Sbjct: 1   MGQKIHPTGFRLAVSRNWASRWYANNNNFAAMLQEDIGVREYLKKKLKNASVGRVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI +YS+RPG++IGKKG DIE+++ +L       +H+++ E+ KPE +A LIA SI
Sbjct: 61  AKNARITIYSSRPGVVIGKKGEDIEQLKTELQRRMGVPVHVNIEEIRKPETDAQLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLERR++FRRAMKRA+Q+AMR GA G+K++++GRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 TQQLERRIMFRRAMKRAMQNAMRLGAQGIKIMSAGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTI--PAAEHRVVEKDS 227
            IDY T+ A+T YG  G+KV+V   D +  +D+ +    AE +   +++
Sbjct: 181 DIDYATSEAKTTYGIIGVKVWVYKGDTLGRNDAPVVEEVAEDKRPRRNA 229


>gi|330430095|gb|AEC21429.1| 30S ribosomal protein S3 [Pusillimonas sp. T7-7]
          Length = 267

 Score =  269 bits (689), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 121/218 (55%), Positives = 163/218 (74%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+PI FRL VN  W+SRW+A    +G +L ED+++REYL+  LK A V +++IER 
Sbjct: 1   MGQKIHPIGFRLAVNRNWSSRWYADDKAFGGMLAEDIRVREYLKKKLKSASVGRVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI VYSARPG++IGK+G DIE ++  L  +    +H+++ E+ KPE +A LIA SI
Sbjct: 61  AKNARITVYSARPGVVIGKRGEDIENLKADLQRLMGVPVHVNIEEIRKPETDAQLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLE+R++FRRAMKRA+Q+AMR GA G+K+++SGRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLEKRIMFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAA 218
           +IDYGT+ A+T YG  GIKV+V   D + + +     A
Sbjct: 181 NIDYGTSEAQTTYGIIGIKVWVYKGDMLPNGELPPETA 218


>gi|317494336|ref|ZP_07952750.1| ribosomal protein S3 [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316917586|gb|EFV38931.1| ribosomal protein S3 [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 233

 Score =  269 bits (689), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 112/230 (48%), Positives = 157/230 (68%), Gaps = 4/230 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS WFA   E+   L  D K+R++L   L +A V++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQFLTKELAKASVSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+RK ++++      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQINIAEVRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
             QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 TSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD----SDSTIPAAEHRVVEKD 226
            IDY T+ A T YG  G+KV++   + +           PAA+ +  ++ 
Sbjct: 181 DIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEKPAAQPKKQQRK 230


>gi|83591270|ref|YP_431279.1| 30S ribosomal protein S3 [Moorella thermoacetica ATCC 39073]
 gi|123766691|sp|Q2RFQ3|RS3_MOOTA RecName: Full=30S ribosomal protein S3
 gi|83574184|gb|ABC20736.1| SSU ribosomal protein S3P [Moorella thermoacetica ATCC 39073]
          Length = 219

 Score =  269 bits (689), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 107/211 (50%), Positives = 153/211 (72%), Gaps = 1/211 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   W+SRW+A G EY  LLHEDLKIRE+++  L QAG+A + IER 
Sbjct: 1   MGQKVHPKGLRLGIIRDWDSRWYA-GKEYKTLLHEDLKIREFIKKRLYQAGIASVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               ++IV +A+PG++IG+ G ++E +RK L  +T  +++L++ E+ KPE+NA L+A+++
Sbjct: 60  ANRIKVIVNTAKPGIVIGRGGAEVEALRKDLERLTGKQVNLNIAEIKKPELNAQLVAENV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLE+R+ FRRAMK+AV  AMR GA G+K+   GRL GAE++RTE Y EG+VPL TLRA
Sbjct: 120 AAQLEKRIAFRRAMKQAVGRAMRLGAQGIKIACGGRLAGAEIARTEWYSEGKVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDS 211
            IDYG A A T YG  G+KV++   + + + 
Sbjct: 180 DIDYGFAEANTTYGKIGVKVWIYKGEVLPER 210


>gi|257791918|ref|YP_003182524.1| 30S ribosomal protein S3 [Eggerthella lenta DSM 2243]
 gi|317489924|ref|ZP_07948416.1| ribosomal protein S3 [Eggerthella sp. 1_3_56FAA]
 gi|325829995|ref|ZP_08163453.1| ribosomal protein S3 [Eggerthella sp. HGA1]
 gi|257475815|gb|ACV56135.1| ribosomal protein S3 [Eggerthella lenta DSM 2243]
 gi|316910922|gb|EFV32539.1| ribosomal protein S3 [Eggerthella sp. 1_3_56FAA]
 gi|325488162|gb|EGC90599.1| ribosomal protein S3 [Eggerthella sp. HGA1]
          Length = 237

 Score =  269 bits (689), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 113/219 (51%), Positives = 150/219 (68%), Gaps = 1/219 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P  FRLG+   W SRW+A   +Y   L  DL IR++L   L +A V+KI IER 
Sbjct: 1   MGQKVSPTGFRLGITEEWRSRWYAD-KDYAKNLANDLAIRKFLDKQLARAAVSKIEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               +IIV +ARPG++IGKKG +I+ +RKKL  + N  + + V EV +PE++A LIAQS+
Sbjct: 60  GDKIKIIVTTARPGVVIGKKGAEIDSLRKKLEKVANGPVSIEVVEVKRPELDAALIAQSV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE RV FRRAM++AVQSA + GA G+++  SGRL GAE+SR E Y EGRVPL TLRA
Sbjct: 120 AEQLEGRVAFRRAMRKAVQSARKSGAKGIRIQCSGRLGGAEMSRREWYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
            IDYG A A T  GS G++V+V   + +    +  PA E
Sbjct: 180 KIDYGFATAATTMGSIGVQVWVYHGEVLPGQKAPQPALE 218


>gi|330447031|ref|ZP_08310681.1| ribosomal protein S3 [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328491222|dbj|GAA05178.1| ribosomal protein S3 [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 229

 Score =  269 bits (688), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 110/227 (48%), Positives = 154/227 (67%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WN+ WFA   E+   L  D K+R++L   L +A +++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNTTWFANSQEFADNLDGDFKVRQFLTKELAKASLSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  ++ +      +++ EV KPE++  L+A SI
Sbjct: 61  AKSIRVTIHTARPGVVIGKKGEDVEKLRAAVAKIAGVPAQINIAEVRKPELDGQLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDY T+ A T YG  G+KV++   + +       P AE    ++ S
Sbjct: 181 DIDYATSSAHTQYGVIGVKVWIFKGEVLGGMPVEEPKAEKPKKQRKS 227


>gi|332107872|gb|EGJ09096.1| 30S ribosomal protein S3 [Rubrivivax benzoatilyticus JA2]
          Length = 289

 Score =  269 bits (688), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 115/220 (52%), Positives = 160/220 (72%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V   W SRWFA    +  +L EDL++R+YL+  LK A V++ILIER 
Sbjct: 1   MGQKIHPTGFRLSVTRAWGSRWFASNRNFAGMLAEDLQVRDYLKTKLKNAAVSRILIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI ++SARPG++IGKKG DIE ++ +L+      + +++ EV KPE++A LIA SI
Sbjct: 61  AKNARITIFSARPGVVIGKKGEDIENLKAELTKRLGVPVAVNIEEVRKPEVDAQLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLE+R++FRRAMKRA+Q+AMR GA G+K++++GRLNG E++RTE Y EGRVPL TL+A
Sbjct: 121 TQQLEKRIMFRRAMKRAMQNAMRLGAQGIKIMSAGRLNGIEIARTEWYREGRVPLHTLKA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEH 220
            IDYG + A+T YG  G+KV+V   D +++ ++   A   
Sbjct: 181 DIDYGFSEAKTTYGVIGVKVWVYRGDRLANGEAPQLAKTE 220


>gi|89902549|ref|YP_525020.1| 30S ribosomal protein S3 [Rhodoferax ferrireducens T118]
 gi|122996738|sp|Q21RW4|RS3_RHOFD RecName: Full=30S ribosomal protein S3
 gi|89347286|gb|ABD71489.1| SSU ribosomal protein S3P [Rhodoferax ferrireducens T118]
          Length = 298

 Score =  269 bits (688), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 120/224 (53%), Positives = 165/224 (73%), Gaps = 2/224 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL ++  W SRW+A   ++  +L ED+K+REYL+  LK A V+++LIER 
Sbjct: 1   MGQKIHPTGFRLSISRNWASRWYANDRDFAGMLAEDIKVREYLKAKLKNASVSRVLIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI ++SARPG++IGKKG DIE ++++LS      + +++ EV KPEI+A LIA SI
Sbjct: 61  AKNARITIFSARPGVVIGKKGEDIENLKRELSRQLGVPVAVNIEEVRKPEIDAKLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLE+R++FRRAMKRA+Q+AMR GA G+K+++SGRLNG E++R E Y EGRVPL TLRA
Sbjct: 121 TQQLEKRIMFRRAMKRAMQNAMRLGALGIKIMSSGRLNGIEIARCEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVE 224
            IDYGT+ A+T YG  G+KV+V   D +  +D  +PAA     +
Sbjct: 181 DIDYGTSEAQTTYGIIGVKVWVYKGDTLGRND--LPAAVEARTD 222


>gi|226329487|ref|ZP_03805005.1| hypothetical protein PROPEN_03396 [Proteus penneri ATCC 35198]
 gi|225202673|gb|EEG85027.1| hypothetical protein PROPEN_03396 [Proteus penneri ATCC 35198]
          Length = 224

 Score =  269 bits (688), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 112/220 (50%), Positives = 157/220 (71%), Gaps = 1/220 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS W+A  +E+   L  D K+R+YL   L +A V++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNSTWYAGTNEFADNLDSDFKVRQYLTKELAKASVSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+RK ++++      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRKNVADIAGVPAQINIAEVRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
             QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 TSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEH 220
            IDY T+ A+T YG  G+KV++  + E+    + +  AE 
Sbjct: 181 DIDYNTSEAQTTYGVLGVKVWIF-KGEILGGMAAVEQAEK 219


>gi|326385093|ref|ZP_08206763.1| 30S ribosomal protein S3 [Gordonia neofelifaecis NRRL B-59395]
 gi|326196178|gb|EGD53382.1| 30S ribosomal protein S3 [Gordonia neofelifaecis NRRL B-59395]
          Length = 267

 Score =  269 bits (688), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 105/222 (47%), Positives = 147/222 (66%), Gaps = 2/222 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP  FRLG+   WNSRW+A   +Y   + ED+ IR+ L   L++AG++K+ IERT
Sbjct: 1   MGQKINPHGFRLGITTDWNSRWYAD-KQYAEYVKEDVAIRKLLSTGLERAGISKVEIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG++G + ++IR  L  +T  ++ L++ EV  PE +A L+AQ +
Sbjct: 60  RDRVRVDIHTARPGIVIGRRGAEADRIRGDLEKLTGKQVQLNILEVKNPEADAQLVAQGV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAM-RFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           A+QL  RV FRRAM++A+QSAM + G  G++V  SGRL GAE+SR E Y EGRVPL TLR
Sbjct: 120 AEQLSNRVAFRRAMRKAIQSAMRQPGVKGIRVQCSGRLGGAEMSRKEFYREGRVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHR 221
           A IDYG   A T +G  G+KV++   D V        AA   
Sbjct: 180 ADIDYGLYEARTTFGRIGVKVWIYKGDIVGGRRELAAAAPAE 221


>gi|319787919|ref|YP_004147394.1| ribosomal protein S3 [Pseudoxanthomonas suwonensis 11-1]
 gi|317466431|gb|ADV28163.1| ribosomal protein S3 [Pseudoxanthomonas suwonensis 11-1]
          Length = 242

 Score =  269 bits (688), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 118/226 (52%), Positives = 158/226 (69%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K++P   RLG+   WNS+W+A   EY   L  DLK+R+ L+  L QAG+++ILIER 
Sbjct: 1   MGHKVHPTGIRLGIAKDWNSKWYAGKGEYADYLAADLKVRKMLRKKLAQAGISRILIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K  R+ +++ARPG++IGK+G DIEK+RK++S M     H++V+EV KPE++A L+A+SI
Sbjct: 61  AKTARVTIHTARPGVVIGKRGEDIEKLRKEVSEMMGVPAHINVSEVRKPELDAQLVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERR++FRRAMKRAV +AMR GA G+KV  +GRLNGAE++R+E Y EGRVPL TLRA
Sbjct: 121 AQQLERRIMFRRAMKRAVGNAMRLGALGIKVNVAGRLNGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            IDYG A A T YG  GIKV+V   +    +       E     + 
Sbjct: 181 DIDYGFAEAHTTYGVIGIKVWVYKGEIFDFAQVGQEKQEEASSPRG 226


>gi|326793564|ref|YP_004311384.1| ribosomal protein S3 [Marinomonas mediterranea MMB-1]
 gi|326544328|gb|ADZ89548.1| ribosomal protein S3 [Marinomonas mediterranea MMB-1]
          Length = 226

 Score =  269 bits (688), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 112/227 (49%), Positives = 154/227 (67%), Gaps = 2/227 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+     S W+A    Y  LL  DL++R+YL+  L QA V++I I+R 
Sbjct: 1   MGQKVHPTGIRLGIVKDHTSTWYANNQNYSKLLLNDLQVRKYLEEKLVQASVSRIEIQRP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +  RI +++ARPG++IGKKG D+EK+R  +S M    +H+++ E+ KPE+++ L+AQ+I
Sbjct: 61  AQTARITIHTARPGIVIGKKGEDVEKLRNAVSKMMGVPVHINIEEIRKPELDSKLVAQNI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AGQLERRVMFRRAMKRAVQNAMRAGAKGIKVQVSGRLGGAEIARAEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDY T  A T YG  G+KV++   + +   +     AE    +K S
Sbjct: 181 DIDYATYEASTTYGIIGVKVWIFKGEILGGIEQV--RAEKGAQKKKS 225


>gi|304399285|ref|ZP_07381151.1| ribosomal protein S3 [Pantoea sp. aB]
 gi|308188351|ref|YP_003932482.1| 30S ribosomal protein S3 [Pantoea vagans C9-1]
 gi|304353211|gb|EFM17592.1| ribosomal protein S3 [Pantoea sp. aB]
 gi|308058861|gb|ADO11033.1| 30S ribosomal protein S3 [Pantoea vagans C9-1]
          Length = 232

 Score =  269 bits (688), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 111/229 (48%), Positives = 157/229 (68%), Gaps = 3/229 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS WFA  +E+   L  D K+R++L   L +A V++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNSTWFANTNEFADNLDSDFKVRQFLTKELAKASVSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  ++ +      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRTVVAKIAGVPAQINIAEVRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
             QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 TSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDS---DSTIPAAEHRVVEKD 226
            IDY T+ A T YG  G+KV++   + +      +   PAA+ +  ++ 
Sbjct: 181 DIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEPAAQPKKQQRK 229


>gi|183600747|ref|ZP_02962240.1| hypothetical protein PROSTU_04341 [Providencia stuartii ATCC 25827]
 gi|188019725|gb|EDU57765.1| hypothetical protein PROSTU_04341 [Providencia stuartii ATCC 25827]
          Length = 233

 Score =  269 bits (688), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 112/230 (48%), Positives = 160/230 (69%), Gaps = 4/230 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS W+A  +E+   L  D K+R+YL   L +A +++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNSTWYANTNEFADNLDSDYKVRQYLNKELAKASISRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+RK ++++      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRKTVADIAGVPAQINIAEVRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD----SDSTIPAAEHRVVEKD 226
            IDY T+ A T YG  G+KV++   + +        +  PAA+ +  ++ 
Sbjct: 181 DIDYNTSEAHTTYGVLGVKVWIFKGEILGGMAAVEQAEKPAAQPKKQQRK 230


>gi|121997643|ref|YP_001002430.1| 30S ribosomal protein S3 [Halorhodospira halophila SL1]
 gi|152060865|sp|A1WVB6|RS3_HALHL RecName: Full=30S ribosomal protein S3
 gi|121589048|gb|ABM61628.1| SSU ribosomal protein S3P [Halorhodospira halophila SL1]
          Length = 228

 Score =  269 bits (688), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 108/223 (48%), Positives = 155/223 (69%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K +P  FRLGV   W S W+A  S +G  L+ DL++RE+++  LK A V++I IER 
Sbjct: 1   MGNKTHPTGFRLGVTEDWRSMWYADSSNFGKYLNTDLEVREFIRERLKNASVSRIQIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN  + +++ARPG++IGKKG DI+++R +++      +H+++ E+ KPE ++ L+A+SI
Sbjct: 61  AKNALVTIHTARPGIVIGKKGEDIDRLRGEVAARMGVPVHINIEEIRKPEADSKLVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRA+KRAV +A R GA G+KV  SGRLNG+E++RTE Y EGRVPL TLRA
Sbjct: 121 AGQLERRVMFRRALKRAVGNAQRVGAQGIKVQVSGRLNGSEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVV 223
            IDYG A A+T YG  G+KV++   + +   +   PA   +  
Sbjct: 181 DIDYGFAEAKTTYGVIGVKVWIFKGEIIDTENEGAPAERVKRA 223


>gi|163859267|ref|YP_001633565.1| 30S ribosomal protein S3 [Bordetella petrii DSM 12804]
 gi|226697669|sp|A9IIZ1|RS3_BORPD RecName: Full=30S ribosomal protein S3
 gi|163262995|emb|CAP45298.1| 30S ribosomal protein S3 [Bordetella petrii]
          Length = 263

 Score =  269 bits (688), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 119/218 (54%), Positives = 163/218 (74%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V   W+SRWFA    +G++L ED+++REYL+  LK A V +++IER 
Sbjct: 1   MGQKIHPTGFRLAVTRNWSSRWFADDKAFGSMLAEDIRVREYLKKKLKSASVGRVIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI VYSARPG++IGK+G DIE ++  L  +    +H+++ E+ KPE +A LIA SI
Sbjct: 61  AKNARITVYSARPGVVIGKRGEDIESLKADLQRLMGVPVHVNIEEIRKPETDAQLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           +QQLE+R++FRRAMKRA+Q+AMR GA G+K+++SGRLNG E++RTE Y EGRVPL TL+A
Sbjct: 121 SQQLEKRIMFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGIEIARTEWYREGRVPLHTLKA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAA 218
           +IDYGT+ A T YG  GIKV+V   D +++ +    AA
Sbjct: 181 NIDYGTSEAHTTYGVIGIKVWVYKGDMLANGELPPEAA 218


>gi|320540603|ref|ZP_08040253.1| 30S ribosomal subunit protein S3 [Serratia symbiotica str. Tucson]
 gi|320029534|gb|EFW11563.1| 30S ribosomal subunit protein S3 [Serratia symbiotica str. Tucson]
          Length = 232

 Score =  269 bits (688), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 111/229 (48%), Positives = 158/229 (68%), Gaps = 3/229 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS W+A   E+   L  D K+R++L   L +A V++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNSTWYANTKEFADNLDSDFKVRQFLAKELAKASVSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+RK ++++      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQINIAEVRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
             QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 TSQLERRVMFRRAMKRAVQNAMRLGAKGIKVDVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDS---DSTIPAAEHRVVEKD 226
            IDY T+ A T YG  G+KV++   + +      +   PAA+ +  ++ 
Sbjct: 181 DIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEPAAQPKKQQRK 229


>gi|86158363|ref|YP_465148.1| SSU ribosomal protein S3P [Anaeromyxobacter dehalogenans 2CP-C]
 gi|123723040|sp|Q2IJ82|RS3_ANADE RecName: Full=30S ribosomal protein S3
 gi|85774874|gb|ABC81711.1| SSU ribosomal protein S3P [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 224

 Score =  269 bits (688), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 108/209 (51%), Positives = 155/209 (74%), Gaps = 1/209 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI FRLGV  +W+S+W+     Y   LHED+K+RE+++  L QAG+++I IER 
Sbjct: 1   MGQKVHPIGFRLGVIRSWDSKWY-EEKNYAKWLHEDIKLREFVKEKLGQAGISRIEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               +I V++ARPG++IGK+G  IE I+K L  +T++E++L+V EV K E +A L+A++I
Sbjct: 60  ANKVKINVHTARPGIVIGKRGAGIETIKKDLQGLTDNEVYLNVVEVRKAETDAQLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERR+ FRRAMK++VQ+A++FGA G++V  SGRL G+E++R E Y EGRVPL TLRA
Sbjct: 120 ATQLERRIAFRRAMKKSVQTALKFGAKGIRVACSGRLGGSEMARYEWYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVS 209
            IDYG A A+T YG  G KV++   + + 
Sbjct: 180 DIDYGFAEAKTTYGKIGCKVWIMRGEVLP 208


>gi|253998020|ref|YP_003050083.1| 30S ribosomal protein S3 [Methylovorus sp. SIP3-4]
 gi|313200087|ref|YP_004038745.1| 30S ribosomal protein S3 [Methylovorus sp. MP688]
 gi|253984699|gb|ACT49556.1| ribosomal protein S3 [Methylovorus sp. SIP3-4]
 gi|312439403|gb|ADQ83509.1| ribosomal protein S3 [Methylovorus sp. MP688]
          Length = 237

 Score =  269 bits (688), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 125/229 (54%), Positives = 166/229 (72%), Gaps = 3/229 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V   W+SRW+A    + A+L+ D+K+R++L+  L  A V+KI+IER 
Sbjct: 1   MGQKIHPFGFRLSVQKNWSSRWYANSKNFPAMLNSDIKVRDFLKKKLSHAAVSKIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN +I +YSARPG++IGKKG DIE +R  L  +    +HL++ EV KPEI+ATLIA+SI
Sbjct: 61  AKNAKITIYSARPGVVIGKKGEDIESLRSSLQGLMGVPVHLNIEEVRKPEIDATLIAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLE+RV+FRRAMKRA+Q+AMR GA G+K+++SGRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLEKRVMFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVS---DSDSTIPAAEHRVVEKD 226
            IDYG A A+T YG  GIKV+V   +      +  + +PA   + V K 
Sbjct: 181 DIDYGVAEAKTTYGIIGIKVWVFKGEVFGTHAEQQAAVPAEPEKKVRKS 229


>gi|197122345|ref|YP_002134296.1| ribosomal protein S3 [Anaeromyxobacter sp. K]
 gi|220917127|ref|YP_002492431.1| ribosomal protein S3 [Anaeromyxobacter dehalogenans 2CP-1]
 gi|226697661|sp|B4UBA5|RS3_ANASK RecName: Full=30S ribosomal protein S3
 gi|254764508|sp|B8J866|RS3_ANAD2 RecName: Full=30S ribosomal protein S3
 gi|196172194|gb|ACG73167.1| ribosomal protein S3 [Anaeromyxobacter sp. K]
 gi|219954981|gb|ACL65365.1| ribosomal protein S3 [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 224

 Score =  269 bits (688), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 108/209 (51%), Positives = 155/209 (74%), Gaps = 1/209 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI FRLGV  +W+S+W+     Y   LHED+K+RE+++  L QAG+++I IER 
Sbjct: 1   MGQKVHPIGFRLGVIRSWDSKWY-EEKNYAKWLHEDIKLREFVKEKLGQAGISRIEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               +I V++ARPG++IGK+G  IE I+K L  +T++E++L+V EV K E +A L+A++I
Sbjct: 60  ANKVKINVHTARPGIVIGKRGAGIETIKKDLQGLTDNEVYLNVVEVRKAETDAQLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERR+ FRRAMK++VQ+A++FGA G++V  SGRL G+E++R E Y EGRVPL TLRA
Sbjct: 120 ATQLERRIAFRRAMKKSVQTALKFGAKGIRVACSGRLGGSEMARYEWYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVS 209
            IDYG A A+T YG  G KV++   + + 
Sbjct: 180 DIDYGFAEAKTTYGKIGCKVWIMRGEVLP 208


>gi|330432118|gb|AEC17177.1| 30S ribosomal protein S3 [Gallibacterium anatis UMN179]
          Length = 235

 Score =  269 bits (688), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 107/225 (47%), Positives = 155/225 (68%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   W+S W+A   ++   L  D K+R++L   L  A V++I IER 
Sbjct: 1   MGQKVHPHGIRLGIVKPWSSTWYANTQDFADNLDGDFKVRKFLTKELANASVSRITIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  ++ +      +++ EV KPE++A L+A+SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRNAVAAIAGVPAQINIAEVKKPELDAKLVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDY TA A T YG  G+KV++   + +    + + + + +  +K
Sbjct: 181 DIDYNTAEANTTYGVIGVKVWIFKGEILGGMAAVMQSEQQQPADK 225


>gi|54022706|ref|YP_116948.1| 30S ribosomal protein S3 [Nocardia farcinica IFM 10152]
 gi|61215424|sp|Q5Z1V7|RS3_NOCFA RecName: Full=30S ribosomal protein S3
 gi|54014214|dbj|BAD55584.1| putative ribosomal protein S3 [Nocardia farcinica IFM 10152]
          Length = 267

 Score =  269 bits (688), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 102/219 (46%), Positives = 148/219 (67%), Gaps = 2/219 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP  FRLG+   W SRW+A   +Y   + ED+ IR+ L   +++AG++K+ IERT
Sbjct: 1   MGQKINPHGFRLGITTDWKSRWYAD-KQYADYVKEDVAIRKLLATGMERAGISKVEIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG++G + ++IR +L  +T  ++ L++ EV  PE +A L+AQ +
Sbjct: 60  RDRVRVDIHTARPGIVIGRRGAEADRIRAELEKLTGKQVQLNILEVKNPESDAQLVAQGV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMR-FGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           A+QL  RV FRRAM++A+QSAMR     G++V  SGRL GAE+SR+E Y EGRVPL TLR
Sbjct: 120 AEQLSNRVAFRRAMRKAIQSAMRSPNVKGIRVQCSGRLGGAEMSRSEFYREGRVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAA 218
           A IDYG   A+T +G  G+KV++   D V        A+
Sbjct: 180 ADIDYGLYEAKTTFGRIGVKVWIYKGDIVGGKRELTAAS 218


>gi|50122945|ref|YP_052112.1| 30S ribosomal protein S3 [Pectobacterium atrosepticum SCRI1043]
 gi|61215521|sp|Q6CZX6|RS3_ERWCT RecName: Full=30S ribosomal protein S3
 gi|49613471|emb|CAG76922.1| 30S ribosomal subunit protein S3 [Pectobacterium atrosepticum
           SCRI1043]
          Length = 233

 Score =  269 bits (688), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 111/230 (48%), Positives = 158/230 (68%), Gaps = 4/230 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS W+A   E+   L  D K+R+YL   L++A V++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNSTWYANTKEFADNLDSDFKVRKYLTKELEKASVSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+RK ++++      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQINIAEVRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
             QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 TSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD----SDSTIPAAEHRVVEKD 226
            IDY T+ A T YG  G+KV++   + +           P+A+ +  ++ 
Sbjct: 181 DIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEKPSAQPKKQQRK 230


>gi|329298527|ref|ZP_08255863.1| 30S ribosomal protein S3 [Plautia stali symbiont]
          Length = 232

 Score =  269 bits (688), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 111/229 (48%), Positives = 156/229 (68%), Gaps = 3/229 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS WFA   E+   L  D K+R++L   L +A V++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNSTWFANTEEFADNLDSDFKVRQFLNKELAKASVSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARP ++IGKKG D+EK+R  ++N+      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPAIVIGKKGEDVEKLRTVVANIAGVPAQINIAEVRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
             QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 TSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDS---DSTIPAAEHRVVEKD 226
            IDY T+ A T YG  G+KV++   + +      +   PAA+ +  ++ 
Sbjct: 181 DIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEPAAQPKKQQRK 229


>gi|126736606|ref|ZP_01752346.1| ribosomal protein S3 [Roseobacter sp. CCS2]
 gi|126713919|gb|EBA10790.1| ribosomal protein S3 [Roseobacter sp. CCS2]
          Length = 233

 Score =  269 bits (688), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 123/227 (54%), Positives = 172/227 (75%), Gaps = 1/227 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K+NPI  RL VN TW+SRW+A   +YG LL EDL+I+++++    Q+GV++++IER 
Sbjct: 1   MGNKVNPIGMRLQVNRTWDSRWYADTKDYGDLLLEDLRIKDFIKKECAQSGVSRVIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ +++ARPG+IIGKKG DIE +RKKL+ +T+SE+HL++ EV KPE++A L+A+SI
Sbjct: 61  HKKCRVTIHAARPGVIIGKKGADIEGLRKKLAALTDSELHLNIVEVRKPELDAALVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLERRV FRRAMKR+VQ+AMR GA G++V  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 GQQLERRVSFRRAMKRSVQNAMRMGALGIRVNLAGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDY    A T YG  GIKV++  + E+ + D +    +H  +++ +
Sbjct: 181 DIDYALYEAMTPYGIIGIKVFIY-KGEIMEHDPSAHDRKHAELQEGA 226


>gi|94500987|ref|ZP_01307512.1| ribosomal protein S3 [Oceanobacter sp. RED65]
 gi|94426927|gb|EAT11910.1| ribosomal protein S3 [Oceanobacter sp. RED65]
          Length = 230

 Score =  269 bits (688), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 104/226 (46%), Positives = 154/226 (68%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+    NS W+A    Y   L  D+++R  ++  L++A V+K+ IER 
Sbjct: 1   MGQKVHPTGIRLGITKDHNSVWYAGKDTYADQLLTDIQVRSMIEKRLEKASVSKVTIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +  +I +++ARPG++IGKKG D++ +RK +++M    +HL++ E+ KP+++A L+AQS+
Sbjct: 61  AQTAKITIHTARPGIVIGKKGEDVDALRKDVADMMGIPVHLNIEEIRKPDLDAKLVAQSV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA+G+K+   GRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ANQLERRVMFRRAMKRAVQNAMRGGAEGIKIQVGGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            IDY T  A T YG  G+KV++   + +   D     A+    +K 
Sbjct: 181 DIDYATYEAHTTYGVIGVKVWIFKGEILGGIDEVRARAKSGGAKKQ 226


>gi|52308149|gb|AAU38649.1| RpsC protein [Mannheimia succiniciproducens MBEL55E]
          Length = 246

 Score =  269 bits (687), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 110/230 (47%), Positives = 152/230 (66%), Gaps = 6/230 (2%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   RLG+   W+S WFA   ++ + L  D K+R++L   L  A V++I IER 
Sbjct: 12  MGQKVNPHGIRLGIVKPWSSTWFANTQDFASNLDGDFKVRKFLNKELANASVSRITIERP 71

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  ++ +      +++ EV KPE++A L+A SI
Sbjct: 72  AKSIRVTIHTARPGIVIGKKGEDVEKLRNAVAKIAGVPAQINIAEVKKPELDAKLVADSI 131

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++R+E Y EGRVPL TLRA
Sbjct: 132 ASQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARSEWYREGRVPLHTLRA 191

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD------SDSTIPAAEHRVVE 224
            IDY T+ A T YG  G+KV++   + +             PAA  +   
Sbjct: 192 DIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAIAQQPEQQPAAPKKAPR 241


>gi|292492427|ref|YP_003527866.1| ribosomal protein S3 [Nitrosococcus halophilus Nc4]
 gi|291581022|gb|ADE15479.1| ribosomal protein S3 [Nitrosococcus halophilus Nc4]
          Length = 223

 Score =  269 bits (687), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 109/217 (50%), Positives = 156/217 (71%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS+W+A  S++  LL+ DL +R +L   L  A V+ I I+R 
Sbjct: 1   MGQKVHPTGIRLGIVKDWNSKWYADSSQFSDLLNNDLGVRSHLTKKLSHALVSNIQIDRP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +N RI +++ARPG++IGKKG DI  +R+++S M    +H+++ E+ KPE++ATL+A ++
Sbjct: 61  ARNARITIHTARPGIVIGKKGEDINNLRQEVSEMMGIPVHINIQEIRKPELDATLVAANV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERR++FRRAMKRAV +AMR GA G+++  SGRLNGAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRIMFRRAMKRAVTNAMRVGAQGIRIKVSGRLNGAEIARNEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPA 217
           +IDYG A A+T YG  G+KV++   +     D  + A
Sbjct: 181 NIDYGFAEAKTTYGVLGVKVWIFKGEVFEQPDQQVTA 217


>gi|258543827|ref|ZP_05704061.1| 30S ribosomal protein S3 [Cardiobacterium hominis ATCC 15826]
 gi|258520916|gb|EEV89775.1| 30S ribosomal protein S3 [Cardiobacterium hominis ATCC 15826]
          Length = 245

 Score =  269 bits (687), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 107/227 (47%), Positives = 157/227 (69%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI FRLGV+  W S+W+A G +Y   L +D ++RE+++  L  A V++I IER 
Sbjct: 6   MGQKVHPIGFRLGVSKDWVSKWYAEGKDYANFLEKDFEVREFIRKKLAHASVSQIQIERP 65

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               +I +++ARPG++IG+KG DIE +++++S++      +++ E+ +PE++A L+A  I
Sbjct: 66  RNGAQITIFTARPGIVIGRKGEDIEVLKQEISSIMGVPTSVNIEEIRRPELDAYLVADGI 125

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLERRV+FRRAMKR+V S MR GA G+KV  +GRLNGAE++RTE Y EGRVPL TLRA
Sbjct: 126 AKQLERRVMFRRAMKRSVASTMRLGAAGIKVSIAGRLNGAEIARTEWYREGRVPLHTLRA 185

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDYG A A T YG  G+KV++   + +   D+          EK +
Sbjct: 186 DIDYGFAEAHTTYGVIGVKVWIFKGENLEGLDANGNVVGEVPEEKRA 232


>gi|167564411|ref|ZP_02357327.1| 30S ribosomal protein S3 [Burkholderia oklahomensis EO147]
 gi|167571557|ref|ZP_02364431.1| 30S ribosomal protein S3 [Burkholderia oklahomensis C6786]
          Length = 266

 Score =  269 bits (687), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 116/229 (50%), Positives = 165/229 (72%), Gaps = 2/229 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V+  W SRW+A  + + A+L ED+ +REYL+  LK A V +++IER 
Sbjct: 1   MGQKIHPTGFRLAVSRNWASRWYANNNNFAAMLQEDIGVREYLKKKLKNASVGRVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI ++S+RPG++IGKKG DIE ++ +L       +H+++ E+ KPE +A LIA SI
Sbjct: 61  AKNARITIFSSRPGVVIGKKGEDIELLKTELQRRMGVPVHVNIEEIRKPETDAQLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLERR++FRRAMKRA+Q+AMR GA G+K++++GRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 TQQLERRIMFRRAMKRAMQNAMRLGAQGIKIMSAGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTI--PAAEHRVVEKDS 227
            IDY T+ A+T YG  G+KV+V   D +  +D+ +    AE +   +++
Sbjct: 181 DIDYATSEAKTTYGVIGVKVWVYKGDTLGRNDAPVVEEVAEDKRPRRNA 229


>gi|27364209|ref|NP_759737.1| 30S ribosomal protein S3 [Vibrio vulnificus CMCP6]
 gi|37678565|ref|NP_933174.1| 30S ribosomal protein S3 [Vibrio vulnificus YJ016]
 gi|320157595|ref|YP_004189974.1| 30S ribosomal protein S3p (S3e) [Vibrio vulnificus MO6-24/O]
 gi|29427440|sp|Q8DE45|RS3_VIBVU RecName: Full=30S ribosomal protein S3
 gi|61215668|sp|Q7MPI2|RS3_VIBVY RecName: Full=30S ribosomal protein S3
 gi|27360327|gb|AAO09264.1| ribosomal protein S3 [Vibrio vulnificus CMCP6]
 gi|37197305|dbj|BAC93145.1| ribosomal protein S3 [Vibrio vulnificus YJ016]
 gi|319932907|gb|ADV87771.1| SSU ribosomal protein S3p (S3e) [Vibrio vulnificus MO6-24/O]
          Length = 233

 Score =  269 bits (687), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 108/224 (48%), Positives = 154/224 (68%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WN+ WFA   ++   L  D K+R++L   L +A +++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNATWFANTKDFADNLDGDFKVRQFLTKELSKASLSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  ++ +      +++ EV KPE++A L+  SI
Sbjct: 61  AKSIRVTIHTARPGVVIGKKGEDVEKLRTAVAKIAGVPAQINIAEVRKPELDAQLVGDSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVE 224
            IDY T+ A T YG  GIKV++   + +    +   AAE +  +
Sbjct: 181 DIDYATSSAHTTYGVIGIKVWIFKGEILGGMPAATEAAEPKADK 224


>gi|270264367|ref|ZP_06192633.1| 30S ribosomal protein S3 [Serratia odorifera 4Rx13]
 gi|270041503|gb|EFA14601.1| 30S ribosomal protein S3 [Serratia odorifera 4Rx13]
          Length = 232

 Score =  269 bits (687), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 111/229 (48%), Positives = 158/229 (68%), Gaps = 3/229 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS W+A   E+   L  D K+R++L   L +A V++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNSTWYANTKEFADNLDSDFKVRQFLIKELAKASVSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+RK ++++      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQINIAEVRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
             QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 TSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDS---DSTIPAAEHRVVEKD 226
            IDY T+ A T YG  G+KV++   + +      +   PAA+ +  ++ 
Sbjct: 181 DIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEPAAQPKKQQRK 229


>gi|33152952|ref|NP_874305.1| 30S ribosomal protein S3 [Haemophilus ducreyi 35000HP]
 gi|61215714|sp|Q7VKD7|RS3_HAEDU RecName: Full=30S ribosomal protein S3
 gi|33149177|gb|AAP96694.1| 30S ribosomal protein S3 [Haemophilus ducreyi 35000HP]
          Length = 234

 Score =  269 bits (687), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 113/232 (48%), Positives = 154/232 (66%), Gaps = 6/232 (2%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS WFA   ++   L  D K+R++L   L  A V++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNSTWFANTQDFADNLDGDFKVRKFLNKELANASVSRIIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  +S +      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRNAVSQIAGVPAQINIAEVKKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDE------VSDSDSTIPAAEHRVVEKD 226
            IDY TA A T YG  G+KV++   +       V +S+    A   +   K 
Sbjct: 181 DIDYNTAEAHTTYGVIGVKVWIFKGEILGGMAAVIESEQQPAAQPKKQARKG 232


>gi|121603126|ref|YP_980455.1| 30S ribosomal protein S3 [Polaromonas naphthalenivorans CJ2]
 gi|152060890|sp|A1VIQ6|RS3_POLNA RecName: Full=30S ribosomal protein S3
 gi|120592095|gb|ABM35534.1| SSU ribosomal protein S3P [Polaromonas naphthalenivorans CJ2]
          Length = 295

 Score =  269 bits (687), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 121/225 (53%), Positives = 164/225 (72%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP  FRL ++  W+SRW+A   ++  +L ED+K+REYL+  LK A V+++LIER 
Sbjct: 1   MGQKINPTGFRLSISRNWSSRWYANNRDFAGMLAEDIKVREYLKKKLKNAAVSRVLIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI ++SARPG++IGKKG DIE ++K+LS      + +++ EV KPEI+A LIA SI
Sbjct: 61  AKNARITIFSARPGVVIGKKGEDIEALKKELSRQLGVPVAVNIEEVRKPEIDAKLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLE+R++FRRAMKRA+Q+AMR GA G+K+++SGRLNG E++R E Y EGRVPL TLRA
Sbjct: 121 TQQLEKRIMFRRAMKRAMQNAMRLGALGIKIMSSGRLNGIEIARCEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDYGT+ A+T YG  G+KV+V   D +  +D T         E+
Sbjct: 181 DIDYGTSEAQTTYGIIGVKVWVYKGDTLGRNDGTGAKMIEVADEE 225


>gi|317401543|gb|EFV82172.1| 30S ribosomal protein S3 [Achromobacter xylosoxidans C54]
          Length = 263

 Score =  269 bits (687), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 117/212 (55%), Positives = 161/212 (75%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V   W+SRWFA    +G++L ED+++REYL+  LK A V +++IER 
Sbjct: 1   MGQKIHPTGFRLAVTRNWSSRWFADDKAFGSMLAEDIRVREYLKKKLKSASVGRVIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI VYSARPG++IGK+G DIE ++  L  +    +H+++ E+ KPE +A LIA SI
Sbjct: 61  AKNARITVYSARPGVVIGKRGEDIESLKADLQRLMGVPVHVNIEEIRKPETDAQLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           +QQLE+R++FRRAMKRA+Q+AMR GA G+K+++SGRLNG E++RTE Y EGRVPL TL+A
Sbjct: 121 SQQLEKRIMFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGIEIARTEWYREGRVPLHTLKA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSD 212
           +IDYGT+ A T YG  GIKV+V   D +++ +
Sbjct: 181 NIDYGTSEAHTTYGVIGIKVWVYKGDMLANGE 212


>gi|89893223|ref|YP_516710.1| 30S ribosomal protein S3 [Desulfitobacterium hafniense Y51]
 gi|123091860|sp|Q250M6|RS3_DESHY RecName: Full=30S ribosomal protein S3
 gi|89332671|dbj|BAE82266.1| 30S ribosomal protein S3 [Desulfitobacterium hafniense Y51]
          Length = 219

 Score =  269 bits (687), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 105/212 (49%), Positives = 150/212 (70%), Gaps = 1/212 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   R+G+   W  RWFA    Y  LLHEDLK+R++++  L+QAGV K+ IER 
Sbjct: 1   MGQKVNPKGLRVGIIRDWEGRWFAD-KNYLELLHEDLKVRKFVKTKLQQAGVPKVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               ++ +++A+PG++IG+ GT++E +RK+L  MT  ++ +++ EV KPE++A L+A+S+
Sbjct: 60  ANRVKVSIHAAKPGIVIGRGGTEVENLRKQLEAMTGKQVAVNIVEVKKPELDAQLVAESV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLE+RV FRRAMK+ VQ  MR G  G+K+  SGRL GAE++RTE Y EG+VPL TLRA
Sbjct: 120 AQQLEKRVSFRRAMKQTVQRTMRQGGQGIKISCSGRLGGAEIARTEWYSEGKVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSD 212
            IDYG A A T YG  G+KV++   + +    
Sbjct: 180 DIDYGFAEANTTYGKIGVKVWIYKGEVLPAKK 211


>gi|238921436|ref|YP_002934951.1| 30S ribosomal protein S3 [Edwardsiella ictaluri 93-146]
 gi|294638046|ref|ZP_06716306.1| ribosomal protein S3 [Edwardsiella tarda ATCC 23685]
 gi|259495245|sp|C5BGL9|RS3_EDWI9 RecName: Full=30S ribosomal protein S3
 gi|238871005|gb|ACR70716.1| 30S ribosomal protein S3, putative [Edwardsiella ictaluri 93-146]
 gi|291088838|gb|EFE21399.1| ribosomal protein S3 [Edwardsiella tarda ATCC 23685]
          Length = 233

 Score =  269 bits (687), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 111/230 (48%), Positives = 157/230 (68%), Gaps = 4/230 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS W+A   E+   L  D K+R++L   L++A V++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNSTWYANTKEFADNLDSDFKVRQFLNKELEKASVSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+RK ++ +      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRKGVAEIAGVPAQINIAEVRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
             QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 TSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD----SDSTIPAAEHRVVEKD 226
            IDY T+ A T YG  G+KV++   + +           PAA+ +  ++ 
Sbjct: 181 DIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEKPAAQPKKQQRK 230


>gi|22127865|ref|NP_671288.1| 30S ribosomal protein S3 [Yersinia pestis KIM 10]
 gi|45440073|ref|NP_991612.1| 30S ribosomal protein S3 [Yersinia pestis biovar Microtus str.
           91001]
 gi|51597982|ref|YP_072173.1| 30S ribosomal protein S3 [Yersinia pseudotuberculosis IP 32953]
 gi|108814013|ref|YP_649780.1| 30S ribosomal protein S3 [Yersinia pestis Nepal516]
 gi|123444092|ref|YP_001008062.1| 30S ribosomal protein S3 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|145597458|ref|YP_001161533.1| 30S ribosomal protein S3 [Yersinia pestis Pestoides F]
 gi|150260737|ref|ZP_01917465.1| 30S ribosomal protein S3 [Yersinia pestis CA88-4125]
 gi|153949533|ref|YP_001402857.1| 30S ribosomal protein S3 [Yersinia pseudotuberculosis IP 31758]
 gi|162419812|ref|YP_001605181.1| 30S ribosomal protein S3 [Yersinia pestis Angola]
 gi|165927901|ref|ZP_02223733.1| ribosomal protein S3 [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|166010543|ref|ZP_02231441.1| ribosomal protein S3 [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166213311|ref|ZP_02239346.1| ribosomal protein S3 [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167419228|ref|ZP_02310981.1| ribosomal protein S3 [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167425626|ref|ZP_02317379.1| ribosomal protein S3 [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|170022550|ref|YP_001719055.1| 30S ribosomal protein S3 [Yersinia pseudotuberculosis YPIII]
 gi|186897178|ref|YP_001874290.1| 30S ribosomal protein S3 [Yersinia pseudotuberculosis PB1/+]
 gi|218927421|ref|YP_002345296.1| 30S ribosomal protein S3 [Yersinia pestis CO92]
 gi|229836303|ref|ZP_04456470.1| 30S ribosomal subunit protein S3 [Yersinia pestis Pestoides A]
 gi|229840073|ref|ZP_04460232.1| 30S ribosomal subunit protein S3 [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229842155|ref|ZP_04462310.1| 30S ribosomal subunit protein S3 [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229904545|ref|ZP_04519656.1| 30S ribosomal subunit protein S3 [Yersinia pestis Nepal516]
 gi|238752681|ref|ZP_04614152.1| 30S ribosomal protein S3 [Yersinia rohdei ATCC 43380]
 gi|238758770|ref|ZP_04619944.1| 30S ribosomal protein S3 [Yersinia aldovae ATCC 35236]
 gi|238763724|ref|ZP_04624683.1| 30S ribosomal protein S3 [Yersinia kristensenii ATCC 33638]
 gi|238783175|ref|ZP_04627201.1| 30S ribosomal protein S3 [Yersinia bercovieri ATCC 43970]
 gi|238788904|ref|ZP_04632694.1| 30S ribosomal protein S3 [Yersinia frederiksenii ATCC 33641]
 gi|238792944|ref|ZP_04636574.1| 30S ribosomal protein S3 [Yersinia intermedia ATCC 29909]
 gi|238797232|ref|ZP_04640733.1| 30S ribosomal protein S3 [Yersinia mollaretii ATCC 43969]
 gi|270488238|ref|ZP_06205312.1| ribosomal protein S3 [Yersinia pestis KIM D27]
 gi|294502294|ref|YP_003566356.1| 30S ribosomal protein S3 [Yersinia pestis Z176003]
 gi|332163253|ref|YP_004299830.1| 30S ribosomal protein S3 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|27734519|sp|Q8ZJA6|RS3_YERPE RecName: Full=30S ribosomal protein S3
 gi|61215489|sp|Q664S7|RS3_YERPS RecName: Full=30S ribosomal protein S3
 gi|123073065|sp|Q1CCV0|RS3_YERPN RecName: Full=30S ribosomal protein S3
 gi|152060915|sp|A1JS29|RS3_YERE8 RecName: Full=30S ribosomal protein S3
 gi|152060916|sp|A4TGZ8|RS3_YERPP RecName: Full=30S ribosomal protein S3
 gi|189045347|sp|A7FNM9|RS3_YERP3 RecName: Full=30S ribosomal protein S3
 gi|226697779|sp|B2K5M4|RS3_YERPB RecName: Full=30S ribosomal protein S3
 gi|226697780|sp|A9R902|RS3_YERPG RecName: Full=30S ribosomal protein S3
 gi|226697781|sp|B1JIW7|RS3_YERPY RecName: Full=30S ribosomal protein S3
 gi|21961000|gb|AAM87539.1|AE014002_12 30S ribosomal subunit protein S3 [Yersinia pestis KIM 10]
 gi|45434928|gb|AAS60489.1| 30S ribosomal protein S3 [Yersinia pestis biovar Microtus str.
           91001]
 gi|51591264|emb|CAH22930.1| 30S ribosomal protein S3 [Yersinia pseudotuberculosis IP 32953]
 gi|108777661|gb|ABG20180.1| SSU ribosomal protein S3P [Yersinia pestis Nepal516]
 gi|115346032|emb|CAL18898.1| 30S ribosomal protein S3 [Yersinia pestis CO92]
 gi|122091053|emb|CAL13936.1| 30S ribosomal protein S3 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|145209154|gb|ABP38561.1| SSU ribosomal protein S3P [Yersinia pestis Pestoides F]
 gi|149290145|gb|EDM40222.1| 30S ribosomal protein S3 [Yersinia pestis CA88-4125]
 gi|152961028|gb|ABS48489.1| ribosomal protein S3 [Yersinia pseudotuberculosis IP 31758]
 gi|162352627|gb|ABX86575.1| ribosomal protein S3 [Yersinia pestis Angola]
 gi|165920177|gb|EDR37478.1| ribosomal protein S3 [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165990633|gb|EDR42934.1| ribosomal protein S3 [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166205609|gb|EDR50089.1| ribosomal protein S3 [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166963222|gb|EDR59243.1| ribosomal protein S3 [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167055316|gb|EDR65110.1| ribosomal protein S3 [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|169749084|gb|ACA66602.1| ribosomal protein S3 [Yersinia pseudotuberculosis YPIII]
 gi|186700204|gb|ACC90833.1| ribosomal protein S3 [Yersinia pseudotuberculosis PB1/+]
 gi|229678663|gb|EEO74768.1| 30S ribosomal subunit protein S3 [Yersinia pestis Nepal516]
 gi|229690465|gb|EEO82519.1| 30S ribosomal subunit protein S3 [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229696439|gb|EEO86486.1| 30S ribosomal subunit protein S3 [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229706371|gb|EEO92378.1| 30S ribosomal subunit protein S3 [Yersinia pestis Pestoides A]
 gi|238698026|gb|EEP90784.1| 30S ribosomal protein S3 [Yersinia kristensenii ATCC 33638]
 gi|238703067|gb|EEP95610.1| 30S ribosomal protein S3 [Yersinia aldovae ATCC 35236]
 gi|238709108|gb|EEQ01355.1| 30S ribosomal protein S3 [Yersinia rohdei ATCC 43380]
 gi|238715971|gb|EEQ07957.1| 30S ribosomal protein S3 [Yersinia bercovieri ATCC 43970]
 gi|238718869|gb|EEQ10684.1| 30S ribosomal protein S3 [Yersinia mollaretii ATCC 43969]
 gi|238722931|gb|EEQ14581.1| 30S ribosomal protein S3 [Yersinia frederiksenii ATCC 33641]
 gi|238727798|gb|EEQ19322.1| 30S ribosomal protein S3 [Yersinia intermedia ATCC 29909]
 gi|262360374|gb|ACY57095.1| 30S ribosomal protein S3 [Yersinia pestis D106004]
 gi|262364326|gb|ACY60883.1| 30S ribosomal protein S3 [Yersinia pestis D182038]
 gi|270336742|gb|EFA47519.1| ribosomal protein S3 [Yersinia pestis KIM D27]
 gi|294352753|gb|ADE63094.1| 30S ribosomal protein S3 [Yersinia pestis Z176003]
 gi|318607738|emb|CBY29236.1| SSU ribosomal protein S3p (S3e) [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|320013348|gb|ADV96919.1| 30S ribosomal subunit protein S3 [Yersinia pestis biovar Medievalis
           str. Harbin 35]
 gi|325667483|gb|ADZ44127.1| 30S ribosomal protein S3 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330861849|emb|CBX72020.1| 30S ribosomal protein S3 [Yersinia enterocolitica W22703]
          Length = 232

 Score =  269 bits (687), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 111/229 (48%), Positives = 158/229 (68%), Gaps = 3/229 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS W+A   E+   L  D K+R++L   L +A V++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKAWNSTWYANTKEFADNLDSDFKVRQFLTKELAKASVSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+RK ++++      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQINIAEVRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
             QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 TSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDS---DSTIPAAEHRVVEKD 226
            IDY T+ A T YG  G+KV++   + +      +   PAA+ +  ++ 
Sbjct: 181 DIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEPAAQPKKQQRK 229


>gi|325529684|gb|EGD06547.1| 30S ribosomal protein S3 [Burkholderia sp. TJI49]
          Length = 266

 Score =  269 bits (687), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 116/229 (50%), Positives = 166/229 (72%), Gaps = 2/229 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V+  W SRW+A  + + A+L ED+ +REYL+  LK A V +++IER 
Sbjct: 1   MGQKIHPTGFRLAVSRNWASRWYANNNNFAAMLQEDIGVREYLKKKLKNASVGRVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI ++S+RPG++IGKKG DIE+++ +L       +H+++ E+ KPE +A LIA SI
Sbjct: 61  AKNARITIFSSRPGVVIGKKGEDIEQLKTELQRRMGVPVHVNIEEIRKPETDAQLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLERR++FRRAMKRA+Q+AMR GA G+K++++GRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 TQQLERRIMFRRAMKRAMQNAMRLGAQGIKIMSAGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTI--PAAEHRVVEKDS 227
            IDY T+ A+T YG  G+KV+V   D +  +D+ +    AE +   +++
Sbjct: 181 DIDYATSEAKTTYGIIGVKVWVYKGDTLGRNDAPVVEEVAEDKRPRRNA 229


>gi|212708987|ref|ZP_03317115.1| hypothetical protein PROVALCAL_00019 [Providencia alcalifaciens DSM
           30120]
 gi|261346929|ref|ZP_05974573.1| ribosomal protein S3 [Providencia rustigianii DSM 4541]
 gi|212688353|gb|EEB47881.1| hypothetical protein PROVALCAL_00019 [Providencia alcalifaciens DSM
           30120]
 gi|282564994|gb|EFB70529.1| ribosomal protein S3 [Providencia rustigianii DSM 4541]
          Length = 233

 Score =  269 bits (687), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 111/230 (48%), Positives = 160/230 (69%), Gaps = 4/230 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS W+A  +E+   L  D K+R+YL   L +A +++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNSTWYANTNEFADNLDSDFKVRQYLNKELAKASISRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+RK ++++      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRKTVADIAGVPAQINIAEVRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           + QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 SSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD----SDSTIPAAEHRVVEKD 226
            IDY T+ A T YG  G+KV++   + +        +  PAA+ +  ++ 
Sbjct: 181 DIDYNTSEAHTTYGVLGVKVWIFKGEILGGMAAVEQAEKPAAQPKKQQRK 230


>gi|256821668|ref|YP_003145631.1| 30S ribosomal protein S3 [Kangiella koreensis DSM 16069]
 gi|256795207|gb|ACV25863.1| ribosomal protein S3 [Kangiella koreensis DSM 16069]
          Length = 233

 Score =  268 bits (686), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 107/226 (47%), Positives = 153/226 (67%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+     + W+A   ++   L  D+ IR++L   LK A ++++ IER 
Sbjct: 1   MGQKVHPTGIRLGIVKKHTATWYAERGDFADYLESDINIRKWLFKELKNASISRVDIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K  R+ +++ARPG++IGKKG DIEK+R K++NM      +SV +V KPE++A L+  ++
Sbjct: 61  AKAIRVTIHTARPGIVIGKKGEDIEKLRAKIANMAGVSAQVSVEQVRKPELDAQLVGDNV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV+FRRAMKRAVQ+AMR GA+G+K+  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVMFRRAMKRAVQNAMRLGAEGIKIEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            IDY T+ A T YG  GIKV++   + +   +   P  + +   + 
Sbjct: 181 DIDYATSEALTTYGIIGIKVWIFKGEVLPGQEKVEPKEDKKPRRRK 226


>gi|260772102|ref|ZP_05881019.1| SSU ribosomal protein S3p (S3e) [Vibrio metschnikovii CIP 69.14]
 gi|260612969|gb|EEX38171.1| SSU ribosomal protein S3p (S3e) [Vibrio metschnikovii CIP 69.14]
          Length = 232

 Score =  268 bits (686), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 108/224 (48%), Positives = 154/224 (68%), Gaps = 1/224 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WN+ WFA   ++   L  D K+R+YL   L +A +++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNATWFANTKDFADNLDGDFKVRQYLTKELAKASLSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  ++ +      ++++EV KPE++  L+A SI
Sbjct: 61  AKSIRVTIHTARPGVVIGKKGEDVEKLRAAVAKIAGVPAQINISEVRKPELDGQLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVE 224
            IDY T+ A T YG  G+KV++  + E+        A E +  +
Sbjct: 181 DIDYATSSAHTTYGVIGVKVWIF-KGEILGGMPAANAVEPKADK 223


>gi|320173955|gb|EFW49131.1| SSU ribosomal protein S3p (S3e) [Shigella dysenteriae CDC 74-1112]
          Length = 233

 Score =  268 bits (686), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 113/230 (49%), Positives = 157/230 (68%), Gaps = 4/230 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS WFA   E+   L  D K+R+YL   L +A V++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLTKELAKASVSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+RK ++++      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQINIAEVRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
             QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 TSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD----SDSTIPAAEHRVVEKD 226
            IDY T+ A T YG  G+KV++   + +           PAA+ +  ++ 
Sbjct: 181 DIDYNTSEAYTTYGVIGVKVWIFKGEILGGMAAVEQPEKPAAQPKKQQRK 230


>gi|74316429|ref|YP_314169.1| 30S ribosomal protein S3 [Thiobacillus denitrificans ATCC 25259]
 gi|91207848|sp|Q3SLP3|RS3_THIDA RecName: Full=30S ribosomal protein S3
 gi|74055924|gb|AAZ96364.1| ribosomal protein S3 [Thiobacillus denitrificans ATCC 25259]
          Length = 234

 Score =  268 bits (686), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 118/226 (52%), Positives = 163/226 (72%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+PI FRLGV   W ++W+     +   L ED+K+R+YL+  L  A V+K+LIER 
Sbjct: 1   MGQKIHPIGFRLGVQRIWTAKWYGSNRNFSDTLLEDIKVRDYLKKKLSHASVSKVLIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI ++S RPG++IGKKG DIE +R +L+ + +  +H+++ EV KPE +A ++A  I
Sbjct: 61  AKNARITIFSGRPGVVIGKKGEDIEVLRGELARLMSVPVHVNIEEVRKPETDAQIVADGI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLE+RV+FRRAMKRA+Q+AMR GA G+K+++SGRLNGAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLEKRVMFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            IDYG A A+T YG  GIKV+V   D ++  +    A + +  +K 
Sbjct: 181 EIDYGFAEAKTTYGIIGIKVWVYKGDALTRGEQPAAAEQEKRGKKS 226


>gi|161523435|ref|YP_001578447.1| 30S ribosomal protein S3 [Burkholderia multivorans ATCC 17616]
 gi|189351792|ref|YP_001947420.1| 30S ribosomal protein S3 [Burkholderia multivorans ATCC 17616]
 gi|221201571|ref|ZP_03574609.1| 30S ribosomal protein S3 [Burkholderia multivorans CGD2M]
 gi|221207354|ref|ZP_03580364.1| 30S ribosomal protein S3 [Burkholderia multivorans CGD2]
 gi|221213492|ref|ZP_03586467.1| 30S ribosomal protein S3 [Burkholderia multivorans CGD1]
 gi|254253511|ref|ZP_04946829.1| 30S ribosomal protein S3 [Burkholderia dolosa AUO158]
 gi|226697675|sp|A9ADJ9|RS3_BURM1 RecName: Full=30S ribosomal protein S3
 gi|124896120|gb|EAY70000.1| 30S ribosomal protein S3 [Burkholderia dolosa AUO158]
 gi|160340864|gb|ABX13950.1| ribosomal protein S3 [Burkholderia multivorans ATCC 17616]
 gi|189335814|dbj|BAG44884.1| small subunit ribosomal protein S3 [Burkholderia multivorans ATCC
           17616]
 gi|221166944|gb|EED99415.1| 30S ribosomal protein S3 [Burkholderia multivorans CGD1]
 gi|221172942|gb|EEE05379.1| 30S ribosomal protein S3 [Burkholderia multivorans CGD2]
 gi|221178387|gb|EEE10796.1| 30S ribosomal protein S3 [Burkholderia multivorans CGD2M]
          Length = 266

 Score =  268 bits (686), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 116/229 (50%), Positives = 165/229 (72%), Gaps = 2/229 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V+  W SRW+A  + + A+L ED+ +REYL+  LK A V +++IER 
Sbjct: 1   MGQKIHPTGFRLAVSRNWASRWYANNNNFAAMLQEDIGVREYLKKKLKNASVGRVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI ++S+RPG++IGKKG DIE ++ +L       +H+++ E+ KPE +A LIA SI
Sbjct: 61  AKNARITIFSSRPGVVIGKKGEDIELLKTELQRRMGVPVHVNIEEIRKPETDAQLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLERR++FRRAMKRA+Q+AMR GA G+K++++GRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 TQQLERRIMFRRAMKRAMQNAMRLGAQGIKIMSAGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTI--PAAEHRVVEKDS 227
            IDY T+ A+T YG  G+KV+V   D +  +D+ +    AE +   +++
Sbjct: 181 DIDYATSEAKTTYGIIGVKVWVYKGDTLGRNDAPVVEEVAEDKRPRRNA 229


>gi|253991682|ref|YP_003043038.1| 30S ribosomal protein S3 [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253783132|emb|CAQ86297.1| 30S ribosomal protein S3 [Photorhabdus asymbiotica]
          Length = 233

 Score =  268 bits (686), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 111/230 (48%), Positives = 158/230 (68%), Gaps = 4/230 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS W+A   E+   L  D K+R+YL   L +A +++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNSTWYANTKEFADNLDSDFKVRQYLNKELAKASISRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+RK ++ +      ++++EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRKTVAEIAGVPAQINISEVRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
             QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 TSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD----SDSTIPAAEHRVVEKD 226
            IDY T+ A T YG  G+KV++   + +        +  PAA+ +  ++ 
Sbjct: 181 DIDYNTSEAHTTYGVLGVKVWIFKGEILGGMAAVEQAEKPAAQPKKQQRK 230


>gi|120609047|ref|YP_968725.1| 30S ribosomal protein S3 [Acidovorax citrulli AAC00-1]
 gi|152060836|sp|A1TJ13|RS3_ACIAC RecName: Full=30S ribosomal protein S3
 gi|120587511|gb|ABM30951.1| SSU ribosomal protein S3P [Acidovorax citrulli AAC00-1]
          Length = 293

 Score =  268 bits (686), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 124/219 (56%), Positives = 165/219 (75%), Gaps = 2/219 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V+  W SRW+A   ++  +L ED+K+REYL+  LK A V++ILIER 
Sbjct: 1   MGQKIHPTGFRLAVSRNWASRWYANNRDFAGMLAEDIKVREYLKAKLKNAAVSRILIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI +YSARPG++IGKKG DIE ++K+L++     + +++ EV KPEI+A LIA SI
Sbjct: 61  AKNARITIYSARPGVVIGKKGEDIENLKKELASRLGVPVAVNIEEVRKPEIDAKLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLE+R++FRRAMKRA+Q+AMR GA G+K+++SGRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 TQQLEKRIMFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
            IDYGT+ A T YG  G+KV+V   D +  +D  +PA E
Sbjct: 181 DIDYGTSEAFTTYGVIGLKVWVYKGDTLGRND--LPAVE 217


>gi|117620103|ref|YP_854847.1| ribosomal protein S3 [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
 gi|152060841|sp|A0KF27|RS3_AERHH RecName: Full=30S ribosomal protein S3
 gi|117561510|gb|ABK38458.1| ribosomal protein S3 [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
          Length = 237

 Score =  268 bits (686), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 107/210 (50%), Positives = 149/210 (70%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS WFA   ++   L+ D ++R++L   LK A ++KI IER 
Sbjct: 1   MGQKVHPNGIRLGITKPWNSTWFANTKDFADNLYSDFQVRQFLTKELKNASLSKITIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+RK ++ +      ++++EV KPE++  L+A SI
Sbjct: 61  AKSIRVTIHTARPGVVIGKKGEDVEKLRKAVAAIAGVPAQINISEVRKPELDGKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
             QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 TSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD 210
            IDY T+ A T YG  G+KV++   + +  
Sbjct: 181 DIDYATSEAHTTYGVIGVKVWIFKGEVLGG 210


>gi|89076318|ref|ZP_01162659.1| 30S ribosomal protein S3 [Photobacterium sp. SKA34]
 gi|90581684|ref|ZP_01237472.1| 30S ribosomal protein S3 [Vibrio angustum S14]
 gi|89048022|gb|EAR53611.1| 30S ribosomal protein S3 [Photobacterium sp. SKA34]
 gi|90437099|gb|EAS62302.1| 30S ribosomal protein S3 [Vibrio angustum S14]
          Length = 229

 Score =  268 bits (686), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 109/227 (48%), Positives = 154/227 (67%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WN+ WFA   E+   L  D K+R++L   L +A +++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNTTWFANSQEFADNLDGDFKVRQFLTKELAKASLSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  ++ +      +++ EV KPE++  L+A SI
Sbjct: 61  AKSIRVTIHTARPGVVIGKKGEDVEKLRAAVAKIAGVPAQINIAEVRKPELDGQLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           + QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 SSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDY T+ A T YG  G+KV++   + +       P AE    ++ S
Sbjct: 181 DIDYATSSAHTQYGVIGVKVWIFKGEVLGGMPVEEPKAEKPKKQRKS 227


>gi|260770919|ref|ZP_05879848.1| SSU ribosomal protein S3p (S3e) [Vibrio furnissii CIP 102972]
 gi|260614156|gb|EEX39346.1| SSU ribosomal protein S3p (S3e) [Vibrio furnissii CIP 102972]
 gi|315178965|gb|ADT85879.1| 30S ribosomal protein S3 [Vibrio furnissii NCTC 11218]
          Length = 233

 Score =  268 bits (686), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 107/224 (47%), Positives = 153/224 (68%), Gaps = 1/224 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WN+ WFA   ++   L  D K+R++L   L +A +++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNATWFANTKDFADNLDGDFKVRQFLTKELSKASLSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  ++ +      +++ EV KPE++  L+A SI
Sbjct: 61  AKSIRVTIHTARPGVVIGKKGEDVEKLRTAVAKIAGVPAQINIAEVRKPELDGQLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVE 224
            IDY T+ A T YG  G+KV++  + E+        A E +  +
Sbjct: 181 DIDYATSSAHTTYGVIGVKVWIF-KGEILGGMPAANAVEPKADK 223


>gi|257065027|ref|YP_003144699.1| SSU ribosomal protein S3P [Slackia heliotrinireducens DSM 20476]
 gi|256792680|gb|ACV23350.1| SSU ribosomal protein S3P [Slackia heliotrinireducens DSM 20476]
          Length = 244

 Score =  268 bits (686), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 108/219 (49%), Positives = 151/219 (68%), Gaps = 1/219 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+ P  FRLG+   W SRW+A   +Y   L  DL IR++L+  L++A V+KI IER 
Sbjct: 1   MGQKVMPTGFRLGITEDWRSRWYAD-KDYAKNLENDLAIRKFLEKQLEKAAVSKIEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               +II+ +ARPG++IGKKG +IE +RK ++ + N  +++ V EV +PE++A L+A+S+
Sbjct: 60  GDKIKIIITTARPGVVIGKKGAEIENLRKDVAKVANGAVNIEVIEVKRPELDAVLVAKSV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE RV FRRAM++AVQSA + GA G+++  SGRL GAE+SR E Y EGRVPL TLRA
Sbjct: 120 AEQLEGRVAFRRAMRKAVQSARKSGAQGIRIQCSGRLGGAEMSRREWYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
            IDYG A A T  G+ G+KV++   + +       PA E
Sbjct: 180 KIDYGFATARTTMGAIGVKVWIYHGEVLPGGKVPQPALE 218


>gi|301630258|ref|XP_002944239.1| PREDICTED: 30S ribosomal protein S3-like [Xenopus (Silurana)
           tropicalis]
          Length = 291

 Score =  268 bits (686), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 124/219 (56%), Positives = 166/219 (75%), Gaps = 2/219 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V+  W SRW+A   ++  +L ED+K+RE+L+  LK A V++ILIER 
Sbjct: 1   MGQKIHPTGFRLAVSRNWASRWYASNRDFAGMLAEDIKVREFLKAKLKNAAVSRILIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI +YSARPG++IGKKG DIE ++K+L+      + +++ EV KPEI+A LIA SI
Sbjct: 61  AKNARITIYSARPGVVIGKKGEDIENLKKELATRLGVPVAVNIEEVRKPEIDAKLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLE+R++FRRAMKRA+Q+AMR GA G+K+++SGRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 TQQLEKRIMFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
            IDYGT+ A+T YG  G+KV+V   D +  +D  +PAAE
Sbjct: 181 DIDYGTSEAKTTYGVIGVKVWVYKGDTLGRND--LPAAE 217


>gi|290477186|ref|YP_003470101.1| 30S ribosomal subunit protein S3 [Xenorhabdus bovienii SS-2004]
 gi|289176534|emb|CBJ83343.1| 30S ribosomal subunit protein S3 [Xenorhabdus bovienii SS-2004]
          Length = 233

 Score =  268 bits (686), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 111/230 (48%), Positives = 158/230 (68%), Gaps = 4/230 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS W+A   E+   L  D K+R+YL   L +A +++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNSTWYANTKEFADNLDSDFKVRQYLNKELVKASISRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+RK ++ +      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRKTVAEIAGVPAQINIAEVRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           + QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 SSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD----SDSTIPAAEHRVVEKD 226
            IDY T+ A T YG  G+KV++   + +        +  PAA+ +  ++ 
Sbjct: 181 DIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQAEKPAAQPKKQQRK 230


>gi|219666496|ref|YP_002456931.1| 30S ribosomal protein S3 [Desulfitobacterium hafniense DCB-2]
 gi|254764528|sp|B8G1X2|RS3_DESHD RecName: Full=30S ribosomal protein S3
 gi|219536756|gb|ACL18495.1| ribosomal protein S3 [Desulfitobacterium hafniense DCB-2]
          Length = 219

 Score =  268 bits (686), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 106/212 (50%), Positives = 150/212 (70%), Gaps = 1/212 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   R+G+   W  RWFA    Y  LLHEDLK+R++++  L+QAGV K+ IER 
Sbjct: 1   MGQKVNPKGLRVGIIRDWEGRWFAD-KNYLELLHEDLKVRKFVKTKLQQAGVPKVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               ++ +Y+A+PG++IG+ GT++E +RK+L  MT  ++ +++ EV KPE++A L+A+S+
Sbjct: 60  ANRVKVSIYAAKPGIVIGRGGTEVENLRKQLEAMTGKQVAVNIVEVKKPELDAQLVAESV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLE+RV FRRAMK+ VQ  MR G  G+K+  SGRL GAE++RTE Y EG+VPL TLRA
Sbjct: 120 AQQLEKRVSFRRAMKQTVQRTMRQGGQGIKISCSGRLGGAEIARTEWYSEGKVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSD 212
            IDYG A A T YG  G+KV++   + +    
Sbjct: 180 DIDYGFAEANTTYGKIGVKVWIYKGEVLPAKK 211


>gi|330827889|ref|YP_004390841.1| 30S ribosomal protein S3 [Aeromonas veronii B565]
 gi|328803025|gb|AEB48224.1| 30S ribosomal protein S3 [Aeromonas veronii B565]
          Length = 237

 Score =  268 bits (685), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 107/210 (50%), Positives = 149/210 (70%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS WFA   ++   L+ D ++R++L   LK A ++KI IER 
Sbjct: 1   MGQKVHPNGIRLGITKPWNSTWFANTKDFADNLYSDFQVRQFLTKELKNASLSKITIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+RK ++ +      ++++EV KPE++  L+A SI
Sbjct: 61  AKSIRVTIHTARPGVVIGKKGEDVEKLRKAVATIAGVPAQINISEVRKPELDGKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
             QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 TSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD 210
            IDY T+ A T YG  G+KV++   + +  
Sbjct: 181 DIDYATSEAHTTYGVIGVKVWIFKGEVLGG 210


>gi|268593547|ref|ZP_06127768.1| ribosomal protein S3 [Providencia rettgeri DSM 1131]
 gi|291310825|gb|EFE51278.1| ribosomal protein S3 [Providencia rettgeri DSM 1131]
          Length = 233

 Score =  268 bits (685), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 111/230 (48%), Positives = 160/230 (69%), Gaps = 4/230 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS W+A  +E+   L  D K+R+YL   L +A +++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNSTWYANTNEFADNLDSDYKVRQYLNKELAKASISRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+RK ++++      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRKTVADIAGVPAQINIAEVRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           + QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 SSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD----SDSTIPAAEHRVVEKD 226
            IDY T+ A T YG  G+KV++   + +        +  PAA+ +  ++ 
Sbjct: 181 DIDYNTSEAHTTYGVLGVKVWIFKGEILGGMAAVEQAEKPAAQPKKQQRK 230


>gi|15803841|ref|NP_289875.1| 30S ribosomal protein S3 [Escherichia coli O157:H7 EDL933]
 gi|25294470|pir||G85996 30S ribosomal subunit protein S3 [imported] - Escherichia coli
           (strain O157:H7, substrain EDL933)
 gi|12517946|gb|AAG58435.1|AE005557_4 30S ribosomal subunit protein S3 [Escherichia coli O157:H7 str.
           EDL933]
          Length = 233

 Score =  268 bits (685), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 112/230 (48%), Positives = 156/230 (67%), Gaps = 4/230 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS WFA   E+   L  D K+R+YL   L +A V++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLTKELAKASVSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+RK ++++      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQINIAEVRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
             QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y E RVPL TLRA
Sbjct: 121 TSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREXRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD----SDSTIPAAEHRVVEKD 226
            IDY T+ A T YG  G+KV++   + +           PAA+ +  ++ 
Sbjct: 181 DIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEKPAAQPKKQQRK 230


>gi|319778737|ref|YP_004129650.1| SSU ribosomal protein S3p (S3e) [Taylorella equigenitalis MCE9]
 gi|317108761|gb|ADU91507.1| SSU ribosomal protein S3p (S3e) [Taylorella equigenitalis MCE9]
          Length = 296

 Score =  268 bits (685), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 119/216 (55%), Positives = 160/216 (74%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P  FRL V   WNSRWFA   ++G +L +DL++REYL+  LKQA V ++LIER 
Sbjct: 1   MGQKVHPTGFRLAVTRNWNSRWFAEDKDFGTMLAQDLRVREYLKRKLKQASVGRVLIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI V++ARPG+IIGK G DI+ ++  L  +    +H+++ E+ KPE++A LIA SI
Sbjct: 61  EKNARITVFTARPGVIIGKGGDDIDALKSDLQRIMGVPVHINIEEIRKPEVDAQLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLE+R++FRRAMKRA+Q+AMR GA G+KV ASGRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLEKRIMFRRAMKRAIQNAMRAGAQGIKVAASGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIP 216
            +DY T+ A T YG  GIKV+V   D + + ++ + 
Sbjct: 181 MVDYATSEALTTYGLLGIKVWVYKGDLLPNGEAPVE 216


>gi|224827023|ref|ZP_03700120.1| ribosomal protein S3 [Lutiella nitroferrum 2002]
 gi|224600689|gb|EEG06875.1| ribosomal protein S3 [Lutiella nitroferrum 2002]
          Length = 233

 Score =  268 bits (685), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 113/226 (50%), Positives = 155/226 (68%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL VN  W+S+WFA   ++  +L +D+ +R +L+  L  A V ++ IER 
Sbjct: 1   MGQKIHPTGFRLAVNKNWSSKWFANSHDFADMLKQDIDVRAFLKKRLANASVGRVTIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ RI ++SARPG++IGKKG DIE ++K+L       +H+++ EV KPEI+A +IA  I
Sbjct: 61  AKSARITIHSARPGVVIGKKGEDIEVLKKELQKRLGVPVHVNIEEVRKPEIDAQIIADGI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLE+RV+FRRAMKRA+Q+AMR GA G+K+++SGRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 ASQLEKRVMFRRAMKRAMQNAMRMGAQGIKIMSSGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            +DY T+ A T YG  GIKV+V   +         P A  +   K 
Sbjct: 181 DVDYATSEANTTYGIIGIKVWVYKGELKPGQVQAAPVATEKKTRKG 226


>gi|58583200|ref|YP_202216.1| 30S ribosomal protein S3 [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84625038|ref|YP_452410.1| 30S ribosomal protein S3 [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|166710837|ref|ZP_02242044.1| 30S ribosomal protein S3 [Xanthomonas oryzae pv. oryzicola BLS256]
 gi|188575496|ref|YP_001912425.1| 30S ribosomal protein S3 [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|289665143|ref|ZP_06486724.1| 30S ribosomal protein S3 [Xanthomonas campestris pv. vasculorum
           NCPPB702]
 gi|325916493|ref|ZP_08178762.1| SSU ribosomal protein S3P [Xanthomonas vesicatoria ATCC 35937]
 gi|75508102|sp|Q5GWU0|RS3_XANOR RecName: Full=30S ribosomal protein S3
 gi|123752714|sp|Q2NZZ1|RS3_XANOM RecName: Full=30S ribosomal protein S3
 gi|58427794|gb|AAW76831.1| 30S ribosomal protein S3 [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84368978|dbj|BAE70136.1| 30S ribosomal protein S3 [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188519948|gb|ACD57893.1| ribosomal protein S3 [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|325537282|gb|EGD09009.1| SSU ribosomal protein S3P [Xanthomonas vesicatoria ATCC 35937]
          Length = 244

 Score =  268 bits (685), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 116/208 (55%), Positives = 156/208 (75%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K++P   RLG++  WNS+W+A   ++ A L  DLK+RE L+  L QAGV+KILIER 
Sbjct: 1   MGHKVHPTGIRLGISKDWNSKWYANKGDFAAYLAADLKVREMLRKKLAQAGVSKILIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K  R+ +++ARPG++IGK+G DIEK+RK++S +     H++V EV KPE++A L+A+SI
Sbjct: 61  AKTARVTIHTARPGVVIGKRGEDIEKLRKEVSELMGVPAHINVTEVRKPELDAQLVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERR++FRRAMKR+V +AMR GA G+KV  +GRLNGAE++R+E Y EGRVPL TLRA
Sbjct: 121 AQQLERRIMFRRAMKRSVGNAMRLGALGIKVNVAGRLNGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEV 208
            IDYG A A T YG  GIKV++   +  
Sbjct: 181 DIDYGFAEASTTYGIIGIKVWIYKGEVF 208


>gi|293602629|ref|ZP_06685072.1| 30S ribosomal protein S3 [Achromobacter piechaudii ATCC 43553]
 gi|311109606|ref|YP_003982459.1| 30S ribosomal protein S3 [Achromobacter xylosoxidans A8]
 gi|292819001|gb|EFF78039.1| 30S ribosomal protein S3 [Achromobacter piechaudii ATCC 43553]
 gi|310764295|gb|ADP19744.1| ribosomal protein S3 [Achromobacter xylosoxidans A8]
          Length = 264

 Score =  268 bits (685), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 117/212 (55%), Positives = 160/212 (75%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V   W+SRWFA    +G +L ED+++REYL+  LK A V +++IER 
Sbjct: 1   MGQKIHPTGFRLAVTRNWSSRWFADDKAFGTMLAEDIRVREYLKKKLKSASVGRVIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI VYSARPG++IGK+G DIE ++  L  +    +H+++ E+ KPE +A LIA SI
Sbjct: 61  AKNARITVYSARPGVVIGKRGEDIESLKADLQRLMGVPVHVNIEEIRKPETDAQLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           +QQLE+R++FRRAMKRA+Q+AMR GA G+K+++SGRLNG E++RTE Y EGRVPL TL+A
Sbjct: 121 SQQLEKRIMFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGIEIARTEWYREGRVPLHTLKA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSD 212
           +IDYGT+ A T YG  GIKV+V   D +++ +
Sbjct: 181 NIDYGTSEAHTTYGVIGIKVWVYKGDMLANGE 212


>gi|89095531|ref|ZP_01168436.1| 30S ribosomal protein S3 [Oceanospirillum sp. MED92]
 gi|89080206|gb|EAR59473.1| 30S ribosomal protein S3 [Oceanospirillum sp. MED92]
          Length = 226

 Score =  268 bits (685), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 111/226 (49%), Positives = 157/226 (69%), Gaps = 1/226 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+     S W+A  SEY + L  DL++REYL   L++A V++I IER 
Sbjct: 1   MGQKVHPTGIRLGIVKDHTSVWYADKSEYASKLQNDLQVREYLDKQLEKASVSRIEIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +N +I +++ARPG++IGKKG D+EK+R  +S M    +H+++ E+ KPE++A L+AQ +
Sbjct: 61  AQNAKITIHTARPGIVIGKKGEDVEKLRNTVSEMMGVPVHINIEEIRKPELDARLVAQGV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+K+   GRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQNAMRLGAKGIKIQLGGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            IDY T  A T YG  G+KV++  + E+      + A ++   +K 
Sbjct: 181 DIDYATYEAHTTYGVIGVKVWIF-KGEILGGIEQVRAEKNAPKKKG 225


>gi|238061115|ref|ZP_04605824.1| 30S ribosomal protein S3 [Micromonospora sp. ATCC 39149]
 gi|237882926|gb|EEP71754.1| 30S ribosomal protein S3 [Micromonospora sp. ATCC 39149]
          Length = 288

 Score =  268 bits (685), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 103/227 (45%), Positives = 151/227 (66%), Gaps = 2/227 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P  FRLG++  W SRWFA    Y   + ED+KIR  +   L++AG++K+ IERT
Sbjct: 1   MGQKVHPTGFRLGISTDWKSRWFAD-KLYKDYIGEDVKIRRMMSKGLERAGISKVDIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG+KG + ++IR +L  +T  ++ L++ EV  PE +A L+AQ +
Sbjct: 60  RDRVRVDIHTARPGIVIGRKGAEADRIRGELEKLTGKQVQLNIIEVKNPESDAQLVAQGV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFG-ADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           A+QL  RV FRRAM++A+QSAM+     G++V  SGRL GAE+SRTE Y EGRVPL TLR
Sbjct: 120 AEQLSSRVSFRRAMRKAMQSAMKNPVCKGIRVQVSGRLGGAEMSRTEFYREGRVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
           A+I+YG   A T +G  G+KV++   D V   ++   A      E+ 
Sbjct: 180 ANIEYGFFEARTTFGRIGVKVWIYKGDAVPGRETPAEAPSRPRRERG 226


>gi|320529802|ref|ZP_08030879.1| ribosomal protein S3 [Selenomonas artemidis F0399]
 gi|320137820|gb|EFW29725.1| ribosomal protein S3 [Selenomonas artemidis F0399]
          Length = 223

 Score =  268 bits (685), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 102/222 (45%), Positives = 155/222 (69%), Gaps = 1/222 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   RLG+   W++RW+A   ++   LHED+KIR+YL+  L+ AGV ++  ER+
Sbjct: 1   MGQKVNPHGIRLGIVKDWDARWYAD-KDFAQNLHEDIKIRDYLKKSLQTAGVPRVETERS 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               ++ +++A+PG++IG+ G+ IE+I++ L  +T+  + +++ E+ +P+++ATL+A++I
Sbjct: 60  KNRLKLTIHTAKPGMVIGRGGSGIEQIKEGLKGLTDKRVDINIAEIKQPDLDATLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERR+ FRRAMK+AV   MR GA G+K+  SGRL GAE++R E Y EG +PL TLRA
Sbjct: 120 AAQLERRIAFRRAMKQAVGRTMRLGAKGIKIAVSGRLGGAEIARRESYREGSIPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRV 222
            IDYGTA A T YG  GIKV++   + + D      AA+ R 
Sbjct: 180 DIDYGTAEAHTTYGRIGIKVWIFKGEVLPDKKQQPKAAKERS 221


>gi|289811445|ref|ZP_06542074.1| 30S ribosomal protein S3 [Salmonella enterica subsp. enterica
           serovar Typhi str. AG3]
          Length = 212

 Score =  268 bits (685), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 110/210 (52%), Positives = 150/210 (71%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS WFA   E+   L  D K+R+YL   L +A V++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLTKELAKASVSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+RK ++++      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQINIAEVRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
             QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 TSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD 210
            IDY T+ A T YG  G+KV++   + +  
Sbjct: 181 DIDYNTSEAHTTYGVIGVKVWIFKGEILGG 210


>gi|119773360|ref|YP_926100.1| 30S ribosomal protein S3 [Shewanella amazonensis SB2B]
 gi|152060903|sp|A1S224|RS3_SHEAM RecName: Full=30S ribosomal protein S3
 gi|119765860|gb|ABL98430.1| SSU ribosomal protein S3P [Shewanella amazonensis SB2B]
          Length = 230

 Score =  268 bits (685), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 109/226 (48%), Positives = 159/226 (70%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   W S W+A  S+Y   LH D ++R++L+  L+ A V+KI+IER 
Sbjct: 1   MGQKVHPNGIRLGITKPWISTWYADKSDYANNLHSDWEVRKFLEKKLEAASVSKIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+E +R +++ ++ +   +++ E+ KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGVVIGKKGEDVEVLRAEVAKISGTPAQINIAEIRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVMFRRAMKRAVQNAMRIGAQGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            IDY T+ + T YG  GIKV+V   + +      +   + +  ++ 
Sbjct: 181 DIDYATSESHTTYGVIGIKVWVFKGEVLDGMLPQVEEPKQQQPKRK 226


>gi|197287074|ref|YP_002152946.1| 30S ribosomal protein S3 [Proteus mirabilis HI4320]
 gi|227354928|ref|ZP_03839342.1| 30S ribosomal protein S3 [Proteus mirabilis ATCC 29906]
 gi|194684561|emb|CAR46389.1| 30S ribosomal protein S3 [Proteus mirabilis HI4320]
 gi|227165010|gb|EEI49849.1| 30S ribosomal protein S3 [Proteus mirabilis ATCC 29906]
          Length = 233

 Score =  268 bits (685), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 112/230 (48%), Positives = 159/230 (69%), Gaps = 4/230 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS W+A  +E+   L  D K+R+YL   L +A V++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNSTWYAGTNEFADNLDSDFKVRQYLTKELAKASVSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+RK ++++      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRKNVADIAGVPAQINIAEVRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
             QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 TSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD----SDSTIPAAEHRVVEKD 226
            IDY T+ A T YG  G+KV++   + +        +  PAA+ +  ++ 
Sbjct: 181 DIDYNTSEAHTTYGVLGVKVWIFKGEILGGMAAVEQAEKPAAQPKKQQRK 230


>gi|113460214|ref|YP_718271.1| 30S ribosomal protein S3 [Haemophilus somnus 129PT]
 gi|170718252|ref|YP_001785272.1| 30S ribosomal protein S3 [Haemophilus somnus 2336]
 gi|123131900|sp|Q0I157|RS3_HAES1 RecName: Full=30S ribosomal protein S3
 gi|112822257|gb|ABI24346.1| SSU ribosomal protein S3P [Haemophilus somnus 129PT]
 gi|168826381|gb|ACA31752.1| ribosomal protein S3 [Haemophilus somnus 2336]
          Length = 235

 Score =  268 bits (685), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 107/223 (47%), Positives = 150/223 (67%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS WFA   ++   L  D K+R++L   L  A V++I IER 
Sbjct: 1   MGQKVHPHGIRLGIVKPWNSTWFANTQDFADNLDGDFKVRQFLNKELANASVSRITIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  ++ +      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRNAVAAIAGVPAQINIAEVKKPELDAKLVAGSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMK+AVQ+AMR GA G+KV  SGRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKKAVQNAMRLGAKGIKVEVSGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVV 223
            IDY T+ A T YG  G+KV++   + +    +     E +  
Sbjct: 181 DIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAIAQQPEQQPA 223


>gi|108809248|ref|YP_653164.1| 30S ribosomal protein S3 [Yersinia pestis Antiqua]
 gi|167398347|ref|ZP_02303871.1| ribosomal protein S3 [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|123372094|sp|Q1C2V3|RS3_YERPA RecName: Full=30S ribosomal protein S3
 gi|108781161|gb|ABG15219.1| SSU ribosomal protein S3P [Yersinia pestis Antiqua]
 gi|167050851|gb|EDR62259.1| ribosomal protein S3 [Yersinia pestis biovar Antiqua str.
           UG05-0454]
          Length = 232

 Score =  268 bits (685), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 111/229 (48%), Positives = 158/229 (68%), Gaps = 3/229 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS W+A   E+   L  D K+R++L   L +A V++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKAWNSTWYANTKEFADNLDSDFKVRQFLTKELAKASVSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+RK ++++      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQINIAEVRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
             QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 ISQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDS---DSTIPAAEHRVVEKD 226
            IDY T+ A T YG  G+KV++   + +      +   PAA+ +  ++ 
Sbjct: 181 DIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEPAAQPKKQQRK 229


>gi|237806881|ref|YP_002891321.1| 30S ribosomal protein S3 [Tolumonas auensis DSM 9187]
 gi|237499142|gb|ACQ91735.1| ribosomal protein S3 [Tolumonas auensis DSM 9187]
          Length = 238

 Score =  268 bits (684), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 107/210 (50%), Positives = 153/210 (72%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   +NS W+A   E+   LH D ++R+YL   LK A +++I+IER 
Sbjct: 1   MGQKVHPNGIRLGITKPFNSTWYANTKEFADNLHGDFQVRQYLTKELKAASLSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+RK+++++      +++ EV KPE+++ L+A SI
Sbjct: 61  AKSIRVTIHTARPGVVIGKKGEDVEKLRKQIASIAGVPAQINIAEVRKPELDSQLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           + QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 SSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD 210
            IDY T+ A T YG  G+KV++   + +  
Sbjct: 181 DIDYATSEAHTTYGVIGVKVWIFKGEVLGG 210


>gi|84515640|ref|ZP_01003001.1| 30S ribosomal protein S3 [Loktanella vestfoldensis SKA53]
 gi|84510082|gb|EAQ06538.1| 30S ribosomal protein S3 [Loktanella vestfoldensis SKA53]
          Length = 238

 Score =  268 bits (684), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 127/227 (55%), Positives = 170/227 (74%), Gaps = 1/227 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K+NPI  RL VN TW+SRWFA   EYG LL EDLKI+ +++    Q+GV++++IER 
Sbjct: 1   MGNKVNPIGMRLQVNRTWDSRWFANTREYGDLLLEDLKIKAFIRKECAQSGVSRVIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ +++ARPG+IIGKKG DIE +R+KL+N+T SE+HL++ EV KPE++A L+A+SI
Sbjct: 61  HKKCRVTIHAARPGVIIGKKGADIEGLRQKLANLTKSELHLNIVEVRKPELDAALVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLERRV FRRAMKRAVQ+AMR GA G++V  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 GQQLERRVSFRRAMKRAVQNAMRMGALGIRVNLAGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDY    A T YG  GIKV++  + E+ + D      +H  +++ +
Sbjct: 181 DIDYALFEAMTPYGIIGIKVFIY-KGEIMEHDPQGHDRKHAELQEGA 226


>gi|124514437|gb|EAY55950.1| ribosomal protein S3 [Leptospirillum rubarum]
          Length = 226

 Score =  268 bits (684), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 115/227 (50%), Positives = 162/227 (71%), Gaps = 3/227 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI FRLG   TW+SRW+A+   +  LLHEDLKIR+ ++  L  AG+AKI IERT
Sbjct: 1   MGQKVHPIGFRLGYIKTWSSRWYAQ-KGFADLLHEDLKIRKMVKKKLFHAGIAKIEIERT 59

Query: 61  HKNC--RIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQ 118
            K+   RI +++ARPGLIIGKKG +IEK++ +L   T S + +++ E+ KPE+ A LIA+
Sbjct: 60  GKDALARISIHTARPGLIIGKKGLEIEKLKSELEETTKSHVSINIKEIKKPELEAQLIAE 119

Query: 119 SIAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTL 178
           S+A QLE+R+ +RRAMK++V SA+RFGA GVK+  +GRL G+E++RTE Y EGRVPL TL
Sbjct: 120 SVASQLEKRISYRRAMKKSVSSALRFGALGVKICCAGRLGGSEIARTEWYREGRVPLHTL 179

Query: 179 RAHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
           RA ID+G A A T +G  G+KV+V   + +   +  +   + R   +
Sbjct: 180 RADIDFGFAEASTTFGKIGVKVWVYRGEILPGQEEVLSKPKERRGRQ 226


>gi|222056699|ref|YP_002539061.1| ribosomal protein S3 [Geobacter sp. FRC-32]
 gi|254764532|sp|B9M6H2|RS3_GEOSF RecName: Full=30S ribosomal protein S3
 gi|221565988|gb|ACM21960.1| ribosomal protein S3 [Geobacter sp. FRC-32]
          Length = 210

 Score =  268 bits (684), Expect = 6e-70,   Method: Composition-based stats.
 Identities = 114/211 (54%), Positives = 162/211 (76%), Gaps = 1/211 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI FRLGV  TW+S+W+A   ++  LLHEDLK++ +L+  L  +GV+KI IER 
Sbjct: 1   MGQKVNPIGFRLGVIKTWDSKWYAE-KDFAKLLHEDLKLKSFLKKRLYHSGVSKIEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               +I +Y+ARPGLIIGKKG+++E ++K+L+ +T+ E++L++ EV KPE++A L++++I
Sbjct: 60  AGKAKINIYTARPGLIIGKKGSEVETLKKELAKLTDKEVYLNIQEVRKPELDAQLVSENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV FRRAMK++V S+++FGA G+++  SGRL GAE+SRTE Y EGRVPL TLRA
Sbjct: 120 ALQLERRVAFRRAMKKSVTSSLKFGAKGIRITCSGRLGGAEMSRTEWYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDS 211
            IDYG A A+T YG  G+KV +   + +S  
Sbjct: 180 DIDYGFAEAKTTYGIIGVKVLIFKGEVLSGK 210


>gi|222109499|ref|YP_002551763.1| 30S ribosomal protein s3 [Acidovorax ebreus TPSY]
 gi|221728943|gb|ACM31763.1| ribosomal protein S3 [Acidovorax ebreus TPSY]
          Length = 288

 Score =  268 bits (684), Expect = 6e-70,   Method: Composition-based stats.
 Identities = 124/219 (56%), Positives = 166/219 (75%), Gaps = 2/219 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V+  W SRW+A   ++  +L ED+K+REYL+  LK A V++ILIER 
Sbjct: 1   MGQKIHPTGFRLAVSRNWASRWYASNRDFAGMLAEDIKVREYLKAKLKNAAVSRILIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI ++SARPG++IGKKG DIE ++K+L+      + +++ EV KPEI+A LIA SI
Sbjct: 61  AKNARITIFSARPGVVIGKKGEDIENLKKELATRLGVPVAVNIEEVRKPEIDAKLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLE+R++FRRAMKRA+Q+AMR GA G+K+++SGRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 TQQLEKRIMFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
            IDYGT+ A+T YG  G+KV+V   D +  +D  +PAAE
Sbjct: 181 DIDYGTSEAKTTYGVIGVKVWVYKGDTLGRND--LPAAE 217


>gi|241765223|ref|ZP_04763206.1| ribosomal protein S3 [Acidovorax delafieldii 2AN]
 gi|241365103|gb|EER59982.1| ribosomal protein S3 [Acidovorax delafieldii 2AN]
          Length = 293

 Score =  268 bits (684), Expect = 6e-70,   Method: Composition-based stats.
 Identities = 124/219 (56%), Positives = 166/219 (75%), Gaps = 2/219 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V+  W SRW+A   ++  +L ED+K+REYL+  LK A V++ILIER 
Sbjct: 1   MGQKIHPTGFRLAVSRNWASRWYASNRDFAGMLAEDIKVREYLKAKLKNAAVSRILIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI +YSARPG++IGKKG DIE ++K+L++     + +++ EV KPEI+A LIA SI
Sbjct: 61  AKNARITIYSARPGVVIGKKGEDIENLKKELASRLGVPVAVNIEEVRKPEIDAKLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLE+R++FRRAMKRA+Q+AMR GA G+K+++SGRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 TQQLEKRIMFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
            IDYGT+ A+T YG  G+KV+V   D +  +D  +PA E
Sbjct: 181 DIDYGTSEAKTTYGVIGVKVWVYKGDTLGRND--LPAVE 217


>gi|332041529|gb|EGI77889.1| 30S ribosomal protein S3 [Hylemonella gracilis ATCC 19624]
          Length = 296

 Score =  267 bits (683), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 118/220 (53%), Positives = 159/220 (72%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP  FRL V+  W SRW+A   ++  +L ED+K+REYL+  LK A V+++LIER 
Sbjct: 1   MGQKINPTGFRLAVSRNWASRWYASNRDFAGMLAEDIKVREYLKTKLKNASVSRVLIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI ++SARPG++IGKKG DIE +++ L       + +++ EV KPEI+A LIA SI
Sbjct: 61  AKNARITIFSARPGVVIGKKGEDIENLKRDLGKQLGVPVAVNIEEVRKPEIDAKLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLE+R++FRRAMKRA+Q+AMR GA G+K+++SGRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 TQQLEKRIMFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEH 220
            IDYGT+ A+T YG  G+KV+V   D +  ++        
Sbjct: 181 DIDYGTSEAKTTYGVIGVKVWVYKGDNLGRNEQPATTEPR 220


>gi|114778818|ref|ZP_01453625.1| 30S ribosomal protein S3 [Mariprofundus ferrooxydans PV-1]
 gi|114550949|gb|EAU53513.1| 30S ribosomal protein S3 [Mariprofundus ferrooxydans PV-1]
          Length = 216

 Score =  267 bits (683), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 108/210 (51%), Positives = 151/210 (71%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI FR+GV   W S W+A    +GA L ED+K+R +++  LK AGV++I+IER 
Sbjct: 1   MGQKVNPIGFRVGVIRNWESVWYASDKNFGAQLREDIKLRRHVKERLKHAGVSRIIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               ++ V+++RPG++IGKKG++I+ +R +L      E+ + + EV +PE  A L+A+++
Sbjct: 61  ADKIKVTVHTSRPGVVIGKKGSEIDAVRNELVREFGQEVQVFIVEVRRPEAEAQLVAENV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A Q+ERRV FRRAMKRAVQSAMR GA GV++  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AFQMERRVAFRRAMKRAVQSAMRMGAKGVRINCAGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD 210
            +DYG A A T YG  G+KV+V    ++ D
Sbjct: 181 DVDYGFAEAHTTYGVIGVKVWVFNGIKLGD 210


>gi|121592718|ref|YP_984614.1| 30S ribosomal protein S3 [Acidovorax sp. JS42]
 gi|152060839|sp|A1W2R3|RS3_ACISJ RecName: Full=30S ribosomal protein S3
 gi|120604798|gb|ABM40538.1| SSU ribosomal protein S3P [Acidovorax sp. JS42]
          Length = 288

 Score =  267 bits (683), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 124/219 (56%), Positives = 166/219 (75%), Gaps = 2/219 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V+  W SRW+A   ++  +L ED+K+REYL+  LK A V++ILIER 
Sbjct: 1   MGQKIHPTGFRLSVSRNWASRWYASNRDFAGMLAEDIKVREYLKAKLKNAAVSRILIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI ++SARPG++IGKKG DIE ++K+L+      + +++ EV KPEI+A LIA SI
Sbjct: 61  AKNARITIFSARPGVVIGKKGEDIENLKKELATRLGVPVAVNIEEVRKPEIDAKLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLE+R++FRRAMKRA+Q+AMR GA G+K+++SGRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 TQQLEKRIMFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
            IDYGT+ A+T YG  G+KV+V   D +  +D  +PAAE
Sbjct: 181 DIDYGTSEAKTTYGVIGVKVWVYKGDTLGRND--LPAAE 217


>gi|206602681|gb|EDZ39162.1| Ribosomal protein S3 [Leptospirillum sp. Group II '5-way CG']
          Length = 226

 Score =  267 bits (683), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 115/227 (50%), Positives = 161/227 (70%), Gaps = 3/227 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI FRLG   TW+SRW+A+   +  LLHEDLKIR+ ++  L  AG+AKI IERT
Sbjct: 1   MGQKVHPIGFRLGYIKTWSSRWYAQ-KGFADLLHEDLKIRKMVKKKLFHAGIAKIEIERT 59

Query: 61  HKNC--RIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQ 118
            K+   RI +++ARPGLIIGKKG +IEK++ +L   T S + +++ E+ KPE+ A LIA+
Sbjct: 60  GKDALARISIHTARPGLIIGKKGLEIEKLKSELEETTKSHVSINIKEIKKPELEAQLIAE 119

Query: 119 SIAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTL 178
           S+A QLE+R+ +RRAMK++V SA+RFGA GVK+  +GRL G+E++RTE Y EGRVPL TL
Sbjct: 120 SVASQLEKRISYRRAMKKSVSSALRFGALGVKICCAGRLGGSEIARTEWYREGRVPLHTL 179

Query: 179 RAHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
           RA ID+G A A T +G  G+KV+V   + +   +      + R   +
Sbjct: 180 RADIDFGFAEASTTFGKIGVKVWVYRGEILPGQEEVASKPKERRGRQ 226


>gi|134096315|ref|YP_001101390.1| 30S ribosomal protein S3 [Herminiimonas arsenicoxydans]
 gi|189045012|sp|A4G9T2|RS3_HERAR RecName: Full=30S ribosomal protein S3
 gi|133740218|emb|CAL63269.1| 30S ribosomal protein S3 [Herminiimonas arsenicoxydans]
          Length = 283

 Score =  267 bits (683), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 118/225 (52%), Positives = 159/225 (70%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V   W SRW+A  S +  +L+EDLK+R YL+  LK A V +++IER 
Sbjct: 1   MGQKIHPTGFRLSVTRNWASRWYAGNSNFATMLNEDLKVRAYLKTKLKNASVGRVIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI +YS+RPG++IGKKG DIE ++  L+ M    +H+++ E+ KPE +A LIA SI
Sbjct: 61  AKNARITIYSSRPGVVIGKKGEDIEVLKSALTKMMGVPVHVNIEEIRKPETDAQLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLE+R++FRRAMKRA+Q+AMR GA G+K+++SGRLNG E++R E Y EGRVPL TLRA
Sbjct: 121 AQQLEKRIMFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGIEIARKEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDYG   AET YG  GIKV+V   D +   +  +   +    ++
Sbjct: 181 EIDYGFGEAETTYGIIGIKVWVYKGDRLPSGEPPVDLTKEDDTKR 225


>gi|209521379|ref|ZP_03270092.1| ribosomal protein S3 [Burkholderia sp. H160]
 gi|209498199|gb|EDZ98341.1| ribosomal protein S3 [Burkholderia sp. H160]
          Length = 268

 Score =  267 bits (683), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 116/229 (50%), Positives = 165/229 (72%), Gaps = 2/229 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V+  W SRW+A  + + A+L ED+ +REYL+  LK A V +++IER 
Sbjct: 1   MGQKIHPTGFRLAVSRNWASRWYANNNNFAAMLQEDIGVREYLKKKLKNASVGRVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI ++S+RPG++IGKKG DIE ++ +L       +H+++ E+ KPE +A LIA SI
Sbjct: 61  AKNARITIFSSRPGVVIGKKGEDIELLKSELQKRMGVPVHVNIEEIRKPETDAQLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLERR++FRRAMKRA+Q+AMR GA G+K++++GRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 TQQLERRIMFRRAMKRAMQNAMRLGAQGIKIMSAGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTI--PAAEHRVVEKDS 227
            IDY T+ A+T YG  G+KV+V   D +  +D+ +    AE +   +++
Sbjct: 181 DIDYATSEAKTTYGIIGVKVWVYKGDTLGRNDAPVVEEVAEEKRPRRNA 229


>gi|167587766|ref|ZP_02380154.1| 30S ribosomal protein S3 [Burkholderia ubonensis Bu]
          Length = 266

 Score =  267 bits (683), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 116/229 (50%), Positives = 165/229 (72%), Gaps = 2/229 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V+  W SRW+A  + + A+L ED+ +REYL+  LK A V +++IER 
Sbjct: 1   MGQKIHPTGFRLAVSRNWASRWYANNNNFAAMLKEDIGVREYLKKKLKNASVGRVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI ++S+RPG++IGKKG DIE ++ +L       +H+++ E+ KPE +A LIA SI
Sbjct: 61  AKNARITIFSSRPGVVIGKKGEDIELLKTELQRRMGVPVHVNIEEIRKPETDAQLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLERR++FRRAMKRA+Q+AMR GA G+K++++GRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 TQQLERRIMFRRAMKRAMQNAMRLGAQGIKIMSAGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTI--PAAEHRVVEKDS 227
            IDY T+ A+T YG  G+KV+V   D +  +D+ +    AE +   +++
Sbjct: 181 DIDYATSEAKTTYGIIGVKVWVYKGDTLGRNDAPVVEEVAEDKRPRRNA 229


>gi|317050534|ref|YP_004111650.1| 30S ribosomal protein S3 [Desulfurispirillum indicum S5]
 gi|316945618|gb|ADU65094.1| ribosomal protein S3 [Desulfurispirillum indicum S5]
          Length = 230

 Score =  267 bits (683), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 109/227 (48%), Positives = 157/227 (69%), Gaps = 1/227 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+  TWNS+W+A   +Y   LHEDL+I ++L+  L  AG++++ IER 
Sbjct: 1   MGQKVHPTGLRLGIIKTWNSKWYAN-KDYADFLHEDLRIEKHLRKELYHAGISRVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                I +++ARPG++IGKKG +IEK+RK LS+MT   I ++V EV KPE++A L+A+++
Sbjct: 60  PGKVNITLHTARPGIVIGKKGAEIEKVRKSLSDMTKKNIFVNVKEVKKPELDAQLVAENV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV FRRAMK+AV   M+ G +G+++  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 120 AMQLERRVAFRRAMKKAVGMTMKMGGEGIRIACAGRLGGAEIARTEWYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDYG A A+T YG  G+KV++S  + +  S             +++
Sbjct: 180 DIDYGFAEAKTTYGIIGVKVWMSHGEILDTSKKAQKVEAAAGATREA 226


>gi|145300929|ref|YP_001143770.1| ribosomal protein S3 [Aeromonas salmonicida subsp. salmonicida
           A449]
 gi|152060842|sp|A4ST00|RS3_AERS4 RecName: Full=30S ribosomal protein S3
 gi|142853701|gb|ABO92022.1| ribosomal protein S3 [Aeromonas salmonicida subsp. salmonicida
           A449]
          Length = 236

 Score =  267 bits (683), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 108/210 (51%), Positives = 150/210 (71%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS WFA   ++   L+ D ++R++L   LK A ++KI IER 
Sbjct: 1   MGQKVHPNGIRLGITKPWNSTWFANTKDFADNLYSDFQVRQFLTKELKNASLSKITIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+RK ++ +T     ++++EV KPE++  L+A SI
Sbjct: 61  AKSIRVTIHTARPGVVIGKKGEDVEKLRKAVAVITGVPAQINISEVRKPELDGKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
             QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 TSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD 210
            IDY T+ A T YG  G+KV++   + +  
Sbjct: 181 DIDYATSEAHTTYGVIGVKVWIFKGEVLGG 210


>gi|300721371|ref|YP_003710642.1| 30S ribosomal subunit protein S3 [Xenorhabdus nematophila ATCC
           19061]
 gi|297627859|emb|CBJ88405.1| 30S ribosomal subunit protein S3 [Xenorhabdus nematophila ATCC
           19061]
          Length = 224

 Score =  267 bits (683), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 109/220 (49%), Positives = 154/220 (70%), Gaps = 1/220 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS W+A   E+   L  D K+R+YL   L +A +++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNSTWYANTKEFADNLDSDFKVRQYLNKELVKASISRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+RK ++++      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRKAVADIAGVPAQINIAEVRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           + QLERRV+FRRAMKRAV +AMR GA G+K   SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 SSQLERRVMFRRAMKRAVHNAMRLGAKGIKEEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEH 220
            IDY T+ A T YG  G+KV++  + E+    + +  AE 
Sbjct: 181 DIDYNTSEAHTTYGVIGVKVWIF-KGEILGGMAAVEQAEK 219


>gi|296163315|ref|ZP_06846076.1| ribosomal protein S3 [Burkholderia sp. Ch1-1]
 gi|295886454|gb|EFG66311.1| ribosomal protein S3 [Burkholderia sp. Ch1-1]
          Length = 268

 Score =  267 bits (683), Expect = 8e-70,   Method: Composition-based stats.
 Identities = 116/229 (50%), Positives = 165/229 (72%), Gaps = 2/229 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V+  W SRW+A  + + A+L ED+ +REYL+  LK A V +++IER 
Sbjct: 1   MGQKIHPTGFRLAVSRNWASRWYANNNNFAAMLQEDIGVREYLKKKLKNASVGRVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI ++S+RPG++IGKKG DIE ++ +L       +H+++ E+ KPE +A LIA SI
Sbjct: 61  AKNARITIFSSRPGVVIGKKGEDIELLKSELQKRMGVPVHVNIEEIRKPETDAQLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLERR++FRRAMKRA+Q+AMR GA G+K++++GRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 TQQLERRIMFRRAMKRAMQNAMRLGAQGIKIMSAGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTI--PAAEHRVVEKDS 227
            IDY T+ A+T YG  G+KV+V   D +  +D+ +    AE +   +++
Sbjct: 181 DIDYATSEAKTTYGIIGVKVWVYKGDTLGRNDAPVVEEVAEEKRPRRNA 229


>gi|187925610|ref|YP_001897252.1| 30S ribosomal protein S3 [Burkholderia phytofirmans PsJN]
 gi|295677926|ref|YP_003606450.1| ribosomal protein S3 [Burkholderia sp. CCGE1002]
 gi|307731249|ref|YP_003908473.1| 30S ribosomal protein S3 [Burkholderia sp. CCGE1003]
 gi|323527596|ref|YP_004229749.1| 30S ribosomal protein S3 [Burkholderia sp. CCGE1001]
 gi|226697677|sp|B2T745|RS3_BURPP RecName: Full=30S ribosomal protein S3
 gi|187716804|gb|ACD18028.1| ribosomal protein S3 [Burkholderia phytofirmans PsJN]
 gi|295437769|gb|ADG16939.1| ribosomal protein S3 [Burkholderia sp. CCGE1002]
 gi|307585784|gb|ADN59182.1| ribosomal protein S3 [Burkholderia sp. CCGE1003]
 gi|323384598|gb|ADX56689.1| ribosomal protein S3 [Burkholderia sp. CCGE1001]
          Length = 268

 Score =  267 bits (683), Expect = 8e-70,   Method: Composition-based stats.
 Identities = 116/229 (50%), Positives = 165/229 (72%), Gaps = 2/229 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V+  W SRW+A  + + A+L ED+ +REYL+  LK A V +++IER 
Sbjct: 1   MGQKIHPTGFRLAVSRNWASRWYANNNNFAAMLQEDIGVREYLKKKLKNASVGRVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI ++S+RPG++IGKKG DIE ++ +L       +H+++ E+ KPE +A LIA SI
Sbjct: 61  AKNARITIFSSRPGVVIGKKGEDIELLKSELQKRMGVPVHVNIEEIRKPETDAQLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLERR++FRRAMKRA+Q+AMR GA G+K++++GRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 TQQLERRIMFRRAMKRAMQNAMRLGAQGIKIMSAGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTI--PAAEHRVVEKDS 227
            IDY T+ A+T YG  G+KV+V   D +  +D+ +    AE +   +++
Sbjct: 181 DIDYATSEAKTTYGIIGVKVWVYKGDTLGRNDAPVVEEVAEEKRPRRNA 229


>gi|153004779|ref|YP_001379104.1| ribosomal protein S3 [Anaeromyxobacter sp. Fw109-5]
 gi|189044983|sp|A7HBM4|RS3_ANADF RecName: Full=30S ribosomal protein S3
 gi|152028352|gb|ABS26120.1| ribosomal protein S3 [Anaeromyxobacter sp. Fw109-5]
          Length = 224

 Score =  267 bits (683), Expect = 8e-70,   Method: Composition-based stats.
 Identities = 111/218 (50%), Positives = 157/218 (72%), Gaps = 1/218 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI FRLGV  +W+S+W+     Y   LHED+ +REY++  L QAG+++I IER 
Sbjct: 1   MGQKVHPIGFRLGVIRSWDSKWY-EEKNYAKWLHEDIHLREYVKEKLGQAGISRIEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               +I V++ARPG++IGK+G  IE I+K+L   T++E++L+V EV K E +A L+A++I
Sbjct: 60  ANKVKINVHTARPGIVIGKRGAGIETIKKELQGKTDNEVYLNVVEVRKAETDAQLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERR+ FRRAMK++VQ+A++FGA G++V  SGRL G+E++R E Y EGRVPL TLRA
Sbjct: 120 ATQLERRIAFRRAMKKSVQTALKFGAKGIRVACSGRLGGSEMARYEWYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAA 218
            IDYG A A+T YG  G KV++   + +  S S  P  
Sbjct: 180 DIDYGFAEAKTTYGKIGCKVWIMRGEVLPQSASARPPR 217


>gi|21241743|ref|NP_641325.1| 30S ribosomal protein S3 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|294627847|ref|ZP_06706426.1| 30S ribosomal protein S3 [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
 gi|294664000|ref|ZP_06729414.1| 30S ribosomal protein S3 [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
 gi|27734501|sp|Q8PNR9|RS3_XANAC RecName: Full=30S ribosomal protein S3
 gi|21107114|gb|AAM35861.1| 30S ribosomal protein S3 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|292597761|gb|EFF41919.1| 30S ribosomal protein S3 [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
 gi|292606229|gb|EFF49466.1| 30S ribosomal protein S3 [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
          Length = 244

 Score =  267 bits (683), Expect = 8e-70,   Method: Composition-based stats.
 Identities = 116/208 (55%), Positives = 156/208 (75%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K++P   RLG+   WNS+W+A  +E+ + L  DLK+RE L+  L QAGV+KILIER 
Sbjct: 1   MGHKVHPTGIRLGIAKDWNSKWYANKAEFASYLAADLKVREMLRKKLAQAGVSKILIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K  R+ +++ARPG++IGK+G DIEK+RK++S +     H++V EV KPE++A L+A+SI
Sbjct: 61  AKTARVTIHTARPGVVIGKRGEDIEKLRKEVSELMGVPAHINVTEVRKPELDAQLVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERR++FRRAMKR+V +AMR GA G+KV  +GRLNGAE++R+E Y EGRVPL TLRA
Sbjct: 121 AQQLERRIMFRRAMKRSVGNAMRLGALGIKVNVAGRLNGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEV 208
            IDYG A A T YG  GIKV++   +  
Sbjct: 181 DIDYGFAEASTTYGIIGIKVWIYKGEVF 208


>gi|78046561|ref|YP_362736.1| 30S ribosomal protein S3 [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|325925381|ref|ZP_08186783.1| SSU ribosomal protein S3P [Xanthomonas perforans 91-118]
 gi|91207850|sp|Q3BWX7|RS3_XANC5 RecName: Full=30S ribosomal protein S3
 gi|78034991|emb|CAJ22636.1| 30S ribosomal protein S3 [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|325544259|gb|EGD15640.1| SSU ribosomal protein S3P [Xanthomonas perforans 91-118]
          Length = 244

 Score =  267 bits (682), Expect = 9e-70,   Method: Composition-based stats.
 Identities = 116/208 (55%), Positives = 156/208 (75%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K++P   RLG+   WNS+W+A  +E+ + L  DLK+RE L+  L QAGV+KILIER 
Sbjct: 1   MGHKVHPTGIRLGIAKDWNSKWYANKAEFASYLAADLKVREMLRKKLAQAGVSKILIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K  R+ +++ARPG++IGK+G DIEK+RK++S +     H++V EV KPE++A L+A+SI
Sbjct: 61  AKTARVTIHTARPGVVIGKRGEDIEKLRKEVSQLMGVPAHINVTEVRKPELDAQLVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERR++FRRAMKR+V +AMR GA G+KV  +GRLNGAE++R+E Y EGRVPL TLRA
Sbjct: 121 AQQLERRIMFRRAMKRSVGNAMRLGALGIKVNVAGRLNGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEV 208
            IDYG A A T YG  GIKV++   +  
Sbjct: 181 DIDYGFAEASTTYGIIGIKVWIYKGEVF 208


>gi|297618378|ref|YP_003703537.1| ribosomal protein S3 [Syntrophothermus lipocalidus DSM 12680]
 gi|297146215|gb|ADI02972.1| ribosomal protein S3 [Syntrophothermus lipocalidus DSM 12680]
          Length = 222

 Score =  267 bits (682), Expect = 9e-70,   Method: Composition-based stats.
 Identities = 99/221 (44%), Positives = 155/221 (70%), Gaps = 1/221 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   R+G+   W+S+W+A   +Y  LLHED  IR+Y++ +   AG++K+ IERT
Sbjct: 1   MGQKVHPKGLRIGIIRDWDSKWYAD-RDYTDLLHEDYHIRKYIKENFFAAGISKVEIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++A+PG+IIG+ GT++E++R+ L  +T   +++++ E+ KPE++A ++A+++
Sbjct: 60  GNRVRVSIHTAKPGIIIGRGGTEVERLRQDLGKLTGKTVNINIVEIKKPELDAQIVAENV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A Q+ERRV +RRAMK+AVQ  MR GA+G+K+  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 120 AAQIERRVAYRRAMKQAVQRTMRAGAEGIKIAVSGRLAGAEIARTEWYAEGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHR 221
            IDYG A A T YG  GIK++++  + +  +          
Sbjct: 180 DIDYGFAEAMTTYGKIGIKIWINRGEVLPAAKQPAKKTGEE 220


>gi|118496858|ref|YP_897908.1| 30S ribosomal protein S3 [Francisella tularensis subsp. novicida
           U112]
 gi|152060861|sp|A0Q4I9|RS3_FRATN RecName: Full=30S ribosomal protein S3
 gi|118422764|gb|ABK89154.1| 30S ribosomal protein S3 [Francisella novicida U112]
 gi|328675413|gb|AEB28088.1| SSU ribosomal protein S3p (S3e) [Francisella cf. novicida 3523]
 gi|328676327|gb|AEB27197.1| SSU ribosomal protein S3p (S3e) [Francisella cf. novicida Fx1]
          Length = 223

 Score =  267 bits (682), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 108/227 (47%), Positives = 157/227 (69%), Gaps = 5/227 (2%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   RLG    W S W+A  S Y   L+ED+K+RE+L   L  A V+KI IER 
Sbjct: 1   MGQKVNPNGIRLGYIRDWRSTWYADSSSYATKLNEDIKVREFLHKKLAAAAVSKIQIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +N +I +++ARPG++IGKKG D+EK+R ++  +    + +++ EV KPEI+A L+A+S+
Sbjct: 61  AQNAKITIHTARPGIVIGKKGEDVEKLRAEVHKLMGIPVQINIEEVRKPEIDAKLVAESV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLE+RV+FRRAMK+A+Q+AM+ GA G+K++ SGRL GAE++R+E   +GRVPLQT RA
Sbjct: 121 AQQLEKRVMFRRAMKKAMQAAMKSGAKGIKIMVSGRLGGAEIARSEWARDGRVPLQTFRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            +DY TA A T YG  G+KV++   + +         AE +  +K +
Sbjct: 181 DVDYATAEALTTYGVIGVKVWIYKGEILPGQ-----IAEKKNNKKGA 222


>gi|300022547|ref|YP_003755158.1| ribosomal protein S3 [Hyphomicrobium denitrificans ATCC 51888]
 gi|299524368|gb|ADJ22837.1| ribosomal protein S3 [Hyphomicrobium denitrificans ATCC 51888]
          Length = 275

 Score =  267 bits (682), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 126/226 (55%), Positives = 170/226 (75%), Gaps = 1/226 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP+  R+G+N TW+SRWFA   EYG LLHED  IR ++    ++AG++K++IER 
Sbjct: 1   MGQKVNPVGLRVGINRTWDSRWFAARGEYGKLLHEDRAIRNHIMKEQREAGISKVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK CR+ V +ARPG++IGKKG  IE++R  L+ +T+SE+HL++ E+ KPEI+ATLIA+ I
Sbjct: 61  HKKCRVTVQTARPGILIGKKGEKIERLRADLAKLTSSEVHLNILEIRKPEIDATLIAEGI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRRAMKRAVQSA+R GA G+++  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLERRVAFRRAMKRAVQSALRLGAIGIRINVAGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            ID+G  VA TAYG  GIKV+V  + E+ + D      +   +++ 
Sbjct: 181 DIDFGYGVARTAYGIIGIKVWVF-KGEIIEHDPMAADKKLAEMQES 225


>gi|212637960|ref|YP_002314480.1| 30S ribosomal protein S3 [Anoxybacillus flavithermus WK1]
 gi|226697662|sp|B7GJ73|RS3_ANOFW RecName: Full=30S ribosomal protein S3
 gi|212559440|gb|ACJ32495.1| Ribosomal protein S3 [Anoxybacillus flavithermus WK1]
          Length = 218

 Score =  267 bits (682), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 104/216 (48%), Positives = 149/216 (68%), Gaps = 1/216 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI  R+G+   W SRW+A   +Y  LLHEDLKIREYL   L  A V++I IER 
Sbjct: 1   MGQKVNPIGLRIGIIRDWESRWYAE-KDYADLLHEDLKIREYLTKRLSDAAVSRIEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                I +++A+PG++IGK G+++E +RK L+ +T   +H+++ E+ KP++ A L+A++I
Sbjct: 60  ANRVNITIHTAKPGMVIGKGGSEVEALRKALNELTGKRVHINIVEIKKPDLEAKLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+Q+E RV FRRA K+A+Q  MR GA G+K + SGRL GA+++R+E Y EG VPL TLRA
Sbjct: 120 ARQIENRVSFRRAQKQAIQRTMRAGAKGIKTMVSGRLGGADIARSEHYSEGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIP 216
            IDY TA A+T YG  G+KV++   + +     T  
Sbjct: 180 DIDYATAEADTTYGKIGVKVWIYRGEVLPTKKKTEE 215


>gi|91785459|ref|YP_560665.1| 30S ribosomal protein S3 [Burkholderia xenovorans LB400]
 gi|122970104|sp|Q13TH6|RS3_BURXL RecName: Full=30S ribosomal protein S3
 gi|91689413|gb|ABE32613.1| SSU ribosomal protein S3P [Burkholderia xenovorans LB400]
          Length = 268

 Score =  267 bits (682), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 117/229 (51%), Positives = 165/229 (72%), Gaps = 2/229 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V+  W SRW+A  + + A+L ED+ +REYL+  LK A V +++IER 
Sbjct: 1   MGQKIHPTGFRLAVSRNWASRWYANNNNFAAMLQEDIGVREYLKKKLKNASVGRVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI +YS+RPG++IGKKG DIE ++ +L       +H+++ E+ KPE +A LIA SI
Sbjct: 61  AKNARITIYSSRPGVVIGKKGEDIELLKSELQRRMGVPVHVNIEEIRKPETDAQLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLERR++FRRAMKRA+Q+AMR GA G+K++++GRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 TQQLERRIMFRRAMKRAMQNAMRLGAQGIKIMSAGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTI--PAAEHRVVEKDS 227
            IDY T+ A+T YG  G+KV+V   D +  +D+ +    AE +   +++
Sbjct: 181 DIDYATSEAKTTYGIIGVKVWVYKGDTLGRNDAPVVEEVAEEKRPRRNA 229


>gi|325921487|ref|ZP_08183342.1| SSU ribosomal protein S3P [Xanthomonas gardneri ATCC 19865]
 gi|325548034|gb|EGD19033.1| SSU ribosomal protein S3P [Xanthomonas gardneri ATCC 19865]
          Length = 244

 Score =  266 bits (681), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 115/208 (55%), Positives = 155/208 (74%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K++P   RLG+   WNS+W+A  +++   L  DLK+RE L+  L QAG++KILIER 
Sbjct: 1   MGHKVHPTGIRLGIAKDWNSKWYANKADFAGYLAADLKVREMLRKKLAQAGISKILIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K  R+ +++ARPG++IGK+G DIEK+RK++S M     H++V EV KPE++A L+A+SI
Sbjct: 61  AKTARVTIHTARPGVVIGKRGEDIEKLRKEVSAMMGVPAHINVTEVRKPELDAQLVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERR++FRRAMKR+V +AMR GA G+KV  +GRLNGAE++R+E Y EGRVPL TLRA
Sbjct: 121 AQQLERRIMFRRAMKRSVGNAMRLGALGIKVNVAGRLNGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEV 208
            IDYG A A T YG  GIKV++   +  
Sbjct: 181 DIDYGFAEASTTYGIIGIKVWIYKGEVF 208


>gi|313888812|ref|ZP_07822473.1| ribosomal protein S3 [Peptoniphilus harei ACS-146-V-Sch2b]
 gi|312845181|gb|EFR32581.1| ribosomal protein S3 [Peptoniphilus harei ACS-146-V-Sch2b]
          Length = 251

 Score =  266 bits (681), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 94/214 (43%), Positives = 147/214 (68%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   R+GV   W+S+W+A    +  LL ED  IR+Y++  L  AG+AKI IER 
Sbjct: 1   MGQKVNPHGLRVGVIKDWDSKWYADKKNFADLLVEDNNIRKYVKKKLYAAGIAKIEIERA 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               +I +++A+PG++IG+ G  +E++R ++  +T+  + ++V E+  P+++A ++A+ I
Sbjct: 61  ANRVKISIHTAKPGMVIGRGGAGVEELRTEIEKLTDKSVVINVEEIKNPDLDAQIVAEGI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+ LERRV FRRAMK+A+Q  MR GA G+K   +GR+ GA+++RTE Y EG +PLQTLRA
Sbjct: 121 AEALERRVAFRRAMKQAIQRTMRQGALGIKTSVAGRVGGADMARTEGYSEGTIPLQTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDST 214
            IDYG A A+T YG  G+KV++   + + + +  
Sbjct: 181 DIDYGFAEADTTYGKLGVKVWLYKGEVLPEIEDE 214


>gi|77918321|ref|YP_356136.1| 30S ribosomal protein S3 [Pelobacter carbinolicus DSM 2380]
 gi|91207825|sp|Q3A6P1|RS3_PELCD RecName: Full=30S ribosomal protein S3
 gi|77544404|gb|ABA87966.1| SSU ribosomal protein S3P [Pelobacter carbinolicus DSM 2380]
          Length = 210

 Score =  266 bits (681), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 120/211 (56%), Positives = 159/211 (75%), Gaps = 1/211 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI FRLGV  TW+SRW+A G EY  LLHED+K+R YL+  L  AGVAKI +ER 
Sbjct: 1   MGQKVHPIGFRLGVVKTWSSRWYAEG-EYSQLLHEDIKLRNYLKKRLYHAGVAKIELERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               +I VY+ARPG+IIGKKG ++E ++K L+ +T+ E+ +++ EV KPEI+A L+A+++
Sbjct: 60  ASKAKINVYAARPGIIIGKKGAEVEALKKDLARLTDKEVFINIQEVRKPEIDAQLVAENV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV FRRAMK++V  A++FGA G+K+  SGRL GAE+SRTE Y EGRVPL TLRA
Sbjct: 120 ATQLERRVAFRRAMKKSVSMALKFGAQGIKITCSGRLGGAEMSRTEWYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDS 211
            IDYG A A+T YG  G+KV +   + +S  
Sbjct: 180 DIDYGFAEAKTTYGIIGVKVLIFKGEVLSQD 210


>gi|310659496|ref|YP_003937217.1| 30S ribosomal protein S3 [Clostridium sticklandii DSM 519]
 gi|308826274|emb|CBH22312.1| 30S ribosomal subunit protein S3 [Clostridium sticklandii]
          Length = 263

 Score =  266 bits (681), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 106/232 (45%), Positives = 156/232 (67%), Gaps = 7/232 (3%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   R+G+N  W+S+WFA   ++ A L ED KIR+ L+  L  +G+ KI IER+
Sbjct: 1   MGQKVNPHGLRVGINKDWDSKWFANKGDFAAFLQEDFKIRKVLKKKLYLSGIPKIEIERS 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               ++ +++A+PG++IGK G  IE+I+ ++  MT  ++ +++ EV +PE+++ L+A++I
Sbjct: 61  GNKVKLNIFTAKPGMVIGKGGQGIEEIKSEVEKMTGKQVFVNILEVKRPEMDSQLVAENI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A  LERRV FRRAMK+A+Q AMR GA G+KV  SGRL GAE++RTE Y EG VPL TLRA
Sbjct: 121 ALALERRVAFRRAMKQAMQRAMRSGAKGIKVSTSGRLGGAEMARTEGYSEGNVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDS-------DSTIPAAEHRVVEK 225
            IDYG A A+T YG  G+KV++   + +          DS +P  E +   +
Sbjct: 181 DIDYGFAEADTTYGKLGVKVWICKGEILPTRKGPKRELDSVMPKEEKKKPRR 232


>gi|190572950|ref|YP_001970795.1| 30S ribosomal protein S3 [Stenotrophomonas maltophilia K279a]
 gi|194364540|ref|YP_002027150.1| 30S ribosomal protein S3 [Stenotrophomonas maltophilia R551-3]
 gi|254521448|ref|ZP_05133503.1| ribosomal protein S3 [Stenotrophomonas sp. SKA14]
 gi|190010872|emb|CAQ44481.1| putative 30S ribosomal protein S3 [Stenotrophomonas maltophilia
           K279a]
 gi|194347344|gb|ACF50467.1| ribosomal protein S3 [Stenotrophomonas maltophilia R551-3]
 gi|219719039|gb|EED37564.1| ribosomal protein S3 [Stenotrophomonas sp. SKA14]
          Length = 244

 Score =  266 bits (681), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 120/232 (51%), Positives = 162/232 (69%), Gaps = 6/232 (2%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K++PI  RLG++  WNS+W+A  +E+   L  DLK+RE L+  L QAG++KILIER 
Sbjct: 1   MGHKVHPIGIRLGISKDWNSKWYANKAEFAGYLAADLKVREMLRKKLAQAGISKILIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K  R+ +++ARPG++IGK+G DIEK+RK++S M     H++V EV KPE++A L+A+SI
Sbjct: 61  AKTARVTIHTARPGVVIGKRGEDIEKLRKEVSEMMGVPAHINVTEVRKPELDAQLVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERR++FRRAMKR+V +AMR GA G+KV   GRLNGAE++R+E Y EGRVPL TLRA
Sbjct: 121 AQQLERRIMFRRAMKRSVGNAMRLGALGIKVNVGGRLNGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEV------SDSDSTIPAAEHRVVEKD 226
            IDYG A A+T YG  GIKV++   +         +     P+   R    D
Sbjct: 181 DIDYGFAEAKTTYGIIGIKVWIYKGEVFDFSQVGQEKQDDTPSRNDRHDRGD 232


>gi|187932137|ref|YP_001892122.1| 30S ribosomal protein S3 [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|226697715|sp|B2SDX9|RS3_FRATM RecName: Full=30S ribosomal protein S3
 gi|187713046|gb|ACD31343.1| 30S ribosomal protein S3 [Francisella tularensis subsp.
           mediasiatica FSC147]
          Length = 223

 Score =  266 bits (681), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 108/227 (47%), Positives = 157/227 (69%), Gaps = 5/227 (2%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   RLG    W S W+A  S Y   L+ED+K+RE+L   L  A V+KI IER 
Sbjct: 1   MGQKVNPNGIRLGYIRDWRSTWYADSSRYATKLNEDIKVREFLHKKLAAAAVSKIQIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +N +I +++ARPG++IGKKG D+EK+R ++  +    + +++ EV KPEI+A L+A+S+
Sbjct: 61  AQNAKITIHTARPGIVIGKKGDDVEKLRAEVHKLMGIPVQINIEEVRKPEIDAKLVAESV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLE+RV+FRRAMK+A+Q+AM+ GA G+K++ SGRL GAE++R+E   +GRVPLQT RA
Sbjct: 121 AQQLEKRVMFRRAMKKAMQAAMKSGAKGIKIMVSGRLGGAEIARSEWARDGRVPLQTFRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            +DY TA A T YG  G+KV++   + +         AE +  +K +
Sbjct: 181 DVDYATAEALTTYGVIGVKVWIYKGEILPGQ-----IAEKKNNKKGA 222


>gi|310644196|ref|YP_003948955.1| 30S ribosomal protein s3 [Paenibacillus polymyxa SC2]
 gi|309249147|gb|ADO58714.1| 30S ribosomal protein S3 [Paenibacillus polymyxa SC2]
          Length = 221

 Score =  266 bits (681), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 100/219 (45%), Positives = 154/219 (70%), Gaps = 2/219 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP+  R+G+   W S+W+A G ++G LL ED+KIRE+L+  LK + V+++ IER 
Sbjct: 1   MGQKVNPVGLRIGIIRDWESKWYA-GKDFGDLLLEDVKIREHLKKRLKDSAVSRVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTN-SEIHLSVNEVPKPEINATLIAQS 119
                + +++A+PG++IGK G+++E +R +++ +    ++H++++E+  PE++A L+A+S
Sbjct: 60  ANRVNVTIHTAKPGMVIGKGGSEVENLRNEITKIAGGKKVHINISEIKNPELDAILVAES 119

Query: 120 IAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           IAQQLERRV FRRA+K+A+Q  MR GA G+K    GRL GAE++R+E Y EG VPL TLR
Sbjct: 120 IAQQLERRVSFRRALKQAIQRTMRSGAKGIKTQVGGRLGGAEIARSEGYSEGTVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAA 218
           A IDYGTA A T YG  G+KV++   + +  +    P  
Sbjct: 180 ADIDYGTAEAHTTYGRLGVKVWIYRGEVLPPAKKQAPQE 218


>gi|94266247|ref|ZP_01289954.1| ribosomal protein S3 [delta proteobacterium MLMS-1]
 gi|93453173|gb|EAT03637.1| ribosomal protein S3 [delta proteobacterium MLMS-1]
          Length = 219

 Score =  266 bits (681), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 106/227 (46%), Positives = 150/227 (66%), Gaps = 9/227 (3%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI  RL +  TW+S W+A   +Y     ED  +R+YL+  L  AGV++I I RT
Sbjct: 1   MGQKVNPIGLRLNIVRTWDSIWYAD-RDYARNFLEDQSLRKYLKKRLYHAGVSRIQIART 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IGKKG +I+ ++  L   T     L + EV +PE +A L+A+++
Sbjct: 60  GDKIRVRLHTARPGVVIGKKGAEIDVLKNDLERRTGRSCALDIQEVRRPEADAQLVAENV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERR+ FRRAMK+A+  A++FGA GV++  SGRL GAE+SR E Y EGRVPL TLRA
Sbjct: 120 AQQLERRIAFRRAMKKAINMALKFGAKGVRIACSGRLGGAEMSRREWYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDYG A A+T YG  G+KV++   + +S+        E R  E+ +
Sbjct: 180 DIDYGLAEAKTTYGVIGVKVWIFKGEVLSE--------EDRRPEEQA 218


>gi|89053082|ref|YP_508533.1| 30S ribosomal protein S3 [Jannaschia sp. CCS1]
 gi|123401403|sp|Q28UV4|RS3_JANSC RecName: Full=30S ribosomal protein S3
 gi|88862631|gb|ABD53508.1| SSU ribosomal protein S3P [Jannaschia sp. CCS1]
          Length = 247

 Score =  266 bits (681), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 128/238 (53%), Positives = 172/238 (72%), Gaps = 13/238 (5%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHL------------K 48
           MG K+NPI  RL VN TW+SRW+A   +YG LL ED+KIR+Y++                
Sbjct: 1   MGHKVNPIGMRLQVNRTWDSRWYADTKDYGDLLLEDIKIRDYIKKGWWEHVAKRDKRPAG 60

Query: 49  QAGVAKILIERTHKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPK 108
            AG++KI+IER HK CR+ ++SARPG+IIGKKG DIE +RKKL+ +T+SE+HL++ E+ K
Sbjct: 61  DAGISKIIIERPHKKCRVTIHSARPGVIIGKKGADIEGLRKKLAEITDSELHLNIVEIRK 120

Query: 109 PEINATLIAQSIAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECY 168
           PE++A L+A+SIAQQLERRV FRRAMKRAVQ+AMR G+ G++V  +GRL GAE++RTE Y
Sbjct: 121 PELDARLVAESIAQQLERRVSFRRAMKRAVQNAMRMGSLGIRVNVAGRLGGAEIARTEWY 180

Query: 169 LEGRVPLQTLRAHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            EGRVPL TLRA IDY  A AETAYG  GIK ++  + E+ + D +      + +++ 
Sbjct: 181 REGRVPLHTLRADIDYAHAEAETAYGIIGIKTWIF-KGEIMEHDPSAHDRRQQELQES 237


>gi|315501427|ref|YP_004080314.1| ribosomal protein s3 [Micromonospora sp. L5]
 gi|315408046|gb|ADU06163.1| ribosomal protein S3 [Micromonospora sp. L5]
          Length = 295

 Score =  266 bits (681), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 103/220 (46%), Positives = 150/220 (68%), Gaps = 2/220 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P  FRLG++  W SRWFA    Y   + ED+KIR  +   L++AG++K+ IERT
Sbjct: 1   MGQKVHPTGFRLGISTDWKSRWFAD-KLYKDYIGEDVKIRRMMSKGLERAGISKVDIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG+KG + ++IR +L  +T  ++ L++ EV  PE +A L+AQ +
Sbjct: 60  RDRVRVDIHTARPGIVIGRKGAEADRIRGELEKLTGKQVQLNIIEVKNPESDAQLVAQGV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFG-ADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           A+QL  RV FRRAM++A+QSAM+     G++V  SGRL GAE+SRTE Y EGRVPL TLR
Sbjct: 120 AEQLSSRVSFRRAMRKAMQSAMKNPACKGIRVQVSGRLGGAEMSRTEFYREGRVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
           A+I+YG   A T +G  G+KV++   D V   ++   AA 
Sbjct: 180 ANIEYGFFEARTTFGRIGVKVWIYKGDAVPGREAPAEAAP 219


>gi|255659509|ref|ZP_05404918.1| ribosomal protein S3 [Mitsuokella multacida DSM 20544]
 gi|260848061|gb|EEX68068.1| ribosomal protein S3 [Mitsuokella multacida DSM 20544]
          Length = 222

 Score =  266 bits (681), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 104/219 (47%), Positives = 156/219 (71%), Gaps = 1/219 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   RLG+  TW+++W+A   ++   LHED+KIR+YL+  L+ AGV++I  ER+
Sbjct: 1   MGQKVNPHGIRLGIVKTWDAKWYAD-KDFADNLHEDIKIRDYLKNSLQAAGVSRIETERS 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               ++ +++A+PG++IG+ G+ IE+I++ L N T   + +++ E+ +P+++ATL+A++I
Sbjct: 60  KNRLKLTIHTAKPGMVIGRGGSGIEQIKEGLKNYTTKRVDINIAEIKQPDMDATLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERR+ FRRAMK+AV   MR GA G+K+  SGRL GAE++R E Y EG +PL TLRA
Sbjct: 120 AQQLERRIAFRRAMKQAVGRTMRLGAKGIKIACSGRLGGAEIARKESYREGSIPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
            IDYGTA A T YG  GIKV++   + + +      AAE
Sbjct: 180 DIDYGTAEAHTTYGRIGIKVWIFKGEVLPERKQAKTAAE 218


>gi|118473160|ref|YP_885825.1| 30S ribosomal protein S3 [Mycobacterium smegmatis str. MC2 155]
 gi|152060880|sp|A0QSD7|RS3_MYCS2 RecName: Full=30S ribosomal protein S3
 gi|118174447|gb|ABK75343.1| ribosomal protein S3 [Mycobacterium smegmatis str. MC2 155]
          Length = 275

 Score =  266 bits (681), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 105/228 (46%), Positives = 148/228 (64%), Gaps = 4/228 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP  FRLG+   W SRW+A   +Y   + ED+ IR+ L   L++AG+A + IERT
Sbjct: 1   MGQKINPHGFRLGITTEWKSRWYAD-KQYKDYVKEDVAIRKLLATGLERAGIADVEIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG++GT+ ++IR  L  +T  ++ L++ EV  PE  A L+AQ +
Sbjct: 60  RDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTGKQVQLNILEVKNPESQAQLVAQGV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAM-RFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           A+QL  RV FRRAM++A+QSAM +    G++V  SGRL GAE+SR+E Y EGRVPL TLR
Sbjct: 120 AEQLSNRVAFRRAMRKAIQSAMRQPNVKGIRVQCSGRLGGAEMSRSEFYREGRVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE--HRVVEK 225
           A IDYG   A+T +G  G+KV++   D V        AA    R   +
Sbjct: 180 ADIDYGLYEAKTTFGRIGVKVWIYKGDIVGGKRELAAAAPASDRPRRE 227


>gi|118465225|ref|YP_883600.1| 30S ribosomal protein S3 [Mycobacterium avium 104]
 gi|152060876|sp|A0QL12|RS3_MYCA1 RecName: Full=30S ribosomal protein S3
 gi|118166512|gb|ABK67409.1| ribosomal protein S3 [Mycobacterium avium 104]
          Length = 280

 Score =  266 bits (680), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 102/215 (47%), Positives = 143/215 (66%), Gaps = 2/215 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP  FRLG+   W SRW+A   +Y   + ED+ IR  L   L++AG+A + IERT
Sbjct: 1   MGQKINPHGFRLGITTDWKSRWYAD-KQYADYVKEDVAIRRLLSTGLERAGIADVEIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG++GT+ ++IR  L  +T  ++ L++ EV  PE  A L+AQ +
Sbjct: 60  RDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTGKQVQLNILEVRNPESQAQLVAQGV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAM-RFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           A+QL  RV FRRAM++A+QSAM +    G++V  SGRL GAE+SR+E Y EGRVPL TLR
Sbjct: 120 AEQLSNRVAFRRAMRKAIQSAMRQPNVKGIRVQCSGRLGGAEMSRSEFYREGRVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDST 214
           A IDYG   A+T +G  G+KV++   D V      
Sbjct: 180 ADIDYGLYEAKTTFGRIGVKVWIYKGDVVGGKREL 214


>gi|145596428|ref|YP_001160725.1| ribosomal protein S3 [Salinispora tropica CNB-440]
 gi|189045333|sp|A4XBP0|RS3_SALTO RecName: Full=30S ribosomal protein S3
 gi|145305765|gb|ABP56347.1| SSU ribosomal protein S3P [Salinispora tropica CNB-440]
          Length = 288

 Score =  266 bits (680), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 104/227 (45%), Positives = 151/227 (66%), Gaps = 2/227 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P  FRLG++  W SRWFA    Y   + ED+KIR  +   L++AG++K+ IERT
Sbjct: 1   MGQKVHPHGFRLGISTDWKSRWFAD-KLYKDYVGEDVKIRRMMSKGLERAGISKVDIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG+KG + ++IR KL  +T  ++ L++ EV  PE +A L+AQ +
Sbjct: 60  RDRVRVDIHTARPGIVIGRKGAEADRIRGKLEKLTGKQVQLNIIEVKSPESDAQLVAQGV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFG-ADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           A+QL  RV FRRAM++A+QSAM+     G++V  SGRL GAE+SRTE Y EGRVPL TLR
Sbjct: 120 AEQLSSRVSFRRAMRKAMQSAMKNPVCKGIRVQVSGRLGGAEMSRTEFYREGRVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
           A+I+YG   A T +G  G+KV++   D V   ++   A      E+ 
Sbjct: 180 ANIEYGFFEARTTFGRIGVKVWIYKGDAVPGRETPAEAPSRPRRERG 226


>gi|238928149|ref|ZP_04659909.1| 30S ribosomal protein s3 [Selenomonas flueggei ATCC 43531]
 gi|238884109|gb|EEQ47747.1| 30S ribosomal protein s3 [Selenomonas flueggei ATCC 43531]
          Length = 223

 Score =  266 bits (680), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 101/222 (45%), Positives = 154/222 (69%), Gaps = 1/222 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   RLG+   W++RW+A    +   LHED+KIR+YL+  L+ AGV ++  ER+
Sbjct: 1   MGQKVNPHGIRLGIVKDWDARWYAD-KNFAQNLHEDIKIRDYLKKSLQTAGVPRVETERS 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               ++ +++A+PG++IG+ G+ IE+I++ L N+T+  + +++ E+ +P+++ATL+A++I
Sbjct: 60  KNRLKLTIHTAKPGMVIGRGGSGIEQIKEGLKNLTDKRVDINIAEIKQPDLDATLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERR+ FRRAMK+AV   MR GA G+K+  SGRL GAE++R E Y EG +PL TLRA
Sbjct: 120 AAQLERRIAFRRAMKQAVGRTMRLGAKGIKIAVSGRLGGAEIARRESYREGSIPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRV 222
            IDYGTA A T YG  GIKV++   + + D  +     + R 
Sbjct: 180 DIDYGTAEAHTTYGRIGIKVWIFKGEVLPDKKNQPKNGKERS 221


>gi|21230370|ref|NP_636287.1| 30S ribosomal protein S3 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66769636|ref|YP_244398.1| 30S ribosomal protein S3 [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|188992848|ref|YP_001904858.1| 30S ribosomal protein S3 [Xanthomonas campestris pv. campestris
           str. B100]
 gi|27734500|sp|Q8PC44|RS3_XANCP RecName: Full=30S ribosomal protein S3
 gi|81304409|sp|Q4URE5|RS3_XANC8 RecName: Full=30S ribosomal protein S3
 gi|21111926|gb|AAM40211.1| 30S ribosomal protein S3 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66574968|gb|AAY50378.1| 30S ribosomal protein S3 [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|167734608|emb|CAP52818.1| 30S ribosomal protein S3 [Xanthomonas campestris pv. campestris]
          Length = 244

 Score =  266 bits (680), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 116/208 (55%), Positives = 156/208 (75%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K++P   RLG+   WNS+W+A  +++ A L  DLK+RE L+  L QAG++KILIER 
Sbjct: 1   MGHKVHPTGIRLGIAKDWNSKWYASKADFAAYLAADLKVREMLRKKLAQAGISKILIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K  R+ +++ARPG++IGK+G DIEK+RK++S M     H++V EV KPE++A L+A+SI
Sbjct: 61  AKTARVTIHTARPGVVIGKRGEDIEKLRKEVSEMMGVPAHINVTEVRKPELDAQLVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERR++FRRAMKR+V +AMR GA G+KV  +GRLNGAE++R+E Y EGRVPL TLRA
Sbjct: 121 AQQLERRIMFRRAMKRSVGNAMRLGALGIKVNVAGRLNGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEV 208
            IDYG A A T YG  GIKV++   +  
Sbjct: 181 DIDYGFAEASTTYGIIGIKVWIYKGEVF 208


>gi|118595329|ref|ZP_01552676.1| 30S ribosomal protein S3 [Methylophilales bacterium HTCC2181]
 gi|118441107|gb|EAV47734.1| 30S ribosomal protein S3 [Methylophilales bacterium HTCC2181]
          Length = 292

 Score =  266 bits (680), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 122/226 (53%), Positives = 164/226 (72%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI FRLGV   W+S+W++    + +LL  D+K+RE+L   L  A V++I+IER 
Sbjct: 1   MGQKINPIGFRLGVTKDWSSKWYSNSKNFASLLQNDIKVREFLNKKLANAAVSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN +I +YSARPG++IGKKG DIE +R  L ++    + L++ E+ KPE++ATLIAQSI
Sbjct: 61  AKNAKITIYSARPGIVIGKKGEDIETLRSSLQSLMGIPVQLNIEEIRKPEVDATLIAQSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLE+RV+FRRAMKRA+Q+AMR GA GVK+++SGRLNG E++R+E Y EGRVPL TLRA
Sbjct: 121 AQQLEKRVMFRRAMKRAMQNAMRLGAQGVKIMSSGRLNGIEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            IDYG A A+T YG  GIKV++   +   +   T+      V E+ 
Sbjct: 181 DIDYGVARAQTTYGIIGIKVWIFKGERFEEPAKTVNLDNKEVAEEK 226


>gi|302869966|ref|YP_003838603.1| 30S ribosomal protein S3 [Micromonospora aurantiaca ATCC 27029]
 gi|302572825|gb|ADL49027.1| ribosomal protein S3 [Micromonospora aurantiaca ATCC 27029]
          Length = 295

 Score =  266 bits (680), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 103/220 (46%), Positives = 150/220 (68%), Gaps = 2/220 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P  FRLG++  W SRWFA    Y   + ED+KIR  +   L++AG++K+ IERT
Sbjct: 1   MGQKVHPTGFRLGISTDWKSRWFAD-KLYKDYIGEDVKIRRMMSKGLERAGISKVDIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG+KG + ++IR +L  +T  ++ L++ EV  PE +A L+AQ +
Sbjct: 60  RDRVRVDIHTARPGIVIGRKGAEADRIRGELEKLTGKQVQLNIIEVKNPESDAQLVAQGV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFG-ADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           A+QL  RV FRRAM++A+QSAM+     G++V  SGRL GAE+SRTE Y EGRVPL TLR
Sbjct: 120 AEQLSSRVSFRRAMRKAMQSAMKNPACKGIRVQVSGRLGGAEMSRTEFYREGRVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
           A+I+YG   A T +G  G+KV++   D V   ++   AA 
Sbjct: 180 ANIEYGFFEARTTFGRIGVKVWIYKGDAVPGREAPAEAAP 219


>gi|89255676|ref|YP_513037.1| 30S ribosomal protein S3 [Francisella tularensis subsp. holarctica
           LVS]
 gi|115314177|ref|YP_762900.1| 30S ribosomal protein S3 [Francisella tularensis subsp. holarctica
           OSU18]
 gi|134302579|ref|YP_001122550.1| 30S ribosomal protein S3 [Francisella tularensis subsp. tularensis
           WY96-3418]
 gi|156501626|ref|YP_001427691.1| 30S ribosomal protein S3 [Francisella tularensis subsp. holarctica
           FTNF002-00]
 gi|167009883|ref|ZP_02274814.1| ribosomal protein S3 [Francisella tularensis subsp. holarctica
           FSC200]
 gi|254368628|ref|ZP_04984643.1| hypothetical protein FTAG_01721 [Francisella tularensis subsp.
           holarctica FSC022]
 gi|290953206|ref|ZP_06557827.1| 30S ribosomal protein S3 [Francisella tularensis subsp. holarctica
           URFT1]
 gi|295313574|ref|ZP_06804163.1| 30S ribosomal protein S3 [Francisella tularensis subsp. holarctica
           URFT1]
 gi|122325782|sp|Q0BNS1|RS3_FRATO RecName: Full=30S ribosomal protein S3
 gi|123094541|sp|Q2A5G4|RS3_FRATH RecName: Full=30S ribosomal protein S3
 gi|152060862|sp|A4IZS8|RS3_FRATW RecName: Full=30S ribosomal protein S3
 gi|189045009|sp|A7N9T2|RS3_FRATF RecName: Full=30S ribosomal protein S3
 gi|89143507|emb|CAJ78683.1| 30S ribosomal protein S3 [Francisella tularensis subsp. holarctica
           LVS]
 gi|115129076|gb|ABI82263.1| ribosomal protein S3 [Francisella tularensis subsp. holarctica
           OSU18]
 gi|134050356|gb|ABO47427.1| ribosomal protein S3 [Francisella tularensis subsp. tularensis
           WY96-3418]
 gi|156252229|gb|ABU60735.1| ribosomal protein S3 [Francisella tularensis subsp. holarctica
           FTNF002-00]
 gi|157121536|gb|EDO65721.1| hypothetical protein FTAG_01721 [Francisella tularensis subsp.
           holarctica FSC022]
          Length = 223

 Score =  266 bits (680), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 108/227 (47%), Positives = 157/227 (69%), Gaps = 5/227 (2%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   RLG    W S W+A  S Y   L+ED+K+RE+L   L  A V+KI IER 
Sbjct: 1   MGQKVNPNGIRLGYIRDWRSTWYADSSRYATKLNEDIKVREFLHKKLAAAAVSKIQIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +N +I +++ARPG++IGKKG D+EK+R ++  +    + +++ EV KPEI+A L+A+S+
Sbjct: 61  AQNAKITIHTARPGIVIGKKGEDVEKLRAEVHKLMGIPVQINIEEVRKPEIDAKLVAESV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLE+RV+FRRAMK+A+Q+AM+ GA G+K++ SGRL GAE++R+E   +GRVPLQT RA
Sbjct: 121 AQQLEKRVMFRRAMKKAMQAAMKSGAKGIKIMVSGRLGGAEIARSEWARDGRVPLQTFRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            +DY TA A T YG  G+KV++   + +         AE +  +K +
Sbjct: 181 DVDYATAEALTTYGVIGVKVWIYKGEILPGQ-----IAEKKNNKKGA 222


>gi|269140565|ref|YP_003297266.1| 30S ribosomal protein S3 [Edwardsiella tarda EIB202]
 gi|267986226|gb|ACY86055.1| 30S ribosomal protein S3 [Edwardsiella tarda EIB202]
 gi|304560353|gb|ADM43017.1| SSU ribosomal protein S3p (S3e) [Edwardsiella tarda FL6-60]
          Length = 233

 Score =  266 bits (680), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 110/230 (47%), Positives = 156/230 (67%), Gaps = 4/230 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS W+A   E+   L  D K+R++L   L++A V++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNSTWYANTKEFADNLDSDFKVRQFLNKELEKASVSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+RK ++ +      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRKGVAEIAGVPAQINIAEVRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
             QL RRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 TSQLVRRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD----SDSTIPAAEHRVVEKD 226
            IDY T+ A T YG  G+KV++   + +           PAA+ +  ++ 
Sbjct: 181 DIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEKPAAQPKKQQRK 230


>gi|313895402|ref|ZP_07828959.1| ribosomal protein S3 [Selenomonas sp. oral taxon 137 str. F0430]
 gi|312976297|gb|EFR41755.1| ribosomal protein S3 [Selenomonas sp. oral taxon 137 str. F0430]
          Length = 223

 Score =  266 bits (680), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 102/222 (45%), Positives = 155/222 (69%), Gaps = 1/222 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   RLG+   W++RW+A   ++   LHED+KIR+YL+  L+ AGV ++  ER+
Sbjct: 1   MGQKVNPHGIRLGIVKDWDARWYAD-KDFAQNLHEDIKIRDYLKKSLQTAGVPRVETERS 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               ++ +++A+PG++IG+ G+ IE+I++ L  +T+  + +++ E+ +P+++ATL+A++I
Sbjct: 60  KNRLKLTIHTAKPGMVIGRGGSGIEQIKEGLKGLTDKRVDINIAEIKQPDLDATLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERR+ FRRAMK+AV   MR GA G+K+  SGRL GAE++R E Y EG +PL TLRA
Sbjct: 120 AAQLERRIAFRRAMKQAVGRTMRLGAKGIKIAVSGRLGGAEIARRESYREGSIPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRV 222
            IDYGTA A T YG  GIKV++   + + D      AA+ R 
Sbjct: 180 DIDYGTAEAHTTYGRIGIKVWIFKSEVLPDKKQQPKAAKERS 221


>gi|152993899|ref|YP_001359620.1| 30S ribosomal protein S3 [Sulfurovum sp. NBC37-1]
 gi|189045340|sp|A6QCQ4|RS3_SULNB RecName: Full=30S ribosomal protein S3
 gi|151425760|dbj|BAF73263.1| 30S ribosomal protein S3 [Sulfurovum sp. NBC37-1]
          Length = 232

 Score =  266 bits (679), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 112/227 (49%), Positives = 152/227 (66%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI  RLG+N  W SRWF         + ED KIR++L+  L  AGV+ I+IERT
Sbjct: 1   MGQKVNPIGLRLGINRNWESRWFPAKERTADFIAEDYKIRKFLKKELFYAGVSNIIIERT 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K  RI + +ARPG+IIGKKG DIEK++  L  M   ++ +++ E  +P+ +  L A+++
Sbjct: 61  AKKLRINIITARPGIIIGKKGADIEKLKTTLVKMLGKDVAINIKEEKRPQASGQLAAENV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV FRRAMK+ +Q A++ GA G+K+  SGRL GAE++RTE YLEGRVPL TLRA
Sbjct: 121 ATQLERRVAFRRAMKKVIQGALKSGAKGIKISVSGRLGGAEMARTEWYLEGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDYG A A+T YG  GIKV++   + ++      PA E +   + S
Sbjct: 181 KIDYGFAEAQTTYGIIGIKVWIFKGEVLAKGIQPEPAEEKKGGRRPS 227


>gi|23097580|ref|NP_691046.1| 30S ribosomal protein S3 [Oceanobacillus iheyensis HTE831]
 gi|27734493|sp|P59182|RS3_OCEIH RecName: Full=30S ribosomal protein S3
 gi|22775803|dbj|BAC12081.1| 30S ribosomal protein S3 [Oceanobacillus iheyensis HTE831]
          Length = 213

 Score =  266 bits (679), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 105/211 (49%), Positives = 148/211 (70%), Gaps = 1/211 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP   R+G+   W S+W+A G +Y  LLHED+KIREYL+  L  A V+ I IER 
Sbjct: 1   MGQKINPTGLRVGIIKDWESKWYA-GKDYADLLHEDIKIREYLENRLSTAAVSSIEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                I +++ +PG++IGK G+++E +RK L+N+T   +H+++ E+ K +++ATL+A SI
Sbjct: 60  ANRVNITIHTGKPGMVIGKGGSEVEALRKSLNNLTGKRVHINIVEIKKVDLDATLVADSI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE R+ FRRA K+A+Q AMR GA G+K   SGRL GA+++R E Y EG VPL TLRA
Sbjct: 120 ARQLENRISFRRAQKQAIQRAMRGGAKGIKTQVSGRLGGADIARAEHYSEGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDS 211
            IDYGTA A+T YG  G+KV++   + +   
Sbjct: 180 DIDYGTAEADTTYGKLGVKVWIYRGEVLPTK 210


>gi|269104018|ref|ZP_06156715.1| SSU ribosomal protein S3p (S3e) [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268163916|gb|EEZ42412.1| SSU ribosomal protein S3p (S3e) [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 232

 Score =  266 bits (679), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 109/230 (47%), Positives = 157/230 (68%), Gaps = 3/230 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WN+ WFA   ++   L  D K+R++L   L +A +++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNTTWFANSQDFADNLDGDFKVRQFLTKELAKASLSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  ++ +      +++ EV KPE++  L+A SI
Sbjct: 61  AKSIRVTIHTARPGVVIGKKGEDVEKLRAAVAKIAGVPAQINIAEVRKPELDGQLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEV---SDSDSTIPAAEHRVVEKDS 227
            IDY T+ A T YG  GIKV++   + +     +++  P A+    ++ S
Sbjct: 181 DIDYATSSAHTQYGVIGIKVWIFKGEVLGGMPAANAVEPKADKPKKQRKS 230


>gi|149376678|ref|ZP_01894437.1| 30S ribosomal protein S3 [Marinobacter algicola DG893]
 gi|149359051|gb|EDM47516.1| 30S ribosomal protein S3 [Marinobacter algicola DG893]
          Length = 227

 Score =  266 bits (679), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 107/213 (50%), Positives = 155/213 (72%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K+NP   RLGV    NS W+A  +EY   L  D+++RE+L   L +A V+KI+IER 
Sbjct: 1   MGHKVNPTGMRLGVIKEHNSVWYAEKAEYANNLLNDIQVREFLDKRLVKASVSKIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +N RI +++ARPG++IGKKG D++++R+++S+M    +H+++ EV KP+++A L+AQ++
Sbjct: 61  AQNARITIHTARPGIVIGKKGEDVDRLRREVSDMMGVPVHINIEEVRKPDLDARLVAQNV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+K+   GRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 AGQLERRVMFRRAMKRAVQNAMRQGAKGIKIQVGGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDS 213
            IDY T  A+T YG  G+KV++   + +   + 
Sbjct: 181 DIDYSTYEAKTTYGIIGVKVWIFKGEILGGMEQ 213


>gi|226939192|ref|YP_002794263.1| 30S ribosomal protein S3 [Laribacter hongkongensis HLHK9]
 gi|254764534|sp|C1DAS3|RS3_LARHH RecName: Full=30S ribosomal protein S3
 gi|226714116|gb|ACO73254.1| RpsC [Laribacter hongkongensis HLHK9]
          Length = 233

 Score =  266 bits (679), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 115/226 (50%), Positives = 157/226 (69%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V   W+S+WFA    +  +L ED+ +RE+L+  LK A V++I IER 
Sbjct: 1   MGQKIDPRGFRLAVTRNWSSKWFANSQNFPGMLKEDIDVREFLKAKLKNASVSRITIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ RI +++ARPG++IGKKG DIE ++++L       +H+++ EV KPEI+A +IA  I
Sbjct: 61  AKSARITIHTARPGVVIGKKGEDIEVLKQELQKRMGVPVHVNIEEVRKPEIDAQIIADGI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLE+RV+FRRAMKRA+Q+AMR GA G+K+++SGRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 ASQLEKRVMFRRAMKRAMQNAMRLGALGIKIMSSGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            +DY T+ A T YG  GIKV+V   D      S  P    + + K 
Sbjct: 181 DVDYATSEAHTTYGVIGIKVWVYKGDMKPGQVSAEPTQPEKKMRKG 226


>gi|33357880|pdb|1P6G|C Chain C, Real Space Refined Coordinates Of The 30s Subunit Fitted
           Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp
           State Of E. Coli 70s Ribosome
 gi|33357957|pdb|1P87|C Chain C, Real Space Refined Coordinates Of The 30s Subunit Fitted
           Into The Low Resolution Cryo-Em Map Of The
           Initiation-Like State Of E. Coli 70s Ribosome
 gi|83754041|pdb|2AVY|C Chain C, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli At 3.5 A Resolution. This File Contains
           The 30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 gi|83754097|pdb|2AW7|C Chain C, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli At 3.5 A Resolution. This File Contains
           The 30s Subunit Of The Second 70s Ribosome. The Entire
           Crystal Structure Contains Two 70s Ribosomes And Is
           Described In Remark 400.
 gi|118138055|pdb|2I2P|C Chain C, Crystal Structure Of Ribosome With Messenger Rna And The
           Anticodon Stem-Loop Of P-Site Trna. This File Contains
           The 30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 gi|118138126|pdb|2I2U|C Chain C, Crystal Structure Of Ribosome With Messenger Rna And The
           Anticodon Stem-Loop Of P-Site Trna. This File Contains
           The 30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 gi|157836025|pdb|2QOU|C Chain C, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin. This
           File Contains The 30s Subunit Of The First 70s Ribosome,
           With Spectinomycin Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes.
 gi|157836088|pdb|2QOW|C Chain C, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin. This
           File Contains The 30s Subunit Of The Second 70s
           Ribosome, With Spectinomycin Bound. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 gi|157836129|pdb|2QOY|C Chain C, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin And
           Neomycin. This File Contains The 30s Subunit Of The
           First 70s Ribosome, With Spectinomycin And Neomycin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes.
 gi|157836192|pdb|2QP0|C Chain C, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin And
           Neomycin. This File Contains The 30s Subunit Of The
           Second 70s Ribosome, With Spectinomycin And Neomycin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes.
 gi|158429700|pdb|2QAL|C Chain C, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Neomycin. This File
           Contains The 30s Subunit Of The First 70s Ribosome, With
           Neomycin Bound. The Entire Crystal Structure Contains
           Two 70s Ribosomes And Is Described In Remark 400.
 gi|158429752|pdb|2QAN|C Chain C, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Neomycin. This File
           Contains The 30s Subunit Of The Second 70s Ribosome,
           With Neomycin Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes And Is Described In Remark
           400.
 gi|158429810|pdb|2QB9|C Chain C, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin. This File
           Contains The 30s Subunit Of The First 70s Ribosome, With
           Gentamicin Bound. The Entire Crystal Structure Contains
           Two 70s Ribosomes And Is Described In Remark 400.
 gi|158429862|pdb|2QBB|C Chain C, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin. This File
           Contains The 30s Subunit Of The Second 70s Ribosome,
           With Gentamicin Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes And Is Described In Remark
           400.
 gi|158429914|pdb|2QBD|C Chain C, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Ribosome Recycling
           Factor (Rrf). This File Contains The 30s Subunit Of The
           First 70s Ribosome. The Entire Crystal Structure
           Contains Two 70s Ribosomes And Is Described In Remark
           400.
 gi|158429966|pdb|2QBF|C Chain C, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Ribosome Recycling
           Factor (Rrf). This File Contains The 30s Subunit Of The
           Second 70s Ribosome. The Entire Crystal Structure
           Contains Two 70s Ribosomes And Is Described In Remark
           400.
 gi|158430020|pdb|2QBH|C Chain C, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin And Ribosome
           Recycling Factor (Rrf). This File Contains The 30s
           Subunit Of The First 70s Ribosome, With Gentamicin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes And Is Described In Remark 400.
 gi|158430073|pdb|2QBJ|C Chain C, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin And Ribosome
           Recycling Factor (Rrf). This File Contains The 30s
           Subunit Of The Second 70s Ribosome, With Gentamicin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes And Is Described In Remark 400.
 gi|158431373|pdb|2Z4K|C Chain C, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Paromomycin And
           Ribosome Recycling Factor (Rrf). This File Contains The
           30s Subunit Of The First 70s Ribosome, With Paromomycin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes And Is Described In Remark 400.
 gi|158431426|pdb|2Z4M|C Chain C, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Paromomycin And
           Ribosome Recycling Factor (Rrf). This File Contains The
           30s Subunit Of The Second 70s Ribosome, With Paromomycin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes And Is Described In Remark 400.
 gi|168988790|pdb|2VHO|C Chain C, Structure Of Pdf Binding Helix In Complex With The
           Ribosome (Part 3 Of 4)
 gi|168988811|pdb|2VHP|C Chain C, Structure Of Pdf Binding Helix In Complex With The
           Ribosome (Part 4 Of 4)
 gi|197107280|pdb|3DF1|C Chain C, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Hygromycin B. This File
           Contains The 30s Subunit Of The First 70s Ribosome, With
           Hygromycin B Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes.
 gi|197107332|pdb|3DF3|C Chain C, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Hygromycin B. This File
           Contains The 30s Subunit Of The Second 70s Ribosome,
           With Hygromycin B Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes.
 gi|329665994|pdb|3J00|C Chain C, Structure Of The Ribosome-Secye Complex In The Membrane
           Environment
          Length = 232

 Score =  266 bits (679), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 112/229 (48%), Positives = 156/229 (68%), Gaps = 4/229 (1%)

Query: 2   GQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERTH 61
           GQK++P   RLG+   WNS WFA   E+   L  D K+R+YL   L +A V++I+IER  
Sbjct: 1   GQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLTKELAKASVSRIVIERPA 60

Query: 62  KNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSIA 121
           K+ R+ +++ARPG++IGKKG D+EK+RK ++++      +++ EV KPE++A L+A SI 
Sbjct: 61  KSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQINIAEVRKPELDAKLVADSIT 120

Query: 122 QQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRAH 181
            QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA 
Sbjct: 121 SQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRAD 180

Query: 182 IDYGTAVAETAYGSCGIKVYVSLRDEVSD----SDSTIPAAEHRVVEKD 226
           IDY T+ A T YG  G+KV++   + +           PAA+ +  ++ 
Sbjct: 181 IDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEKPAAQPKKQQRK 229


>gi|85709051|ref|ZP_01040117.1| 30S ribosomal protein S3 [Erythrobacter sp. NAP1]
 gi|85690585|gb|EAQ30588.1| 30S ribosomal protein S3 [Erythrobacter sp. NAP1]
          Length = 231

 Score =  266 bits (679), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 127/225 (56%), Positives = 168/225 (74%), Gaps = 4/225 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK NPI  RL +N TW+SRW+A G +Y  LL ED+K+R+Y+   L QA ++K++IER 
Sbjct: 1   MGQKSNPIGLRLQINRTWDSRWYAEGRDYAGLLAEDIKMRKYILESLPQAAISKVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K CR+ +Y+ARPG+IIGKKG DIEK+R KLS MT+SE+ L++ E+ KPEI+A L+AQ +
Sbjct: 61  AKLCRVSIYAARPGVIIGKKGADIEKLRAKLSTMTSSEVKLNIVEIRKPEIDAKLVAQGV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QL RRV FRRAMKRAVQSA+R GA+G+K++  GRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 ADQLVRRVAFRRAMKRAVQSALRLGAEGIKIVCGGRLGGAEIARVEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
           +IDY    A TAYG  GIKV++  + E+   D   P A+ R++ +
Sbjct: 181 NIDYAETEALTAYGIIGIKVWIF-KGEILAHD---PTAQDRLMME 221


>gi|108797992|ref|YP_638189.1| 30S ribosomal protein S3 [Mycobacterium sp. MCS]
 gi|119867088|ref|YP_937040.1| 30S ribosomal protein S3 [Mycobacterium sp. KMS]
 gi|126433654|ref|YP_001069345.1| 30S ribosomal protein S3 [Mycobacterium sp. JLS]
 gi|123070587|sp|Q1BDA1|RS3_MYCSS RecName: Full=30S ribosomal protein S3
 gi|152060881|sp|A3PVC7|RS3_MYCSJ RecName: Full=30S ribosomal protein S3
 gi|152060882|sp|A1UBP2|RS3_MYCSK RecName: Full=30S ribosomal protein S3
 gi|108768411|gb|ABG07133.1| SSU ribosomal protein S3P [Mycobacterium sp. MCS]
 gi|119693177|gb|ABL90250.1| SSU ribosomal protein S3P [Mycobacterium sp. KMS]
 gi|126233454|gb|ABN96854.1| SSU ribosomal protein S3P [Mycobacterium sp. JLS]
          Length = 287

 Score =  266 bits (679), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 105/229 (45%), Positives = 147/229 (64%), Gaps = 5/229 (2%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP  FRLG+   W SRW+A   +Y   + ED+ IR  L   L++AG+A + IERT
Sbjct: 1   MGQKINPHGFRLGITTDWKSRWYAD-KQYKDYVKEDVAIRRLLATGLERAGIADVEIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG++GT+ ++IR  L  +T  ++ L++ EV  PE  A L+AQ +
Sbjct: 60  RDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTKKQVQLNILEVKNPESVAQLVAQGV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAM-RFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           A+QL  RV FRRAM++A+QSAM +    G++V  SGRL GAE+SR+E Y EGRVPL TLR
Sbjct: 120 AEQLSNRVAFRRAMRKAIQSAMRQPNVKGIRVQCSGRLGGAEMSRSEFYREGRVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDS---TIPAAEHRVVEK 225
           A IDYG   A+T +G  G+KV++   D V          PA   R   +
Sbjct: 180 ADIDYGLYEAKTTFGRIGVKVWIYKGDIVGGKRELTAAAPAGADRPRRE 228


>gi|152964663|ref|YP_001360447.1| ribosomal protein S3 [Kineococcus radiotolerans SRS30216]
 gi|189045014|sp|A6W5U4|RS3_KINRD RecName: Full=30S ribosomal protein S3
 gi|151359180|gb|ABS02183.1| ribosomal protein S3 [Kineococcus radiotolerans SRS30216]
          Length = 282

 Score =  266 bits (679), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 101/229 (44%), Positives = 150/229 (65%), Gaps = 4/229 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFAR----GSEYGALLHEDLKIREYLQCHLKQAGVAKIL 56
           MGQK+NP  FRLG+     SRWFA     G  Y   + ED+ IR  +   +++AG++K+ 
Sbjct: 1   MGQKVNPFGFRLGITTDHRSRWFADSTKTGQRYADYVKEDVAIRRLMSKGMERAGISKVE 60

Query: 57  IERTHKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLI 116
           IERT    R+ +++ARPG++IG++G + ++IR +L  +T  ++ L++ EV  PE++A L+
Sbjct: 61  IERTRDRVRVDIHTARPGIVIGRRGAEADRIRTELEKLTGKQVQLNILEVKNPEVDAQLV 120

Query: 117 AQSIAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQ 176
           AQ +A+QL  RV FRRAM++ +Q+ MR GA G++V  +GRL GAE+SR+E Y EGRVPL 
Sbjct: 121 AQGVAEQLASRVSFRRAMRKGMQTTMRSGAKGIRVQCAGRLGGAEMSRSEFYREGRVPLH 180

Query: 177 TLRAHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
           TLRA+IDYG   A T +G  G+KV++   D  S   +   AA  R   +
Sbjct: 181 TLRANIDYGFYEARTTFGRIGVKVWIYHGDITSRELAQSQAAAPRAPRR 229


>gi|146328784|ref|YP_001210145.1| 30S ribosomal protein S3 [Dichelobacter nodosus VCS1703A]
 gi|172047328|sp|A5EX93|RS3_DICNV RecName: Full=30S ribosomal protein S3
 gi|146232254|gb|ABQ13232.1| 30S ribosomal protein S3 [Dichelobacter nodosus VCS1703A]
          Length = 239

 Score =  266 bits (679), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 112/227 (49%), Positives = 157/227 (69%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+PI FRLGV+  W S+W+A G++Y   L +D ++RE+L+  L  A V+KI IER 
Sbjct: 1   MGQKIHPIGFRLGVSKDWTSKWYAEGTDYANYLEKDFEVREFLRKKLAHASVSKIQIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               +I +++ARPG++IGKKG DIE ++K++  +      +++ E+ +PE+++ L+A +I
Sbjct: 61  RNGAQITIFTARPGIVIGKKGEDIEILKKEVGKILGVATSINIEEIRRPELDSYLVADNI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLERRV+FRRAMKRAV S MR GA GVKV  SGRLNGAE++RTE Y EGRVPL TLRA
Sbjct: 121 AKQLERRVMFRRAMKRAVASTMRLGAVGVKVSISGRLNGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDYG A A T YG  G+KV++   + +   ++          EK +
Sbjct: 181 DIDYGLAEAYTTYGVIGVKVWIFKGENLEGLEADTSNTNELSDEKRN 227


>gi|37528537|ref|NP_931882.1| 30S ribosomal protein S3 [Photorhabdus luminescens subsp. laumondii
           TTO1]
 gi|61215674|sp|Q7MYF7|RS3_PHOLL RecName: Full=30S ribosomal protein S3
 gi|36787975|emb|CAE17092.1| 30S ribosomal protein S3 [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 233

 Score =  266 bits (679), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 109/230 (47%), Positives = 158/230 (68%), Gaps = 4/230 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WNS W+A   E+   L  D K+R+YL+  L +A +++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNSTWYANTKEFADNLDSDFKVRQYLKKELAKASISRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+RK ++ +      ++++EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRKTVAEIAGVPAQINISEVRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
             QLERR++FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 TSQLERRIMFRRAMKRAVQNAMRQGAKGIKVEVSGRLGGAEIARPEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD----SDSTIPAAEHRVVEKD 226
            IDY T+ A T YG  G+KV++   + +        +  PAA+ +  ++ 
Sbjct: 181 DIDYNTSEAHTTYGVLGVKVWIFKGEILGGMAAVEQAEKPAAQPKKQQRK 230


>gi|152998265|ref|YP_001343100.1| 30S ribosomal protein S3 [Marinomonas sp. MWYL1]
 gi|150839189|gb|ABR73165.1| ribosomal protein S3 [Marinomonas sp. MWYL1]
          Length = 226

 Score =  266 bits (679), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 109/226 (48%), Positives = 152/226 (67%), Gaps = 2/226 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+     S W+A    Y  LL  DL++R +L+  L QA V++I I+R 
Sbjct: 1   MGQKVHPTGIRLGIVKDHTSTWYANNQNYSKLLLNDLQVRAFLEKKLVQASVSRIEIQRP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +  RI +++ARPG++IGKKG D+EK+R  +S M    +H+++ E+ KPE++A L+AQ+I
Sbjct: 61  AQTARITIHTARPGIVIGKKGEDVEKLRNAVSEMMGVPVHINIEEIRKPEMDAKLVAQNI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQNAMRAGAKGIKVQVSGRLGGAEIARAEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPA--AEHRVVE 224
            IDY T  A T YG  G+KV++   + +   +       A+ +  +
Sbjct: 181 DIDYATYEAATTYGIIGVKVWIFKGEILGGIEQVRADKGAQKKKSK 226


>gi|260893366|ref|YP_003239463.1| ribosomal protein S3 [Ammonifex degensii KC4]
 gi|260865507|gb|ACX52613.1| ribosomal protein S3 [Ammonifex degensii KC4]
          Length = 220

 Score =  266 bits (679), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 98/211 (46%), Positives = 146/211 (69%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WN++W+A   ++   L ED+KIR +++     AGV+ I+IER 
Sbjct: 1   MGQKVDPRGLRLGIIRDWNAKWYAENKDFANFLLEDVKIRRHIKQKFYHAGVSNIVIERM 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG+ G ++E +R++L  MT  ++ +++ E+  PE++A L+A++I
Sbjct: 61  ANRIRVTIHTARPGMVIGRGGAEVENLRRELEEMTGKQVSINIVEIKVPELDAQLVAENI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A Q+ERRV +RRAMK+A+  AMR GA G+KV  SGRL GAE++RTE   EGRVPL TLRA
Sbjct: 121 ASQIERRVAYRRAMKQAIARAMRMGAKGIKVEVSGRLAGAEIARTEWLREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDS 211
            IDYG A A T YG  G+KV++   D +   
Sbjct: 181 DIDYGFAEAITTYGKIGVKVWIYKGDVLPQR 211


>gi|157690906|ref|YP_001485368.1| 30S ribosomal protein S3 [Bacillus pumilus SAFR-032]
 gi|194017609|ref|ZP_03056220.1| ribosomal protein S3 [Bacillus pumilus ATCC 7061]
 gi|172045995|sp|A8F991|RS3_BACP2 RecName: Full=30S ribosomal protein S3
 gi|157679664|gb|ABV60808.1| ribosomal protein S3 [Bacillus pumilus SAFR-032]
 gi|194010881|gb|EDW20452.1| ribosomal protein S3 [Bacillus pumilus ATCC 7061]
          Length = 218

 Score =  266 bits (679), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 99/219 (45%), Positives = 151/219 (68%), Gaps = 1/219 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP+  R+GV   W S+WFA G +Y   LHEDLKIRE++   L  A V+K+ IER 
Sbjct: 1   MGQKVNPVGLRIGVIRDWESKWFA-GKDYADFLHEDLKIREFISKRLSDASVSKVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                I +++A+PG++IGK G+++E +RK L+++T   +H+++ E+ + +++A L+A++I
Sbjct: 60  ANRVNITIHTAKPGMVIGKGGSEVEALRKALNSLTGKRVHINILEIKRADLDAQLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE R+ FRRA K+ +Q  MR GA G+K + SGRL GA+++R+E Y EG VPL TLRA
Sbjct: 120 ARQLENRISFRRAQKQTIQRTMRAGAQGIKTMVSGRLGGADIARSEYYSEGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
            IDY TA A+T YG  G+KV++   + +    +T    +
Sbjct: 180 DIDYATAEADTTYGKLGVKVWIYRGEVLPTKKNTAEGGK 218


>gi|304310022|ref|YP_003809620.1| 30S ribosomal protein S3 [gamma proteobacterium HdN1]
 gi|301795755|emb|CBL43954.1| 30S ribosomal protein S3 [gamma proteobacterium HdN1]
          Length = 227

 Score =  266 bits (679), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 114/223 (51%), Positives = 156/223 (69%), Gaps = 2/223 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+    +S W+A    +G  L +D+K+REYL   LK A V++I IER 
Sbjct: 1   MGQKVHPTGIRLGIVKKHSSTWYASPKNFGDYLLKDIKVREYLSEKLKAASVSRIEIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +N RI + +ARPG++IGKKG D+EK+RK+++++    +H+++ E+ KPE++A L+A+ I
Sbjct: 61  AENARITIKTARPGIVIGKKGEDVEKLRKEVASIMQVPVHINIEEIRKPELDAKLVAEGI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ  MR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQGTMRLGAKGIKVQVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSD--STIPAAEHR 221
            IDY TA AET YGS G+KV++   + +   +       A  R
Sbjct: 181 DIDYATARAETTYGSIGVKVWIFKGEVLGGVEPVEDTKVAPKR 223


>gi|153869561|ref|ZP_01999135.1| 30S ribosomal protein S3 [Beggiatoa sp. PS]
 gi|152073947|gb|EDN70859.1| 30S ribosomal protein S3 [Beggiatoa sp. PS]
          Length = 211

 Score =  265 bits (678), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 109/209 (52%), Positives = 154/209 (73%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI  RLG+   W+S+W+A   +Y   L+ DLK+R +++  L  A V+++ IER 
Sbjct: 1   MGQKVHPIGMRLGIIKDWSSKWYANSQDYPVYLNTDLKVRAFIKKKLAPASVSEVRIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +N RII+++ARPG++IGKKG DI+K+R  +S M    +H+SV E+ KPE++A L+A S+
Sbjct: 61  ARNARIIIHTARPGIVIGKKGEDIDKLRAIVSKMMGIPVHISVEEIRKPELDAYLVAVSV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERR++FRRAMKR V +AMR GA G+++  SGRLNGAE++RTE Y EGRVPL TLRA
Sbjct: 121 ASQLERRIMFRRAMKRVVGNAMRLGAQGIRINVSGRLNGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVS 209
            IDYG A A+T YG  G+KV++   + + 
Sbjct: 181 DIDYGFAEAQTTYGIIGVKVWIFKGEIIG 209


>gi|308070969|ref|YP_003872574.1| 30S ribosomal protein S3 [Paenibacillus polymyxa E681]
 gi|305860248|gb|ADM72036.1| 30S ribosomal protein S3 [Paenibacillus polymyxa E681]
          Length = 221

 Score =  265 bits (678), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 99/219 (45%), Positives = 154/219 (70%), Gaps = 2/219 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP+  R+G+   W S+W+A G ++G LL ED++IRE+L+  LK + V+++ IER 
Sbjct: 1   MGQKVNPVGLRIGIIRDWESKWYA-GKDFGDLLLEDVRIREHLKKRLKDSAVSRVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTN-SEIHLSVNEVPKPEINATLIAQS 119
                + +++A+PG++IGK G+++E +R +++ +    ++H++++E+  PE++A L+A+S
Sbjct: 60  ANRVNVTIHTAKPGMVIGKGGSEVENLRNEITKIAGGKKVHINISEIKNPELDAILVAES 119

Query: 120 IAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           IAQQLERRV FRRA+K+A+Q  MR GA G+K    GRL GAE++R+E Y EG VPL TLR
Sbjct: 120 IAQQLERRVSFRRALKQAIQRTMRSGAKGIKTQVGGRLGGAEIARSEGYSEGTVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAA 218
           A IDYGTA A T YG  G+KV++   + +  +    P  
Sbjct: 180 ADIDYGTAEAHTTYGRLGVKVWIYRGEVLPPAKKQAPQE 218


>gi|317126867|ref|YP_004093149.1| ribosomal protein S3 [Bacillus cellulosilyticus DSM 2522]
 gi|315471815|gb|ADU28418.1| ribosomal protein S3 [Bacillus cellulosilyticus DSM 2522]
          Length = 219

 Score =  265 bits (678), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 100/211 (47%), Positives = 149/211 (70%), Gaps = 1/211 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   R+G+   W S+W+A   +Y  LLHED+KIREYL+  LK+A ++ + IER 
Sbjct: 1   MGQKVNPTGLRVGIIKDWESKWYAD-KDYADLLHEDIKIREYLEKRLKEASLSTVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                + +Y+A+PG++IGK G+++E +RK L+ +T   +H+++NEV  P+++A L+A ++
Sbjct: 60  ANRVNVTIYTAKPGMVIGKGGSEVEALRKALNQLTGKRVHININEVKYPDMDARLVADNV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE R+ FRRAMK+ +Q  MR GA G+K   SGRL GA+++R+E Y EG VPL TLRA
Sbjct: 120 ARQLENRISFRRAMKQVIQRTMRSGAKGIKTEVSGRLGGADIARSESYSEGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDS 211
            IDYGTA A+T YG  G+KV++   + +   
Sbjct: 180 DIDYGTAEADTTYGKLGVKVWIYRGEVLPTK 210


>gi|238025938|ref|YP_002910169.1| 30S ribosomal protein S3 [Burkholderia glumae BGR1]
 gi|330815255|ref|YP_004358960.1| 30S ribosomal protein S3 [Burkholderia gladioli BSR3]
 gi|237875132|gb|ACR27465.1| 30S ribosomal protein S3 [Burkholderia glumae BGR1]
 gi|327367648|gb|AEA59004.1| 30S ribosomal protein S3 [Burkholderia gladioli BSR3]
          Length = 266

 Score =  265 bits (678), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 116/229 (50%), Positives = 164/229 (71%), Gaps = 2/229 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V+  W SRW+A  + + A+L ED+ +REYL+  LK A V +++IER 
Sbjct: 1   MGQKIHPTGFRLAVSRNWASRWYANNNNFAAMLQEDIGVREYLKKKLKNASVGRVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI +YS+RPG++IGKKG DIE ++ +L       +H+++ E+ KPE +A LIA SI
Sbjct: 61  AKNARITIYSSRPGVVIGKKGEDIELLKTELQRRMGVPVHVNIEEIRKPETDAQLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLERR++FRRAMKRA+Q+AMR GA G+K++++GRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 TQQLERRIMFRRAMKRAMQNAMRLGAQGIKIMSAGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTI--PAAEHRVVEKDS 227
            IDY T+ A+T YG  G+KV+V   D +  +D+ +     E +   +++
Sbjct: 181 DIDYATSEAKTTYGIIGVKVWVYKGDTLGRNDAPVVEEVTEDKRPRRNA 229


>gi|323141362|ref|ZP_08076253.1| ribosomal protein S3 [Phascolarctobacterium sp. YIT 12067]
 gi|322414111|gb|EFY04939.1| ribosomal protein S3 [Phascolarctobacterium sp. YIT 12067]
          Length = 222

 Score =  265 bits (678), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 103/223 (46%), Positives = 152/223 (68%), Gaps = 1/223 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   R+GV   W+S+W+A G +Y   L ED+KIRE+++  L  +G++K+ IER 
Sbjct: 1   MGQKVNPHGLRVGVIKGWDSKWYA-GKDYEKFLLEDIKIREFIKEKLFLSGISKVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               RI +++A+PG++IG++G++IE ++  L  MT S I +++ EV  P+++ATL+A++I
Sbjct: 60  SNKARISIHTAKPGMVIGRQGSNIELLKSDLKKMTESAIEINIVEVKTPDMDATLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERR+ FRRAMK+ V   MR GA G+K+   GRL GAE++R+E Y EG +PL TLRA
Sbjct: 120 AAQLERRIAFRRAMKQCVGRTMRMGAKGIKITCGGRLGGAEIARSESYREGSIPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVV 223
            IDYGTA A T YG  GIKV++   + + +S      A  +  
Sbjct: 180 DIDYGTAEAHTTYGRIGIKVWIYKGEVLPESKEAAKVAPAKEA 222


>gi|88801213|ref|ZP_01116754.1| ribosomal protein S3 [Reinekea sp. MED297]
 gi|88776051|gb|EAR07285.1| ribosomal protein S3 [Reinekea sp. MED297]
          Length = 228

 Score =  265 bits (678), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 107/226 (47%), Positives = 159/226 (70%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+    NS W+A    Y   L  D+++R YL+  L++A V+KI+IER 
Sbjct: 1   MGQKVHPTGIRLGIVKDHNSVWYAGSDTYSEKLLNDIEVRAYLEKKLEKASVSKIIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +N +I +++ARPG++IGKKG D+E +R++L+ M    +H+++ E+ KP+++  L+AQSI
Sbjct: 61  AQNAKITIHTARPGIVIGKKGEDVELLRQELTQMMGIPVHINIEEIRKPDLDGKLVAQSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRA+Q+AMR GA+G++V  SGRL GAE++R+E YLEGRVPL TLRA
Sbjct: 121 AGQLERRVMFRRAMKRAMQNAMRGGAEGIRVQVSGRLGGAEIARSEWYLEGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            IDY TA A T YG  G+KV++   + +   +     ++ +  +  
Sbjct: 181 DIDYATAEANTTYGIIGVKVWIFKGEVLGGIEEVRAKSKAQPKKNS 226


>gi|167582617|ref|ZP_02375491.1| 30S ribosomal protein S3 [Burkholderia thailandensis TXDOH]
 gi|167838206|ref|ZP_02465065.1| 30S ribosomal protein S3 [Burkholderia thailandensis MSMB43]
          Length = 266

 Score =  265 bits (678), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 115/229 (50%), Positives = 164/229 (71%), Gaps = 2/229 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V+  W SRW+A  + + A+L ED+ +REYL+  LK A V +++IER 
Sbjct: 1   MGQKIHPTGFRLAVSRNWASRWYANNNNFAAMLQEDIGVREYLKKKLKNASVGRVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI ++S+RPG++IGKKG DIE ++ +L       +H+++ E+ KPE +A LIA SI
Sbjct: 61  AKNARITIFSSRPGVVIGKKGEDIELLKTELQRRMGVPVHVNIEEIRKPETDAQLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLERR++FRRAMKRA+Q+AMR GA G+K++++GRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 TQQLERRIMFRRAMKRAMQNAMRLGAQGIKIMSAGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTI--PAAEHRVVEKDS 227
            IDY T+ A+T YG  G+KV+V   D +  +D+ +     E +   +++
Sbjct: 181 DIDYATSEAKTTYGVIGVKVWVYKGDTLGRNDAPVVEEVTEDKRPRRNA 229


>gi|119468274|ref|ZP_01611400.1| 30S ribosomal subunit protein S3 [Alteromonadales bacterium TW-7]
 gi|119448267|gb|EAW29531.1| 30S ribosomal subunit protein S3 [Alteromonadales bacterium TW-7]
          Length = 233

 Score =  265 bits (677), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 104/210 (49%), Positives = 149/210 (70%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG++  W S W+A   ++   L  D K+R +L   LK A V+KI+IER 
Sbjct: 1   MGQKVHPTGIRLGISKPWVSTWYASSKDFSDQLFGDHKVRAFLTKELKTASVSKIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R+ ++ +      ++++EV KPE++A L+A  I
Sbjct: 61  AKSIRVTIHTARPGVVIGKKGEDVEKLRQAVTKIAGVPAQINISEVRKPELDAQLVADGI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKR+VQ+AMR G+ G+KV  SGRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRSVQNAMRIGSKGIKVEVSGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD 210
            IDY T+ A T YG  G+KV++   + +  
Sbjct: 181 DIDYATSEALTTYGIIGVKVWIFKGEVIGG 210


>gi|15827996|ref|NP_302259.1| 30S ribosomal protein S3 [Mycobacterium leprae TN]
 gi|3122828|sp|O32987|RS3_MYCLE RecName: Full=30S ribosomal protein S3
 gi|2344838|emb|CAB11440.1| ribosomal protein S3 [Mycobacterium leprae]
 gi|13093549|emb|CAC30811.1| 30S ribosomal protein S3 [Mycobacterium leprae]
          Length = 281

 Score =  265 bits (677), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 105/229 (45%), Positives = 147/229 (64%), Gaps = 5/229 (2%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP  FRLG+   W SRW+A   +Y   + ED+ IR  L   L++AG+A + IERT
Sbjct: 1   MGQKINPHGFRLGITTGWKSRWYAD-KQYAEYVKEDVAIRRLLSTGLERAGIADVEIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG++GT+ ++IR  L  +T  ++ L++ EV  PE  A L+AQ +
Sbjct: 60  RDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQLNILEVKNPESQAQLVAQGV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAM-RFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           A+QL  RV FRRAM++A+QSAM +    G++V  SGRL GAE+SR+E Y EGRVPL TLR
Sbjct: 120 AEQLSNRVAFRRAMRKAIQSAMRQPNVKGIRVQCSGRLGGAEMSRSEFYREGRVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDS---TIPAAEHRVVEK 225
           A IDYG   A+T +G  G+KV++   D V          PA   R   +
Sbjct: 180 ADIDYGLHEAKTTFGRIGVKVWIYKGDIVGGKREVTAVAPAGAERARRE 228


>gi|221230473|ref|YP_002503889.1| 30S ribosomal protein S3 [Mycobacterium leprae Br4923]
 gi|254764537|sp|B8ZSB3|RS3_MYCLB RecName: Full=30S ribosomal protein S3
 gi|219933580|emb|CAR71953.1| 30S ribosomal protein S3 [Mycobacterium leprae Br4923]
          Length = 281

 Score =  265 bits (677), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 105/229 (45%), Positives = 147/229 (64%), Gaps = 5/229 (2%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP  FRLG+   W SRW+A   +Y   + ED+ IR  L   L++AG+A + IERT
Sbjct: 1   MGQKINPHGFRLGITTGWKSRWYAD-KQYAEYVKEDVAIRRLLSTGLERAGIADVEIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG++GT+ ++IR  L  +T  ++ L++ EV  PE  A L+AQ +
Sbjct: 60  RDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTCKQVQLNILEVKNPESQAQLVAQGV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAM-RFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           A+QL  RV FRRAM++A+QSAM +    G++V  SGRL GAE+SR+E Y EGRVPL TLR
Sbjct: 120 AEQLSNRVAFRRAMRKAIQSAMRQPNVKGIRVQCSGRLGGAEMSRSEFYREGRVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDS---TIPAAEHRVVEK 225
           A IDYG   A+T +G  G+KV++   D V          PA   R   +
Sbjct: 180 ADIDYGLHEAKTTFGRIGVKVWIYKGDIVGGKREVTAVAPAGAERARRE 228


>gi|77359122|ref|YP_338697.1| 30S ribosomal protein S3 [Pseudoalteromonas haloplanktis TAC125]
 gi|91207832|sp|Q3IF19|RS3_PSEHT RecName: Full=30S ribosomal protein S3
 gi|76874033|emb|CAI85254.1| 30S ribosomal subunit protein S3 [Pseudoalteromonas haloplanktis
           TAC125]
          Length = 233

 Score =  264 bits (676), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 106/210 (50%), Positives = 150/210 (71%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG++  W S W+A   ++ A L  D K+R +L   LK A V+KI+IER 
Sbjct: 1   MGQKVHPTGIRLGISKPWVSTWYASSKDFSAQLFGDHKVRTFLTKELKTASVSKIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R+ ++ +      ++++EV KPE++A L+A  I
Sbjct: 61  AKSIRVTIHTARPGVVIGKKGEDVEKLRQAVTKIAGVPAQINISEVRKPELDAQLVADGI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKR+VQ+AMR G+ G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRSVQNAMRIGSKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD 210
            IDY T+ A T YG  G+KV++   + +  
Sbjct: 181 DIDYATSEALTTYGIIGVKVWIFKGEVIGG 210


>gi|295106945|emb|CBL04488.1| SSU ribosomal protein S3P [Gordonibacter pamelaeae 7-10-1-b]
          Length = 237

 Score =  264 bits (676), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 108/219 (49%), Positives = 150/219 (68%), Gaps = 1/219 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P  FRLG+   W SRW++   +Y   L  DL IR++L  +L +A V+K+ IER 
Sbjct: 1   MGQKVSPTGFRLGITEDWRSRWYSD-KDYAKNLENDLAIRKFLDKYLARAAVSKVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               ++IV +ARPG++IGKKG +I+ +RKKL  + +  + + V EV +PE++A LIAQS+
Sbjct: 60  GDKIKVIVTTARPGVVIGKKGAEIDSLRKKLEKVASGPVSIEVVEVKRPELDAALIAQSV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE RV FRRAM++AVQSA + GA G+++  SGRL GAE+SR E Y EGRVPL TLRA
Sbjct: 120 AEQLEGRVAFRRAMRKAVQSARKSGAKGIRIQCSGRLGGAEMSRREWYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
            IDYG   A T  GS G++V+V   + +    +  PA E
Sbjct: 180 KIDYGFCTAATTMGSIGVQVWVYHGEMLPGQKAPNPALE 218


>gi|294496991|ref|YP_003560691.1| 30S ribosomal protein S3 [Bacillus megaterium QM B1551]
 gi|295702356|ref|YP_003595431.1| 30S ribosomal protein S3 [Bacillus megaterium DSM 319]
 gi|294346928|gb|ADE67257.1| 30S ribosomal protein S3 [Bacillus megaterium QM B1551]
 gi|294800015|gb|ADF37081.1| 30S ribosomal protein S3 [Bacillus megaterium DSM 319]
          Length = 218

 Score =  264 bits (676), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 102/219 (46%), Positives = 151/219 (68%), Gaps = 1/219 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP+  R+GV   W SRWFA G +Y  LLHEDLK+REY+   L  A V+K+ IER 
Sbjct: 1   MGQKVNPVGLRVGVIRDWESRWFA-GKDYADLLHEDLKVREYIAKRLNDAAVSKVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                + +++A+PG++IGK GT++E +RK L+ +T   +H+++ E+ + +++A L+A++I
Sbjct: 60  ANRLNVTIHTAKPGMVIGKGGTEVESLRKALNQLTGKRVHINILEIKRADLDAKLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE RV FRRA K+A+Q +MR GA G+K + SGRL GA+++R+E Y EG VPL TLRA
Sbjct: 120 ARQLENRVSFRRAQKQAIQRSMRAGAQGIKTMVSGRLGGADIARSEYYSEGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
            IDY  A A+T YG  G+KV++   + +     T    +
Sbjct: 180 DIDYAHAEADTTYGKLGVKVWIYRGEVLPTKKKTEEGGK 218


>gi|90409296|ref|ZP_01217393.1| 30S ribosomal protein S3 [Psychromonas sp. CNPT3]
 gi|90309590|gb|EAS37778.1| 30S ribosomal protein S3 [Psychromonas sp. CNPT3]
          Length = 229

 Score =  264 bits (676), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 106/226 (46%), Positives = 149/226 (65%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   ++S W+A   E+   L  D  IR++L   LK A ++K+ IER 
Sbjct: 1   MGQKVHPNGIRLGITKAFSSTWYAGKKEFADNLFSDHLIRKFLTEKLKNASLSKVTIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  ++ M      ++++EV KPE++A L+A SI
Sbjct: 61  AKSVRVTIHTARPGVVIGKKGEDVEKLRTAIAKMAGVPAQINISEVRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           + QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 SSQLERRVMFRRAMKRAVQNAMRLGAKGIKVQVSGRLGGAEIARAEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            IDY T+ A T YG  G+KV++   + +            +   K 
Sbjct: 181 DIDYSTSEALTVYGIIGVKVWIFKGEVLGGLPLQQEQQPSKPKRKG 226


>gi|56707484|ref|YP_169380.1| 30S ribosomal protein S3 [Francisella tularensis subsp. tularensis
           SCHU S4]
 gi|110669955|ref|YP_666512.1| 30S ribosomal protein S3 [Francisella tularensis subsp. tularensis
           FSC198]
 gi|61215376|sp|Q5NHW2|RS3_FRATT RecName: Full=30S ribosomal protein S3
 gi|123063579|sp|Q14JB4|RS3_FRAT1 RecName: Full=30S ribosomal protein S3
 gi|56603976|emb|CAG44964.1| 30S ribosomal protein S3 [Francisella tularensis subsp. tularensis
           SCHU S4]
 gi|110320288|emb|CAL08347.1| 30S ribosomal protein S3 [Francisella tularensis subsp. tularensis
           FSC198]
 gi|282158628|gb|ADA78019.1| 30S ribosomal protein S3 [Francisella tularensis subsp. tularensis
           NE061598]
          Length = 222

 Score =  264 bits (676), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 105/222 (47%), Positives = 153/222 (68%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   RLG    W S W+A  S Y   L+ED+K+RE+L   L  A V+KI IER 
Sbjct: 1   MGQKVNPNGIRLGYIRDWRSTWYADSSRYATKLNEDIKVREFLHKKLAAAAVSKIQIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +N +I +++AR G++IGKKG D+EK+R ++  +    + +++ EV KPEI+A L+A+S+
Sbjct: 61  AQNAKITIHTARSGIVIGKKGEDVEKLRAEVHKLMGIPVQINIEEVRKPEIDAKLVAESV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLE+RV+FRRAMK+A+Q+AM+ GA G+K++ SGRL GAE++R+E   +GRVPLQT RA
Sbjct: 121 AQQLEKRVMFRRAMKKAMQAAMKSGAKGIKIMVSGRLGGAEIARSEWARDGRVPLQTFRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRV 222
            +DY TA A T YG  G+KV++   + +    +     + R 
Sbjct: 181 DVDYATAEALTTYGVIGVKVWIYKGEILPGQIAEKKNNKKRS 222


>gi|119718119|ref|YP_925084.1| 30S ribosomal protein S3 [Nocardioides sp. JS614]
 gi|152060887|sp|A1SNL2|RS3_NOCSJ RecName: Full=30S ribosomal protein S3
 gi|119538780|gb|ABL83397.1| SSU ribosomal protein S3P [Nocardioides sp. JS614]
          Length = 278

 Score =  264 bits (676), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 100/207 (48%), Positives = 148/207 (71%), Gaps = 1/207 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP  FRLG++    SRW+A    Y + + ED+ IR+ L   +++AG+AK+ IERT
Sbjct: 1   MGQKINPNGFRLGISTDHKSRWYAD-KLYKSYVGEDVAIRKLLSKGMERAGIAKVEIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG++G + ++IR +L  +T  ++ L++ EV  PE++A L+AQ +
Sbjct: 60  RDRVRVDIHTARPGIVIGRRGAEADRIRGELEKLTGKQVQLNILEVKNPEVDAQLVAQGV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QL  RV FRRAM++A+Q++MR GA G+++  SGRLNGAE+SRTE Y EGRVPL TLRA
Sbjct: 120 AEQLSGRVQFRRAMRKAMQTSMRSGAKGIRIQCSGRLNGAEMSRTEFYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDE 207
            IDYG   A T +G  G+KV++   + 
Sbjct: 180 DIDYGFYEARTTFGRIGVKVWIYKGEV 206


>gi|152980649|ref|YP_001355095.1| small subunit ribosomal protein S3 [Janthinobacterium sp.
           Marseille]
 gi|189045013|sp|A6T3J8|RS3_JANMA RecName: Full=30S ribosomal protein S3
 gi|151280726|gb|ABR89136.1| small subunit ribosomal protein S3 [Janthinobacterium sp.
           Marseille]
          Length = 283

 Score =  264 bits (676), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 118/215 (54%), Positives = 160/215 (74%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V+  W SRW+A  S +  +L+EDLK+R YL+  LK A V +++IER 
Sbjct: 1   MGQKIHPTGFRLAVSRNWASRWYAGNSNFATMLNEDLKVRAYLKTKLKNASVGRVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI +YS+RPG++IGKKG DIE ++  L+ M    +H+++ E+ KPE +A LIA SI
Sbjct: 61  AKNARITIYSSRPGVVIGKKGEDIEVLKSALTKMMGVPVHVNIEEIRKPETDAQLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLE+R++FRRAMKRA+Q+AMR GA G+K+++SGRLNG E++R E Y EGRVPL TLRA
Sbjct: 121 AQQLEKRIMFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGIEIARKEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTI 215
            IDYG   AET YG  GIKV+V   D +++ ++ +
Sbjct: 181 DIDYGFGEAETTYGIIGIKVWVYKGDRLANGEAPV 215


>gi|53720815|ref|YP_109801.1| 30S ribosomal protein S3 [Burkholderia pseudomallei K96243]
 gi|53723848|ref|YP_104160.1| 30S ribosomal protein S3 [Burkholderia mallei ATCC 23344]
 gi|76811070|ref|YP_335134.1| 30S ribosomal protein S3 [Burkholderia pseudomallei 1710b]
 gi|121601078|ref|YP_994450.1| 30S ribosomal protein S3 [Burkholderia mallei SAVP1]
 gi|124383473|ref|YP_001027901.1| 30S ribosomal protein S3 [Burkholderia mallei NCTC 10229]
 gi|126441331|ref|YP_001060744.1| 30S ribosomal protein S3 [Burkholderia pseudomallei 668]
 gi|126450100|ref|YP_001082996.1| 30S ribosomal protein S3 [Burkholderia mallei NCTC 10247]
 gi|126452567|ref|YP_001068028.1| 30S ribosomal protein S3 [Burkholderia pseudomallei 1106a]
 gi|134283153|ref|ZP_01769854.1| 30S ribosomal protein S3 [Burkholderia pseudomallei 305]
 gi|167001693|ref|ZP_02267485.1| 30S ribosomal protein S3 [Burkholderia mallei PRL-20]
 gi|167721571|ref|ZP_02404807.1| 30S ribosomal protein S3 [Burkholderia pseudomallei DM98]
 gi|167740545|ref|ZP_02413319.1| 30S ribosomal protein S3 [Burkholderia pseudomallei 14]
 gi|167817750|ref|ZP_02449430.1| 30S ribosomal protein S3 [Burkholderia pseudomallei 91]
 gi|167826147|ref|ZP_02457618.1| 30S ribosomal protein S3 [Burkholderia pseudomallei 9]
 gi|167847659|ref|ZP_02473167.1| 30S ribosomal protein S3 [Burkholderia pseudomallei B7210]
 gi|167896231|ref|ZP_02483633.1| 30S ribosomal protein S3 [Burkholderia pseudomallei 7894]
 gi|167904613|ref|ZP_02491818.1| 30S ribosomal protein S3 [Burkholderia pseudomallei NCTC 13177]
 gi|167912878|ref|ZP_02499969.1| 30S ribosomal protein S3 [Burkholderia pseudomallei 112]
 gi|167920838|ref|ZP_02507929.1| 30S ribosomal protein S3 [Burkholderia pseudomallei BCC215]
 gi|217424767|ref|ZP_03456264.1| 30S ribosomal protein S3 [Burkholderia pseudomallei 576]
 gi|226198160|ref|ZP_03793731.1| 30S ribosomal protein S3 [Burkholderia pseudomallei Pakistan 9]
 gi|237814139|ref|YP_002898590.1| ribosomal protein S3 [Burkholderia pseudomallei MSHR346]
 gi|242315858|ref|ZP_04814874.1| 30S ribosomal protein S3 [Burkholderia pseudomallei 1106b]
 gi|254174687|ref|ZP_04881348.1| 30S ribosomal protein S3 [Burkholderia mallei ATCC 10399]
 gi|254180345|ref|ZP_04886943.1| 30S ribosomal protein S3 [Burkholderia pseudomallei 1655]
 gi|254190308|ref|ZP_04896816.1| 30S ribosomal protein S3 [Burkholderia pseudomallei Pasteur 52237]
 gi|254198497|ref|ZP_04904918.1| 30S ribosomal protein S3 [Burkholderia pseudomallei S13]
 gi|254201233|ref|ZP_04907597.1| 30S ribosomal protein S3 [Burkholderia mallei FMH]
 gi|254206574|ref|ZP_04912925.1| 30S ribosomal protein S3 [Burkholderia mallei JHU]
 gi|254259494|ref|ZP_04950548.1| 30S ribosomal protein S3 [Burkholderia pseudomallei 1710a]
 gi|254300582|ref|ZP_04968027.1| 30S ribosomal protein S3 [Burkholderia pseudomallei 406e]
 gi|254357112|ref|ZP_04973386.1| 30S ribosomal protein S3 [Burkholderia mallei 2002721280]
 gi|61215449|sp|Q62GL1|RS3_BURMA RecName: Full=30S ribosomal protein S3
 gi|61215462|sp|Q63Q17|RS3_BURPS RecName: Full=30S ribosomal protein S3
 gi|91207643|sp|Q3JMR9|RS3_BURP1 RecName: Full=30S ribosomal protein S3
 gi|152060851|sp|A3P0A7|RS3_BURP0 RecName: Full=30S ribosomal protein S3
 gi|189044957|sp|A3MRW0|RS3_BURM7 RecName: Full=30S ribosomal protein S3
 gi|189044958|sp|A2S7I2|RS3_BURM9 RecName: Full=30S ribosomal protein S3
 gi|189044959|sp|A1V897|RS3_BURMS RecName: Full=30S ribosomal protein S3
 gi|189044960|sp|A3NEH3|RS3_BURP6 RecName: Full=30S ribosomal protein S3
 gi|52211229|emb|CAH37218.1| 30S ribosomal protein S3 [Burkholderia pseudomallei K96243]
 gi|52427271|gb|AAU47864.1| ribosomal protein S3 [Burkholderia mallei ATCC 23344]
 gi|76580523|gb|ABA49998.1| ribosomal protein S3 [Burkholderia pseudomallei 1710b]
 gi|121229888|gb|ABM52406.1| 30S ribosomal protein S3 [Burkholderia mallei SAVP1]
 gi|124291493|gb|ABN00762.1| 30S ribosomal protein S3 [Burkholderia mallei NCTC 10229]
 gi|126220824|gb|ABN84330.1| 30S ribosomal protein S3 [Burkholderia pseudomallei 668]
 gi|126226209|gb|ABN89749.1| 30S ribosomal protein S3 [Burkholderia pseudomallei 1106a]
 gi|126242970|gb|ABO06063.1| 30S ribosomal protein S3 [Burkholderia mallei NCTC 10247]
 gi|134245348|gb|EBA45441.1| 30S ribosomal protein S3 [Burkholderia pseudomallei 305]
 gi|147747127|gb|EDK54203.1| 30S ribosomal protein S3 [Burkholderia mallei FMH]
 gi|147752116|gb|EDK59182.1| 30S ribosomal protein S3 [Burkholderia mallei JHU]
 gi|148026176|gb|EDK84261.1| 30S ribosomal protein S3 [Burkholderia mallei 2002721280]
 gi|157810491|gb|EDO87661.1| 30S ribosomal protein S3 [Burkholderia pseudomallei 406e]
 gi|157937984|gb|EDO93654.1| 30S ribosomal protein S3 [Burkholderia pseudomallei Pasteur 52237]
 gi|160695732|gb|EDP85702.1| 30S ribosomal protein S3 [Burkholderia mallei ATCC 10399]
 gi|169655237|gb|EDS87930.1| 30S ribosomal protein S3 [Burkholderia pseudomallei S13]
 gi|184210884|gb|EDU07927.1| 30S ribosomal protein S3 [Burkholderia pseudomallei 1655]
 gi|217392223|gb|EEC32248.1| 30S ribosomal protein S3 [Burkholderia pseudomallei 576]
 gi|225929680|gb|EEH25696.1| 30S ribosomal protein S3 [Burkholderia pseudomallei Pakistan 9]
 gi|237503075|gb|ACQ95393.1| ribosomal protein S3 [Burkholderia pseudomallei MSHR346]
 gi|242139097|gb|EES25499.1| 30S ribosomal protein S3 [Burkholderia pseudomallei 1106b]
 gi|243062590|gb|EES44776.1| 30S ribosomal protein S3 [Burkholderia mallei PRL-20]
 gi|254218183|gb|EET07567.1| 30S ribosomal protein S3 [Burkholderia pseudomallei 1710a]
          Length = 266

 Score =  264 bits (676), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 115/229 (50%), Positives = 164/229 (71%), Gaps = 2/229 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V+  W SRW+A  + + A+L ED+ +REYL+  LK A V +++IER 
Sbjct: 1   MGQKIHPTGFRLAVSRNWASRWYANNNNFAAMLQEDIGVREYLKKKLKNASVGRVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI ++S+RPG++IGKKG DIE ++ +L       +H+++ E+ KPE +A LIA SI
Sbjct: 61  AKNARITIFSSRPGVVIGKKGEDIELLKTELQRRMGVPVHVNIEEIRKPETDAQLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLERR++FRRAMKRA+Q+AMR GA G+K++++GRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 TQQLERRIMFRRAMKRAMQNAMRLGAQGIKIMSAGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTI--PAAEHRVVEKDS 227
            IDY T+ A+T YG  G+KV+V   D +  +D+ +     E +   +++
Sbjct: 181 DIDYATSEAKTTYGIIGVKVWVYKGDTLGRNDAPVVEEVTEDKRPRRNA 229


>gi|83719069|ref|YP_443566.1| 30S ribosomal protein S3 [Burkholderia thailandensis E264]
 gi|167620731|ref|ZP_02389362.1| 30S ribosomal protein S3 [Burkholderia thailandensis Bt4]
 gi|123726556|sp|Q2SU33|RS3_BURTA RecName: Full=30S ribosomal protein S3
 gi|83652894|gb|ABC36957.1| ribosomal protein S3 [Burkholderia thailandensis E264]
          Length = 266

 Score =  264 bits (676), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 115/229 (50%), Positives = 164/229 (71%), Gaps = 2/229 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V+  W SRW+A  + + A+L ED+ +REYL+  LK A V +++IER 
Sbjct: 1   MGQKIHPTGFRLAVSRNWASRWYANNNNFAAMLQEDIGVREYLKKKLKNASVGRVIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI ++S+RPG++IGKKG DIE ++ +L       +H+++ E+ KPE +A LIA SI
Sbjct: 61  AKNARITIFSSRPGVVIGKKGEDIELLKTELQRRMGVPVHVNIEEIRKPETDAQLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLERR++FRRAMKRA+Q+AMR GA G+K++++GRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 TQQLERRIMFRRAMKRAMQNAMRLGAQGIKIMSAGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTI--PAAEHRVVEKDS 227
            IDY T+ A+T YG  G+KV+V   D +  +D+ +     E +   +++
Sbjct: 181 DIDYATSEAKTTYGVIGVKVWVYKGDTLGRNDAPVVEEVTEDKRPRRNA 229


>gi|87122977|ref|ZP_01078838.1| 30S ribosomal protein S3 [Marinomonas sp. MED121]
 gi|86161745|gb|EAQ63049.1| 30S ribosomal protein S3 [Marinomonas sp. MED121]
          Length = 226

 Score =  264 bits (676), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 109/226 (48%), Positives = 154/226 (68%), Gaps = 2/226 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+     S W+A    Y  LL  DL++R+YL+  L QA V++I I+R 
Sbjct: 1   MGQKVHPTGIRLGIVKDHTSTWYANNQNYSKLLLNDLQVRKYLEGKLVQASVSRIEIQRP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            ++ RI +++ARPG++IGKKG D+EK+R  +S+M    +H+++ E+ KPE++A L+AQ+I
Sbjct: 61  AQSARITIHTARPGIVIGKKGEDVEKLRNAVSDMMGVPVHINIEEIRKPELDAKLVAQNI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AGQLERRVMFRRAMKRAVQNAMRAGAKGIKVQVSGRLGGAEIARAEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDS--TIPAAEHRVVE 224
            IDY T  A T YG  G+K ++   + +   +       A+ +  +
Sbjct: 181 DIDYATYEANTTYGIIGVKTWIFKGEILGGIEQVRANKGAQKKKSK 226


>gi|313884389|ref|ZP_07818150.1| ribosomal protein S3 [Eremococcus coleocola ACS-139-V-Col8]
 gi|312620173|gb|EFR31601.1| ribosomal protein S3 [Eremococcus coleocola ACS-139-V-Col8]
          Length = 219

 Score =  264 bits (676), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 95/219 (43%), Positives = 145/219 (66%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI  R+G+   W+++WFA    Y   LHEDL+IR Y+   L  A V++I IER 
Sbjct: 1   MGQKVHPIGMRVGIIRDWDAKWFANNKNYADFLHEDLRIRNYVYGKLTDASVSQIQIERA 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                + +++A+PG++IGK G +++ +R  LS +T  ++H+++ E+ +P ++A L+A  I
Sbjct: 61  ANRVIVSIHTAKPGMVIGKGGAEVDTLRNDLSKLTGKKVHINIVEIKEPSLDAKLVALDI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLE RV FRRA K+A+Q  MR GA G+K   SGRLNGA+++RTE Y EG VPL TLR+
Sbjct: 121 AQQLENRVAFRRAQKQAIQRVMRAGAQGIKTQVSGRLNGADMARTEHYSEGTVPLHTLRS 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
            IDY    A+T YG  G+KV++   + +   +++    +
Sbjct: 181 DIDYAWEEADTTYGKIGVKVWICRGEILPGQENSGKGGK 219


>gi|297717886|gb|ADI50086.1| SSU ribosomal protein S3p [Candidatus Odyssella thessalonicensis
           L13]
          Length = 225

 Score =  264 bits (676), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 115/208 (55%), Positives = 162/208 (77%), Gaps = 1/208 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP+  RLG+N  W+SRWF+   +Y   LH+DL+IR +++ +L QAGVAK++IER 
Sbjct: 1   MGQKVNPVGLRLGINKLWDSRWFS-KKDYAKNLHQDLEIRRFVEKNLAQAGVAKVVIERL 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K  R+ +++ARPG++IGKKG DI+K+RKKLS++ N+++ +++ EV KPEI+A LIA++I
Sbjct: 60  AKKARLTIHTARPGVLIGKKGADIDKLRKKLSDIANTDVTINLVEVRKPEIDAKLIAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQ+ERRV FRRAMKRA+QS++R GA G++V  SGRL GAE++R E Y EGRVPL TLR+
Sbjct: 120 AQQIERRVSFRRAMKRAMQSSLRLGAQGIRVNCSGRLGGAEIARMEWYREGRVPLHTLRS 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEV 208
            +DY    A+T YG  GIKV+V   + +
Sbjct: 180 DVDYALGEAKTTYGIIGIKVWVYKGEIL 207


>gi|297537537|ref|YP_003673306.1| 30S ribosomal protein S3 [Methylotenera sp. 301]
 gi|297256884|gb|ADI28729.1| ribosomal protein S3 [Methylotenera sp. 301]
          Length = 241

 Score =  264 bits (676), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 124/211 (58%), Positives = 158/211 (74%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+PI FRL V   W+SRW+A    + A+L  D+K+RE+L   L  A V++ILIER 
Sbjct: 1   MGQKIHPIGFRLSVQKNWSSRWYANSKNFPAMLQGDIKVREFLNKKLASAAVSRILIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN +I +YSARPG++IGKKG DIE +R  L  +    +HL++ EV KPEI+ATLIAQSI
Sbjct: 61  AKNAKITIYSARPGVVIGKKGEDIESLRATLQGLMGVPVHLNIEEVRKPEIDATLIAQSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLE+RV+FRRAMKRA+Q+AMR GA G+K+++SGRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLEKRVMFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDS 211
            IDYG A A T YG  GIKV+V   +  + +
Sbjct: 181 DIDYGVAEASTTYGIIGIKVWVFKGEIFAGN 211


>gi|304438368|ref|ZP_07398309.1| 30S ribosomal protein S3 [Selenomonas sp. oral taxon 149 str.
           67H29BP]
 gi|304368734|gb|EFM22418.1| 30S ribosomal protein S3 [Selenomonas sp. oral taxon 149 str.
           67H29BP]
          Length = 223

 Score =  264 bits (675), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 100/222 (45%), Positives = 152/222 (68%), Gaps = 1/222 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   RLG+   W++RW+A   ++   LHED+KIR+YL+  L+ AGV ++  ER+
Sbjct: 1   MGQKVNPHGIRLGIVKDWDARWYAD-KDFAQNLHEDIKIRDYLKKSLQTAGVPRVETERS 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               ++ +++A+PG++IG+ G+ IE+I++ L  +T   + +++ E+ +P+++ATL+A++I
Sbjct: 60  KNRLKLTIHTAKPGMVIGRGGSGIEQIKEGLKGLTEKRVDINIAEIKQPDLDATLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERR+ FRRAMK+AV   MR GA G+K+  SGRL GAE++R E Y EG +PL TLRA
Sbjct: 120 AAQLERRIAFRRAMKQAVGRTMRLGAKGIKIAVSGRLGGAEIARRESYREGSIPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRV 222
            IDYGTA A T YG  GIKV++   + + D        + R 
Sbjct: 180 DIDYGTAEAHTTYGRIGIKVWIFKGEVLPDKKQAPKNNKERS 221


>gi|289579136|ref|YP_003477763.1| ribosomal protein S3 [Thermoanaerobacter italicus Ab9]
 gi|289528849|gb|ADD03201.1| ribosomal protein S3 [Thermoanaerobacter italicus Ab9]
          Length = 221

 Score =  264 bits (675), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 100/218 (45%), Positives = 151/218 (69%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   R+GV   W ++W+A    +  LL ED+KIR Y++  L  AG++KI+IER 
Sbjct: 1   MGQKVHPYGLRVGVTQDWLAKWYADDKNFSKLLIEDIKIRNYIKEKLYAAGISKIVIERA 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               +I +++A+PG++IGK G  I+K+R++L  MTN  + L++ EV  PE++A L+A+++
Sbjct: 61  SNRIKIDIHAAKPGMVIGKGGAGIDKLREELEKMTNKTVILNIVEVKTPELSAQLVAENV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A Q+E+R+ +RRAMK+A+  AM+ GA G+K+  SGRL GAE++RTE Y EG VPLQTLRA
Sbjct: 121 AAQIEKRISYRRAMKQAIARAMKLGAKGIKIACSGRLAGAEIARTERYHEGVVPLQTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAA 218
            IDYG A A T YG  G+KV+++  + +      + A 
Sbjct: 181 DIDYGFAEANTTYGKIGVKVWINKGEILPQPKKQVTAE 218


>gi|133924|sp|P23309|RS3_BACST RecName: Full=30S ribosomal protein S3; AltName: Full=BS2; AltName:
           Full=BS3/BS4
 gi|580921|emb|CAA38740.1| ribosomal protein S3 [Geobacillus stearothermophilus]
          Length = 218

 Score =  264 bits (675), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 100/219 (45%), Positives = 148/219 (67%), Gaps = 1/219 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI  R+G+   W SRW+A   +Y  L+HEDLKIREY+   L+ A V+++ IER 
Sbjct: 1   MGQKVNPIGLRIGIIRDWESRWYAE-KDYADLVHEDLKIREYINKRLQDAAVSRVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                + +++A+PG++IGK G+++E +RK L+ +T    H+++ E+ KP+++A L+A++I
Sbjct: 60  ANRVNVTIHTAKPGMVIGKGGSEVEALRKALTQLTGKREHINIVEIKKPDLDAKLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE RV FRRA K+A+Q AMR G  GVK +   RL GAE++R+E Y EG VPL TLRA
Sbjct: 120 ARQLENRVSFRRAQKQAIQRAMRPGRKGVKTMVVRRLGGAEIARSEHYSEGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
            IDY TA A+T YG  G+KV++   + +          +
Sbjct: 180 DIDYATAEADTTYGKIGVKVWIYRGEVLPTKKKAEEGGK 218


>gi|315125268|ref|YP_004067271.1| 30S ribosomal protein S3 [Pseudoalteromonas sp. SM9913]
 gi|315013781|gb|ADT67119.1| 30S ribosomal protein S3 [Pseudoalteromonas sp. SM9913]
          Length = 233

 Score =  264 bits (675), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 105/210 (50%), Positives = 150/210 (71%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG++  W S W+A   ++ A L  D K+R +L   LK A V+KI+IER 
Sbjct: 1   MGQKVHPTGIRLGISKPWVSTWYANSKDFSAQLFGDHKVRTFLTKELKAASVSKIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R+ ++ +      ++++EV KPE++A L+A  I
Sbjct: 61  AKSIRVTIHTARPGVVIGKKGEDVEKLRQAVTKIAGVPAQINISEVRKPELDAQLVADGI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKR+VQ+AMR G+ G+KV  SGRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRSVQNAMRIGSKGIKVEVSGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD 210
            IDY T+ A T YG  G+KV++   + +  
Sbjct: 181 DIDYATSEALTTYGIIGVKVWIFKGEVIGG 210


>gi|255020771|ref|ZP_05292829.1| SSU ribosomal protein S3p (S3e) [Acidithiobacillus caldus ATCC
           51756]
 gi|254969767|gb|EET27271.1| SSU ribosomal protein S3p (S3e) [Acidithiobacillus caldus ATCC
           51756]
          Length = 220

 Score =  264 bits (675), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 109/221 (49%), Positives = 163/221 (73%), Gaps = 1/221 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK NPI  RLG+   WNSRW+++G ++   L ED+++RE+++  L  A +++I+IER 
Sbjct: 1   MGQKTNPIGLRLGIIKNWNSRWYSKG-DFKDKLVEDIRVREFIRKRLGGAAISQIVIERP 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            ++ RI +++ARPG++IGKKG DIEK+R  +       +H++V E+ KPE++A L+A+S+
Sbjct: 60  ARSARITLHTARPGVVIGKKGEDIEKLRLDVQRQMGVPVHINVEEIRKPELDAQLVAESV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERR++FRRAMKRAV +AMRFGA G+++  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 120 AQQLERRIMFRRAMKRAVTNAMRFGAKGMRINCAGRLGGAEIARTEWYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHR 221
            IDYG A A+T YG  G+KV++   + +  S +   +++ +
Sbjct: 180 DIDYGFAEAKTTYGIIGVKVWIFKGEILEWSTAQGGSSQQK 220


>gi|15607847|ref|NP_215221.1| 30S ribosomal protein S3 [Mycobacterium tuberculosis H37Rv]
 gi|15840114|ref|NP_335151.1| 30S ribosomal protein S3 [Mycobacterium tuberculosis CDC1551]
 gi|31791892|ref|NP_854385.1| 30S ribosomal protein S3 [Mycobacterium bovis AF2122/97]
 gi|121636629|ref|YP_976852.1| 30S ribosomal protein S3 [Mycobacterium bovis BCG str. Pasteur
           1173P2]
 gi|148660482|ref|YP_001282005.1| 30S ribosomal protein S3 [Mycobacterium tuberculosis H37Ra]
 gi|148821912|ref|YP_001286666.1| 30S ribosomal protein S3 [Mycobacterium tuberculosis F11]
 gi|215402491|ref|ZP_03414672.1| 30S ribosomal protein S3 [Mycobacterium tuberculosis 02_1987]
 gi|215425949|ref|ZP_03423868.1| 30S ribosomal protein S3 [Mycobacterium tuberculosis T92]
 gi|215429548|ref|ZP_03427467.1| 30S ribosomal protein S3 [Mycobacterium tuberculosis EAS054]
 gi|218752357|ref|ZP_03531153.1| 30S ribosomal protein S3 [Mycobacterium tuberculosis GM 1503]
 gi|219556556|ref|ZP_03535632.1| 30S ribosomal protein S3 [Mycobacterium tuberculosis T17]
 gi|224989101|ref|YP_002643788.1| 30S ribosomal protein S3 [Mycobacterium bovis BCG str. Tokyo 172]
 gi|253797650|ref|YP_003030651.1| 30S ribosomal protein S3 rpsC [Mycobacterium tuberculosis KZN 1435]
 gi|254231027|ref|ZP_04924354.1| 30S ribosomal protein S3 rpsC [Mycobacterium tuberculosis C]
 gi|254549668|ref|ZP_05140115.1| 30S ribosomal protein S3 [Mycobacterium tuberculosis '98-R604
           INH-RIF-EM']
 gi|260185589|ref|ZP_05763063.1| 30S ribosomal protein S3 [Mycobacterium tuberculosis CPHL_A]
 gi|260199717|ref|ZP_05767208.1| 30S ribosomal protein S3 [Mycobacterium tuberculosis T46]
 gi|260203878|ref|ZP_05771369.1| 30S ribosomal protein S3 [Mycobacterium tuberculosis K85]
 gi|289442108|ref|ZP_06431852.1| 30S ribosomal protein S3 rpsC [Mycobacterium tuberculosis T46]
 gi|289446267|ref|ZP_06436011.1| 30S ribosomal protein S3 rpsC [Mycobacterium tuberculosis CPHL_A]
 gi|289552964|ref|ZP_06442174.1| 30S ribosomal protein S3 rpsC [Mycobacterium tuberculosis KZN 605]
 gi|289568651|ref|ZP_06448878.1| 30S ribosomal protein S3 rpsC [Mycobacterium tuberculosis T17]
 gi|289573315|ref|ZP_06453542.1| 30S ribosomal protein S3 rpsC [Mycobacterium tuberculosis K85]
 gi|289744431|ref|ZP_06503809.1| 30S ribosomal protein S3 [Mycobacterium tuberculosis 02_1987]
 gi|289749214|ref|ZP_06508592.1| 30S ribosomal protein S3 rpsC [Mycobacterium tuberculosis T92]
 gi|289752754|ref|ZP_06512132.1| 30S ribosomal protein S3 [Mycobacterium tuberculosis EAS054]
 gi|289760834|ref|ZP_06520212.1| 30S ribosomal protein S3 rpsC [Mycobacterium tuberculosis GM 1503]
 gi|294996202|ref|ZP_06801893.1| 30S ribosomal protein S3 [Mycobacterium tuberculosis 210]
 gi|297633206|ref|ZP_06950986.1| 30S ribosomal protein S3 [Mycobacterium tuberculosis KZN 4207]
 gi|297730186|ref|ZP_06959304.1| 30S ribosomal protein S3 [Mycobacterium tuberculosis KZN R506]
 gi|306774818|ref|ZP_07413155.1| 30S ribosomal protein S3 rpsC [Mycobacterium tuberculosis SUMu001]
 gi|306781449|ref|ZP_07419786.1| 30S ribosomal protein S3 rpsC [Mycobacterium tuberculosis SUMu002]
 gi|306783359|ref|ZP_07421681.1| 30S ribosomal protein S3 rpsC [Mycobacterium tuberculosis SUMu003]
 gi|306787729|ref|ZP_07426051.1| 30S ribosomal protein S3 rpsC [Mycobacterium tuberculosis SUMu004]
 gi|306794497|ref|ZP_07432799.1| 30S ribosomal protein S3 rpsC [Mycobacterium tuberculosis SUMu005]
 gi|306796462|ref|ZP_07434764.1| 30S ribosomal protein S3 rpsC [Mycobacterium tuberculosis SUMu006]
 gi|306806531|ref|ZP_07443199.1| 30S ribosomal protein S3 rpsC [Mycobacterium tuberculosis SUMu007]
 gi|306970920|ref|ZP_07483581.1| 30S ribosomal protein S3 rpsC [Mycobacterium tuberculosis SUMu010]
 gi|307078650|ref|ZP_07487820.1| 30S ribosomal protein S3 rpsC [Mycobacterium tuberculosis SUMu011]
 gi|307083214|ref|ZP_07492327.1| 30S ribosomal protein S3 rpsC [Mycobacterium tuberculosis SUMu012]
 gi|313657513|ref|ZP_07814393.1| 30S ribosomal protein S3 [Mycobacterium tuberculosis KZN V2475]
 gi|61236258|sp|P0A5X6|RS3_MYCTU RecName: Full=30S ribosomal protein S3
 gi|61236268|sp|P0A5X7|RS3_MYCBO RecName: Full=30S ribosomal protein S3
 gi|152060877|sp|A1KGI8|RS3_MYCBP RecName: Full=30S ribosomal protein S3
 gi|189045021|sp|A5U093|RS3_MYCTA RecName: Full=30S ribosomal protein S3
 gi|254764536|sp|C1AL41|RS3_MYCBT RecName: Full=30S ribosomal protein S3
 gi|1806175|emb|CAB06470.1| PROBABLE 30S RIBOSOMAL PROTEIN S3 RPSC [Mycobacterium tuberculosis
           H37Rv]
 gi|13880264|gb|AAK44965.1| ribosomal protein S3 [Mycobacterium tuberculosis CDC1551]
 gi|31617479|emb|CAD93589.1| PROBABLE 30S RIBOSOMAL PROTEIN S3 RPSC [Mycobacterium bovis
           AF2122/97]
 gi|121492276|emb|CAL70743.1| Probable 30S ribosomal protein S3 rpsC [Mycobacterium bovis BCG
           str. Pasteur 1173P2]
 gi|124600086|gb|EAY59096.1| 30S ribosomal protein S3 rpsC [Mycobacterium tuberculosis C]
 gi|148504634|gb|ABQ72443.1| 30S ribosomal protein S3 [Mycobacterium tuberculosis H37Ra]
 gi|148720439|gb|ABR05064.1| 30S ribosomal protein S3 rpsC [Mycobacterium tuberculosis F11]
 gi|224772214|dbj|BAH25020.1| 30S ribosomal protein S3 [Mycobacterium bovis BCG str. Tokyo 172]
 gi|253319153|gb|ACT23756.1| 30S ribosomal protein S3 rpsC [Mycobacterium tuberculosis KZN 1435]
 gi|289415027|gb|EFD12267.1| 30S ribosomal protein S3 rpsC [Mycobacterium tuberculosis T46]
 gi|289419225|gb|EFD16426.1| 30S ribosomal protein S3 rpsC [Mycobacterium tuberculosis CPHL_A]
 gi|289437596|gb|EFD20089.1| 30S ribosomal protein S3 rpsC [Mycobacterium tuberculosis KZN 605]
 gi|289537746|gb|EFD42324.1| 30S ribosomal protein S3 rpsC [Mycobacterium tuberculosis K85]
 gi|289542405|gb|EFD46053.1| 30S ribosomal protein S3 rpsC [Mycobacterium tuberculosis T17]
 gi|289684959|gb|EFD52447.1| 30S ribosomal protein S3 [Mycobacterium tuberculosis 02_1987]
 gi|289689801|gb|EFD57230.1| 30S ribosomal protein S3 rpsC [Mycobacterium tuberculosis T92]
 gi|289693341|gb|EFD60770.1| 30S ribosomal protein S3 [Mycobacterium tuberculosis EAS054]
 gi|289708340|gb|EFD72356.1| 30S ribosomal protein S3 rpsC [Mycobacterium tuberculosis GM 1503]
 gi|308216708|gb|EFO76107.1| 30S ribosomal protein S3 rpsC [Mycobacterium tuberculosis SUMu001]
 gi|308325750|gb|EFP14601.1| 30S ribosomal protein S3 rpsC [Mycobacterium tuberculosis SUMu002]
 gi|308331853|gb|EFP20704.1| 30S ribosomal protein S3 rpsC [Mycobacterium tuberculosis SUMu003]
 gi|308335640|gb|EFP24491.1| 30S ribosomal protein S3 rpsC [Mycobacterium tuberculosis SUMu004]
 gi|308337097|gb|EFP25948.1| 30S ribosomal protein S3 rpsC [Mycobacterium tuberculosis SUMu005]
 gi|308343121|gb|EFP31972.1| 30S ribosomal protein S3 rpsC [Mycobacterium tuberculosis SUMu006]
 gi|308347008|gb|EFP35859.1| 30S ribosomal protein S3 rpsC [Mycobacterium tuberculosis SUMu007]
 gi|308359541|gb|EFP48392.1| 30S ribosomal protein S3 rpsC [Mycobacterium tuberculosis SUMu010]
 gi|308363446|gb|EFP52297.1| 30S ribosomal protein S3 rpsC [Mycobacterium tuberculosis SUMu011]
 gi|308367084|gb|EFP55935.1| 30S ribosomal protein S3 rpsC [Mycobacterium tuberculosis SUMu012]
 gi|323720834|gb|EGB29901.1| 30S ribosomal protein S3 rpsC [Mycobacterium tuberculosis CDC1551A]
 gi|326905071|gb|EGE52004.1| 30S ribosomal protein S3 rpsC [Mycobacterium tuberculosis W-148]
 gi|328457431|gb|AEB02854.1| 30S ribosomal protein S3 rpsC [Mycobacterium tuberculosis KZN 4207]
          Length = 274

 Score =  264 bits (675), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 102/215 (47%), Positives = 143/215 (66%), Gaps = 2/215 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP  FRLG+   W SRW+A   +Y   + ED+ IR  L   L++AG+A + IERT
Sbjct: 1   MGQKINPHGFRLGITTDWKSRWYAD-KQYAEYVKEDVAIRRLLSSGLERAGIADVEIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG++GT+ ++IR  L  +T  ++ L++ EV  PE  A L+AQ +
Sbjct: 60  RDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTGKQVQLNILEVKNPESQAQLVAQGV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAM-RFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           A+QL  RV FRRAM++A+QSAM +    G++V  SGRL GAE+SR+E Y EGRVPL TLR
Sbjct: 120 AEQLSNRVAFRRAMRKAIQSAMRQPNVKGIRVQCSGRLGGAEMSRSEFYREGRVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDST 214
           A IDYG   A+T +G  G+KV++   D V      
Sbjct: 180 ADIDYGLYEAKTTFGRIGVKVWIYKGDIVGGKREL 214


>gi|294341604|emb|CAZ90021.1| 30S ribosomal protein S3 [Thiomonas sp. 3As]
          Length = 274

 Score =  264 bits (675), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 121/226 (53%), Positives = 159/226 (70%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V   W SRW+A  ++Y  +L ED+ +REYL   LK A V+++LIER 
Sbjct: 1   MGQKIHPTGFRLAVTRGWASRWYAPSTQYAKMLSEDIMVREYLAKRLKNASVSRVLIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI +YSARPG++IGKKG DIE ++ +L+      + + + EV KPEI+A LIA SI
Sbjct: 61  AKNARITIYSARPGVVIGKKGEDIENLKAELAKRLGVPVAVDIEEVRKPEIDAQLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLE+R+ FRRAMKRA+Q+AMR GA G+K+++SGRLNG E++R E Y EGRVPLQTLRA
Sbjct: 121 TQQLEKRIQFRRAMKRAMQNAMRMGAQGIKIMSSGRLNGIEIARREWYREGRVPLQTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
           +IDY T+ A+T YG  G+KV+V   D  +        AE    E+D
Sbjct: 181 NIDYATSEAKTTYGVIGVKVWVYKGDTPAKGAIVPAKAEPAAPEED 226


>gi|296137300|ref|YP_003644542.1| ribosomal protein S3 [Thiomonas intermedia K12]
 gi|295797422|gb|ADG32212.1| ribosomal protein S3 [Thiomonas intermedia K12]
          Length = 278

 Score =  264 bits (675), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 121/226 (53%), Positives = 159/226 (70%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V   W SRW+A  ++Y  +L ED+ +REYL   LK A V+++LIER 
Sbjct: 1   MGQKIHPTGFRLAVTRGWASRWYAPSTQYAKMLSEDIMVREYLAKRLKNASVSRVLIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI +YSARPG++IGKKG DIE ++ +L+      + + + EV KPEI+A LIA SI
Sbjct: 61  AKNARITIYSARPGVVIGKKGEDIENLKAELAKRLGVPVAVDIEEVRKPEIDAQLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLE+R+ FRRAMKRA+Q+AMR GA G+K+++SGRLNG E++R E Y EGRVPLQTLRA
Sbjct: 121 TQQLEKRIQFRRAMKRAMQNAMRMGAQGIKIMSSGRLNGIEIARREWYREGRVPLQTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
           +IDY T+ A+T YG  G+KV+V   D  +        AE    E+D
Sbjct: 181 NIDYATSEAKTTYGVIGVKVWVYKGDTPAKGAIVPAKAEPAAPEED 226


>gi|296141109|ref|YP_003648352.1| ribosomal protein S3 [Tsukamurella paurometabola DSM 20162]
 gi|296029243|gb|ADG80013.1| ribosomal protein S3 [Tsukamurella paurometabola DSM 20162]
          Length = 268

 Score =  264 bits (675), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 102/219 (46%), Positives = 146/219 (66%), Gaps = 2/219 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP  FRLG+   W SRW+A   +Y   + ED+ IR+ L   L++AG++KI IERT
Sbjct: 1   MGQKINPHGFRLGITTDWKSRWYAD-KQYAEYVKEDVAIRKKLTDGLERAGISKIEIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG++G + ++IR +L  +T  ++ L++ EV   E +A L+AQ I
Sbjct: 60  RDRVRVDIHTARPGIVIGRRGAEADRIRSELEKLTGKQVQLNILEVKNSEADAQLVAQGI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAM-RFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           A+QL  RV FRRAM++A+QSAM +    G++V  SGRL GAE+SR+E Y EGRVPL TLR
Sbjct: 120 AEQLSNRVAFRRAMRKAIQSAMRQPNVKGIRVQCSGRLGGAEMSRSEFYREGRVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAA 218
           A IDYG   A+T +G  G+KV++   D V         +
Sbjct: 180 ADIDYGLHEAKTTFGRIGVKVWIYKGDVVGGRRELAAPS 218


>gi|91774641|ref|YP_544397.1| 30S ribosomal protein S3 [Methylobacillus flagellatus KT]
 gi|123078974|sp|Q1H4N1|RS3_METFK RecName: Full=30S ribosomal protein S3
 gi|91708628|gb|ABE48556.1| SSU ribosomal protein S3P [Methylobacillus flagellatus KT]
          Length = 236

 Score =  264 bits (675), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 126/228 (55%), Positives = 164/228 (71%), Gaps = 2/228 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V   W+SRW+A  + + A+L  D+K+RE+L+  L  A V+KI+IER 
Sbjct: 1   MGQKIHPFGFRLSVQKNWSSRWYANSNNFPAMLSSDIKVREFLKKKLAHAAVSKIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN +I +YSARPG++IGKKG DIE +R  L  +    +HL++ EV KPEI+ATLIA+SI
Sbjct: 61  AKNAKITIYSARPGIVIGKKGEDIESLRSGLQGLMGVPVHLNIEEVRKPEIDATLIAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLE+RV+FRRAMKRA+Q+AMR GA G+K+++SGRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLEKRVMFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTI--PAAEHRVVEKD 226
            IDYG A A+T YG  GIKV+V   +   +       PA   + V K 
Sbjct: 181 DIDYGVAEAKTTYGIIGIKVWVFKGEVFGNKIEQAAQPAEPEKKVRKS 228


>gi|258651369|ref|YP_003200525.1| 30S ribosomal protein S3 [Nakamurella multipartita DSM 44233]
 gi|258554594|gb|ACV77536.1| ribosomal protein S3 [Nakamurella multipartita DSM 44233]
          Length = 279

 Score =  264 bits (675), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 98/210 (46%), Positives = 148/210 (70%), Gaps = 2/210 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP  FRLG+   WNSRW+A    Y   + ED++IR+ +   +++AG++K+ IERT
Sbjct: 1   MGQKINPHGFRLGITTDWNSRWYAD-KSYADYVAEDVQIRKLMSKGMERAGISKVEIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG++G + ++IR +L  +T  ++ L++ EV  PE +A L+AQ++
Sbjct: 60  RDRVRVDIHTARPGIVIGRRGAEADRIRGQLEKLTGKQVQLNILEVRNPESDAQLVAQAV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMR-FGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           A+QL  RV FRRAM++++QSA R     G+++  SGRL GAE+SR+E Y EGRVPL TLR
Sbjct: 120 AEQLSNRVSFRRAMRKSMQSAQRSPQVKGIRIQCSGRLGGAEMSRSEFYREGRVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVS 209
           A IDYG   A+T +G  G+KV++   D+V 
Sbjct: 180 ADIDYGFFEAKTTFGRIGVKVWIYKGDKVG 209


>gi|299065421|emb|CBJ36590.1| 30S ribosomal subunit protein S3 [Ralstonia solanacearum CMR15]
          Length = 265

 Score =  264 bits (675), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 116/225 (51%), Positives = 162/225 (72%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V+  W SRW+A  +++  +L ED+++RE+L+  LK A V +++IER 
Sbjct: 1   MGQKIHPTGFRLAVSRNWASRWYANNTQFAGMLKEDIEVREFLKKKLKNASVGRVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI +YS+RPG++IGKKG DIE ++ +L       +H+++ E+ KPE++A LIA SI
Sbjct: 61  AKNARITIYSSRPGVVIGKKGEDIELLKAELQRRMGVPVHVNIEEIRKPEVDAQLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLERR++FRRAMKRA+Q+AMR GA G+K+++SGRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 TQQLERRIMFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDYG + AET YG  G+KV+V   D +  +D+ +         K
Sbjct: 181 DIDYGFSEAETTYGIIGVKVWVYKGDHLGRNDAPVVEEPQEERRK 225


>gi|127511098|ref|YP_001092295.1| 30S ribosomal protein S3 [Shewanella loihica PV-4]
 gi|152060904|sp|A3Q988|RS3_SHELP RecName: Full=30S ribosomal protein S3
 gi|126636393|gb|ABO22036.1| SSU ribosomal protein S3P [Shewanella loihica PV-4]
          Length = 229

 Score =  264 bits (675), Expect = 7e-69,   Method: Composition-based stats.
 Identities = 110/225 (48%), Positives = 157/225 (69%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   W S W+A  S+Y   L  D ++R++L+  LKQA V+KI+IER 
Sbjct: 1   MGQKVHPNGIRLGITKPWISTWYADKSDYANNLSSDWEVRKFLEKKLKQASVSKIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R +++ +T     +++ E+ KPE++A L+A+ I
Sbjct: 61  AKSVRVTIHTARPGVVIGKKGEDVEKLRNEVAKLTGIPAQINIAEIRKPELDAKLVAEGI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDY TA + T YG  G+KV+V   + +      +   + +   K
Sbjct: 181 DIDYSTAESHTQYGVIGVKVWVFKGEVLDGVVPALEEPKQQPKRK 225


>gi|319654874|ref|ZP_08008949.1| 30S ribosomal protein S3 [Bacillus sp. 2_A_57_CT2]
 gi|317393437|gb|EFV74200.1| 30S ribosomal protein S3 [Bacillus sp. 2_A_57_CT2]
          Length = 218

 Score =  264 bits (675), Expect = 7e-69,   Method: Composition-based stats.
 Identities = 103/214 (48%), Positives = 151/214 (70%), Gaps = 1/214 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP+  R+GV   W S+W+A G +Y  LLHEDLK+REY+   L  A V+K+ IER 
Sbjct: 1   MGQKVNPVGLRVGVIRDWESKWYA-GKDYADLLHEDLKVREYITKRLSDASVSKVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                I +++A+PG++IGK GT++E +RK L+++T   +H+++ E+ + +I+A L+A++I
Sbjct: 60  ANRLNITIHTAKPGMVIGKGGTEVEALRKSLNSLTGKRVHINILEIKRADIDAKLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE RV FRRA K+ +Q AMR GA G+K + SGRL GA+++R+E Y EG VPL TLRA
Sbjct: 120 ARQLENRVSFRRAQKQTIQRAMRAGAKGIKTMVSGRLGGADIARSESYSEGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDST 214
            IDY TA A+T YG  G+KV++   + +     T
Sbjct: 180 DIDYATAEADTTYGKLGVKVWIYRGEVLPTKKKT 213


>gi|139438586|ref|ZP_01772102.1| Hypothetical protein COLAER_01100 [Collinsella aerofaciens ATCC
           25986]
 gi|133776125|gb|EBA39945.1| Hypothetical protein COLAER_01100 [Collinsella aerofaciens ATCC
           25986]
          Length = 236

 Score =  264 bits (674), Expect = 7e-69,   Method: Composition-based stats.
 Identities = 109/222 (49%), Positives = 154/222 (69%), Gaps = 4/222 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+ P  FRLG+   W SRWFA   +Y   L  DL+IR+YL+  L +A V+++ IER 
Sbjct: 1   MGQKVYPTGFRLGITENWRSRWFAE-KDYAKTLGNDLEIRKYLEKRLSRAAVSRVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNM---TNSEIHLSVNEVPKPEINATLIA 117
               ++I+ +ARPG++IGKKG +I+ +R +L  +   +  ++ + V E+ +PE++A L+A
Sbjct: 60  GDKVKVIILTARPGVVIGKKGAEIDTLRTELEKVAGVSKGQLSVDVVEIKRPELDANLVA 119

Query: 118 QSIAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQT 177
           QSIA+QLE RV FRRAM++AVQSA + GA G+++  SGRL GAE+ R E Y EGRVPL T
Sbjct: 120 QSIAEQLEGRVAFRRAMRKAVQSARKAGAKGIRIQCSGRLGGAEMGRREWYREGRVPLHT 179

Query: 178 LRAHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
           LRA IDYGTAVA T  G+CG+KV++ L +++       PA E
Sbjct: 180 LRAKIDYGTAVASTTMGACGVKVWIYLGEKLPGQPVPNPALE 221


>gi|148652244|ref|YP_001279337.1| 30S ribosomal protein S3 [Psychrobacter sp. PRwf-1]
 gi|189045300|sp|A5WCJ6|RS3_PSYWF RecName: Full=30S ribosomal protein S3
 gi|148571328|gb|ABQ93387.1| SSU ribosomal protein S3P [Psychrobacter sp. PRwf-1]
          Length = 247

 Score =  264 bits (674), Expect = 7e-69,   Method: Composition-based stats.
 Identities = 110/222 (49%), Positives = 153/222 (68%), Gaps = 1/222 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI  RLGV    N+ W+A   +Y   L  DL++R+YL+  L  A ++ I+IER 
Sbjct: 1   MGQKVHPIGIRLGVVKKHNANWYADPKQYSEYLLNDLQVRDYLRKKLDNAMISHIMIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               +I + +ARPG++IGKKG DIEK++K+L+ M      +++ E+  P+++A L+A+ I
Sbjct: 61  TGAAKITISTARPGIVIGKKGEDIEKLQKELTKMMGVPAQVNIEEITSPDLDARLVAEGI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ++MR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQNSMRSGAQGIKVELSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDST-IPAAEHR 221
            IDY +  AET YG+ G+KV+V   + +   DS   P  E +
Sbjct: 181 DIDYASVRAETTYGTIGVKVWVFRGEILDGMDSVYNPPKEDK 222


>gi|54778756|gb|AAV39590.1| ribosomal protein S3 [synthetic construct]
          Length = 260

 Score =  264 bits (674), Expect = 7e-69,   Method: Composition-based stats.
 Identities = 112/229 (48%), Positives = 156/229 (68%), Gaps = 4/229 (1%)

Query: 2   GQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERTH 61
           GQK++P   RLG+   WNS WFA   E+   L  D K+R+YL   L +A V++I+IER  
Sbjct: 26  GQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLTKELAKASVSRIVIERPA 85

Query: 62  KNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSIA 121
           K+ R+ +++ARPG++IGKKG D+EK+RK ++++      +++ EV KPE++A L+A SI 
Sbjct: 86  KSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQINIAEVRKPELDAKLVADSIT 145

Query: 122 QQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRAH 181
            QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA 
Sbjct: 146 SQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRAD 205

Query: 182 IDYGTAVAETAYGSCGIKVYVSLRDEVSD----SDSTIPAAEHRVVEKD 226
           IDY T+ A T YG  G+KV++   + +           PAA+ +  ++ 
Sbjct: 206 IDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEKPAAQPKKQQRK 254


>gi|120402322|ref|YP_952151.1| 30S ribosomal protein S3 [Mycobacterium vanbaalenii PYR-1]
 gi|152060884|sp|A1T4P5|RS3_MYCVP RecName: Full=30S ribosomal protein S3
 gi|119955140|gb|ABM12145.1| SSU ribosomal protein S3P [Mycobacterium vanbaalenii PYR-1]
          Length = 280

 Score =  264 bits (674), Expect = 8e-69,   Method: Composition-based stats.
 Identities = 102/216 (47%), Positives = 144/216 (66%), Gaps = 2/216 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP  FRLG+   W SRW+A   +Y   + ED+ IR+ L   L++AG+A + IERT
Sbjct: 1   MGQKINPHGFRLGITTEWKSRWYAD-KQYADYIKEDVAIRKLLATGLERAGIADVEIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG++GT+ ++IR  L  +T  ++ L++ EV  PE  A L+AQ +
Sbjct: 60  RDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTKKQVQLNILEVKNPESVAQLVAQGV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAM-RFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           A+QL  RV FRRAM++A+QSAM +    G++V  SGRL GAE+SR+E Y EGRVPL TLR
Sbjct: 120 AEQLSNRVAFRRAMRKAIQSAMRQPNVKGIRVQCSGRLGGAEMSRSEFYREGRVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTI 215
           A IDYG   A+T +G  G+KV++   D V       
Sbjct: 180 ADIDYGLYEAKTTFGRIGVKVWIYKGDIVGGKRELT 215


>gi|291482494|dbj|BAI83569.1| 30S ribosomal protein S3 [Bacillus subtilis subsp. natto BEST195]
          Length = 218

 Score =  264 bits (674), Expect = 8e-69,   Method: Composition-based stats.
 Identities = 99/209 (47%), Positives = 147/209 (70%), Gaps = 1/209 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP+  R+GV   W S+W+A G +Y   LHEDLKIREY+   L  A V+K+ IER 
Sbjct: 1   MGQKVNPVGLRIGVIRDWESKWYA-GKDYADFLHEDLKIREYISKRLSDASVSKVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                I +++A+PG++IGK G+++E +RK L+++T   +H+++ E+ + +++A L+A +I
Sbjct: 60  ANRVNITIHTAKPGMVIGKGGSEVEALRKALNSLTGKRVHINILEIKRADLDAQLVADNI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE RV FRRA K+ +Q  MR GA GVK + SGRL GA+++R+E Y EG VPL TLRA
Sbjct: 120 ARQLENRVSFRRAQKQQIQRTMRAGAQGVKTMVSGRLGGADIARSEYYSEGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVS 209
            IDY T+ A+T YG  G+KV++   + + 
Sbjct: 180 DIDYATSEADTTYGKLGVKVWIYRGEVLP 208


>gi|148982468|ref|ZP_01816770.1| 30S ribosomal protein S3 [Vibrionales bacterium SWAT-3]
 gi|145960459|gb|EDK25836.1| 30S ribosomal protein S3 [Vibrionales bacterium SWAT-3]
          Length = 232

 Score =  264 bits (674), Expect = 8e-69,   Method: Composition-based stats.
 Identities = 108/224 (48%), Positives = 154/224 (68%), Gaps = 1/224 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WN+ WFA   ++   L  D K+R++L   L++A +++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNATWFANTKDFADNLDGDFKVRQFLTKELQKASLSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  ++ +      +++ EV KPE++  L+A SI
Sbjct: 61  AKSIRVTIHTARPGVVIGKKGEDVEKLRAAVAKIAGVPAQINIAEVRKPELDGQLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVE 224
            IDY T+ A T YG  GIKV++  + E+        A E +  +
Sbjct: 181 DIDYATSSAHTQYGVIGIKVWIF-KGEILGGMPAANAVEPKGDK 223


>gi|187930358|ref|YP_001900845.1| 30S ribosomal protein S3 [Ralstonia pickettii 12J]
 gi|226697747|sp|B2UEL3|RS3_RALPJ RecName: Full=30S ribosomal protein S3
 gi|187727248|gb|ACD28413.1| ribosomal protein S3 [Ralstonia pickettii 12J]
          Length = 262

 Score =  264 bits (674), Expect = 8e-69,   Method: Composition-based stats.
 Identities = 116/225 (51%), Positives = 162/225 (72%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V+  W SRW+A  +++  +L ED+++RE+L+  LK A V +++IER 
Sbjct: 1   MGQKIHPTGFRLAVSRNWASRWYASNTQFAGMLKEDIEVREFLKKKLKNASVGRVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI +YS+RPG++IGKKG DIE ++ +L       +H+++ E+ KPE++A LIA SI
Sbjct: 61  AKNARITIYSSRPGVVIGKKGEDIELLKAELQRRMGVPVHVNIEEIRKPEVDAQLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLERR++FRRAMKRA+Q+AMR GA G+K+++SGRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 TQQLERRIMFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDYG + AET YG  G+KV+V   D +  +D+ +         K
Sbjct: 181 DIDYGFSEAETTYGIIGVKVWVYKGDHLGRNDAPVVEEPQEERRK 225


>gi|119478126|ref|ZP_01618205.1| 30S ribosomal protein S3 [marine gamma proteobacterium HTCC2143]
 gi|119448832|gb|EAW30075.1| 30S ribosomal protein S3 [marine gamma proteobacterium HTCC2143]
          Length = 227

 Score =  264 bits (674), Expect = 8e-69,   Method: Composition-based stats.
 Identities = 108/222 (48%), Positives = 153/222 (68%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI  RLG+     S W+A G  Y   L  DL++RE+L+  L  A V++I+IER 
Sbjct: 1   MGQKVHPIGIRLGITKQHTSIWYAEGGAYAEHLINDLEVREFLEKKLNSASVSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +  RI +++ARPG+IIGKKG D++K+RK+LS      +H+++ E+ KP+++A L+AQ++
Sbjct: 61  AQTARITIHTARPGIIIGKKGEDVDKLRKELSAKMGVPVHINIEEIRKPDLDAKLVAQNV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKR VQ+AMR GA G+KV  SGR+ GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AGQLERRVMFRRAMKRVVQNAMRQGAQGIKVQVSGRVGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRV 222
            IDY    A T YG  G+KV++   + +   +     A+ + 
Sbjct: 181 DIDYSAYEAATTYGIIGVKVWIFKGEVIGGVEEVEVQAKGKK 222


>gi|261409515|ref|YP_003245756.1| 30S ribosomal protein S3 [Paenibacillus sp. Y412MC10]
 gi|315649693|ref|ZP_07902777.1| ribosomal protein S3 [Paenibacillus vortex V453]
 gi|329922023|ref|ZP_08277816.1| ribosomal protein S3 [Paenibacillus sp. HGF5]
 gi|261285978|gb|ACX67949.1| ribosomal protein S3 [Paenibacillus sp. Y412MC10]
 gi|315274881|gb|EFU38257.1| ribosomal protein S3 [Paenibacillus vortex V453]
 gi|328942406|gb|EGG38670.1| ribosomal protein S3 [Paenibacillus sp. HGF5]
          Length = 221

 Score =  264 bits (674), Expect = 8e-69,   Method: Composition-based stats.
 Identities = 103/219 (47%), Positives = 154/219 (70%), Gaps = 2/219 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP+  R+G+   W S+W+A G ++G LL ED+KIREYL+  LK + V++I IER 
Sbjct: 1   MGQKVNPVGLRIGIIRDWESKWYA-GKDFGDLLLEDVKIREYLKNKLKDSAVSRIEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTN-SEIHLSVNEVPKPEINATLIAQS 119
                + +++A+PG++IGK G+++E +R +++ +    ++H++++E+  PE++A L+A+S
Sbjct: 60  ANRVNVTIHTAKPGMVIGKGGSEVEVLRGQVTKIAGGKKVHINISEIKNPELDAILVAES 119

Query: 120 IAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           IAQQLERRV FRRA+K+A+Q  MR GA G+K   SGRL GAE++RTE Y EG VPL TLR
Sbjct: 120 IAQQLERRVSFRRALKQAIQRTMRSGAKGIKTSVSGRLGGAEIARTEGYSEGTVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAA 218
           A IDYGTA A T YG  G+KV++   + +  +       
Sbjct: 180 ADIDYGTAEAHTTYGRIGVKVWIYRGEVLPTAKKQAAQE 218


>gi|170729003|ref|YP_001763029.1| 30S ribosomal protein S3 [Shewanella woodyi ATCC 51908]
 gi|169814350|gb|ACA88934.1| ribosomal protein S3 [Shewanella woodyi ATCC 51908]
          Length = 229

 Score =  264 bits (674), Expect = 9e-69,   Method: Composition-based stats.
 Identities = 109/226 (48%), Positives = 156/226 (69%), Gaps = 4/226 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   W S W+A  S+Y   L  D ++R++L+ +LKQA V+KI+IER 
Sbjct: 1   MGQKVHPNGIRLGITKPWISTWYADKSDYANNLTSDWEVRKFLEKNLKQASVSKIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  ++ +T     +++ E+ KPE++A L+A+ I
Sbjct: 61  AKSVRVTIHTARPGVVIGKKGEDVEKLRNAVAKLTGIPAQINIAEIRKPELDAKLVAEGI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRD----EVSDSDSTIPAAEHRV 222
            IDY TA + T YG  G+KV+V   +     +   +      + + 
Sbjct: 181 DIDYSTAESHTQYGVIGVKVWVFKGEVLDGVLPAHEEPKQQPKRKP 226


>gi|254468886|ref|ZP_05082292.1| ribosomal protein S3 [beta proteobacterium KB13]
 gi|207087696|gb|EDZ64979.1| ribosomal protein S3 [beta proteobacterium KB13]
          Length = 282

 Score =  264 bits (674), Expect = 9e-69,   Method: Composition-based stats.
 Identities = 122/226 (53%), Positives = 159/226 (70%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI FRLGV   W+S+WF     +   L+ D+K+RE+L   L  A V+KI+IER 
Sbjct: 1   MGQKINPIGFRLGVQKNWSSKWFTSTKNFPVFLNNDIKVREFLNKKLANAAVSKIIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN ++ + +ARPG++IGKKG DIE +R  L  +    + L++ EV KPEI+ATLIAQSI
Sbjct: 61  AKNAKVTIMTARPGIVIGKKGEDIENLRSDLQGLMGIPVQLNIEEVRKPEIDATLIAQSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLE+RV FRRAMKRA+Q+AMR GA G+K+++SGRLNG E++R+E Y EGRVPL TLRA
Sbjct: 121 AQQLEKRVQFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGIEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            IDYG A A+T YG  GIKV++   +   D     P  +  V +K 
Sbjct: 181 DIDYGVARAQTQYGIIGIKVWIYKGEVFQDDKVASPITKDVVGDKS 226


>gi|297582456|ref|YP_003698236.1| 30S ribosomal protein S3 [Bacillus selenitireducens MLS10]
 gi|297140913|gb|ADH97670.1| ribosomal protein S3 [Bacillus selenitireducens MLS10]
          Length = 219

 Score =  264 bits (674), Expect = 9e-69,   Method: Composition-based stats.
 Identities = 101/211 (47%), Positives = 152/211 (72%), Gaps = 1/211 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP   R+GV   W S+W+A G +Y  LLHED++IRE+L+  L +A V+ I IER 
Sbjct: 1   MGQKINPNGLRVGVIKGWESKWYA-GKDYADLLHEDIRIREFLENRLTEASVSTIEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                + +++A+PG++IGK G+++E +RK L++MT   +H+++NE+ +P++++ L+A++I
Sbjct: 60  ANRVNVTIFTAKPGMVIGKGGSEVEALRKALNDMTGKRVHININEIKRPDLDSKLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE R+ FRRAMK+ +Q  MR GA G++   SGRL GA+++R+E Y EG VPL TLRA
Sbjct: 120 ARQLENRISFRRAMKQTIQRTMRSGAKGIRTQVSGRLGGADIARSESYSEGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDS 211
            IDYGTA A+T YG  GIKV++   + +   
Sbjct: 180 DIDYGTAEADTTYGKLGIKVWIYKGEVLPTK 210


>gi|253577185|ref|ZP_04854505.1| 30S ribosomal protein S3 [Paenibacillus sp. oral taxon 786 str.
           D14]
 gi|251843429|gb|EES71457.1| 30S ribosomal protein S3 [Paenibacillus sp. oral taxon 786 str.
           D14]
          Length = 222

 Score =  264 bits (674), Expect = 9e-69,   Method: Composition-based stats.
 Identities = 103/220 (46%), Positives = 156/220 (70%), Gaps = 2/220 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP+  R+G+   W S+W+A G ++G LL ED+KIRE+L+  LK + V++I IER 
Sbjct: 1   MGQKVNPVGLRVGIIRDWESKWYA-GKDFGDLLLEDVKIREHLKNKLKDSAVSRIEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTN-SEIHLSVNEVPKPEINATLIAQS 119
                + +++A+PG++IGK G+++E +R +++ +    ++H++++E+  P+++A L+A+S
Sbjct: 60  ANRVNVTIHTAKPGMVIGKGGSEVENLRGEITKIAGGKKVHINISEIKHPDLDAILVAES 119

Query: 120 IAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           IAQQLERRV FRRA+K+A+Q  MR GA G+K   SGRL GAE++RTE Y EG VPL TLR
Sbjct: 120 IAQQLERRVSFRRALKQAIQRTMRSGAKGIKTAVSGRLGGAEIARTEGYSEGTVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
           A IDYGTA A T YG  G+KV++   + +  +     A E
Sbjct: 180 ADIDYGTAEAHTTYGRIGVKVWIYRGEVLPTAKKQQAAQE 219


>gi|326388203|ref|ZP_08209806.1| 30S ribosomal protein S3 [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326207369|gb|EGD58183.1| 30S ribosomal protein S3 [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 231

 Score =  263 bits (673), Expect = 9e-69,   Method: Composition-based stats.
 Identities = 124/218 (56%), Positives = 156/218 (71%), Gaps = 1/218 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K NPI  RL +N TW+SRWFA G  Y  LL EDL IR+Y+   L QA ++K++IER 
Sbjct: 1   MGHKTNPIGLRLQINRTWDSRWFAEGRSYAQLLKEDLTIRKYIVEKLPQAAISKVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K CR+ +Y+ARPG+IIGKKG DIEK+R KLS +T S++ L++ E+ KPEI+A L+AQ I
Sbjct: 61  AKVCRVSIYAARPGVIIGKKGADIEKLRAKLSTLTASDVKLNIVEIRKPEIDAKLVAQGI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QL RRV FRRAMKRAVQSA+R GA+G+K+   GRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 ADQLVRRVAFRRAMKRAVQSALRLGAEGIKITCGGRLGGAEIARVEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAA 218
           +IDY  A A TAYG  GIK ++  + E+   D      
Sbjct: 181 NIDYAEAEAHTAYGVIGIKTWIF-KGEILGHDPLAQDR 217


>gi|292669853|ref|ZP_06603279.1| 30S ribosomal protein S3 [Selenomonas noxia ATCC 43541]
 gi|292648650|gb|EFF66622.1| 30S ribosomal protein S3 [Selenomonas noxia ATCC 43541]
          Length = 223

 Score =  263 bits (673), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 101/222 (45%), Positives = 154/222 (69%), Gaps = 1/222 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   RLG+   W++RW+A   ++   LHED+KIR+YL+  L+ AGV ++  ER+
Sbjct: 1   MGQKVNPHGIRLGIVKDWDARWYAD-KDFAQNLHEDIKIRDYLKKSLQTAGVPRVETERS 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               ++ +++A+PG++IG+ G+ IE+I++ L N+T+  + +++ E+ +P+++ATL+A++I
Sbjct: 60  KNRLKLTIHTAKPGMVIGRGGSGIEQIKEGLKNLTDKRVDINIAEIKQPDLDATLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERR+ FRRAMK+AV   MR GA G+K+  SGRL GAE++R E Y EG +PL TLRA
Sbjct: 120 AAQLERRIAFRRAMKQAVGRTMRLGAKGIKIAVSGRLGGAEIARRESYREGSIPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRV 222
            IDYGTA A T YG  GIKV++   + + D        + R 
Sbjct: 180 DIDYGTAEAHTTYGRIGIKVWIFKGEVLHDKKQQSRNGKERS 221


>gi|309782840|ref|ZP_07677560.1| ribosomal protein S3 [Ralstonia sp. 5_7_47FAA]
 gi|308918264|gb|EFP63941.1| ribosomal protein S3 [Ralstonia sp. 5_7_47FAA]
          Length = 262

 Score =  263 bits (673), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 116/225 (51%), Positives = 162/225 (72%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V+  W SRW+A  +++  +L ED+++RE+L+  LK A V +++IER 
Sbjct: 1   MGQKIHPTGFRLAVSRNWASRWYASNTQFAGMLKEDIEVREFLKKKLKNASVGRVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI +YS+RPG++IGKKG DIE ++ +L       +H+++ E+ KPE++A LIA SI
Sbjct: 61  AKNARITIYSSRPGVVIGKKGEDIELLKAELQRRMGVPVHVNIEEIRKPEVDAQLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLERR++FRRAMKRA+Q+AMR GA G+K+++SGRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 TQQLERRIMFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDYG + AET YG  G+KV+V   D +  +D+ +         K
Sbjct: 181 DIDYGFSEAETTYGIIGVKVWVYKGDHLGRNDAPVVEEPQEERRK 225


>gi|207721892|ref|YP_002252330.1| 30s ribosomal protein s3 [Ralstonia solanacearum MolK2]
 gi|300702786|ref|YP_003744387.1| 30S ribosomal protein S3 [Ralstonia solanacearum CFBP2957]
 gi|206587060|emb|CAQ17644.1| 30s ribosomal protein s3 [Ralstonia solanacearum MolK2]
 gi|299070448|emb|CBJ41743.1| 30S ribosomal subunit protein S3 [Ralstonia solanacearum CFBP2957]
          Length = 264

 Score =  263 bits (673), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 116/225 (51%), Positives = 162/225 (72%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V+  W SRW+A  +++  +L ED+++RE+L+  LK A V +++IER 
Sbjct: 1   MGQKIHPTGFRLAVSRNWASRWYASNTQFAGMLKEDIEVREFLKKKLKNASVGRVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI +YS+RPG++IGKKG DIE ++ +L       +H+++ E+ KPE++A LIA SI
Sbjct: 61  AKNARITIYSSRPGVVIGKKGEDIELLKAELQRRMGVPVHVNIEEIRKPEVDAQLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLERR++FRRAMKRA+Q+AMR GA G+K+++SGRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 TQQLERRIMFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDYG + AET YG  G+KV+V   D +  +D+ +         K
Sbjct: 181 DIDYGFSEAETTYGIIGVKVWVYKGDHLGRNDAPVVEEPQEERRK 225


>gi|241664526|ref|YP_002982886.1| 30S ribosomal protein S3 [Ralstonia pickettii 12D]
 gi|240866553|gb|ACS64214.1| ribosomal protein S3 [Ralstonia pickettii 12D]
          Length = 264

 Score =  263 bits (673), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 116/225 (51%), Positives = 162/225 (72%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V+  W SRW+A  +++  +L ED+++RE+L+  LK A V +++IER 
Sbjct: 1   MGQKIHPTGFRLAVSRNWASRWYASNTQFAGMLKEDIEVREFLKKKLKNASVGRVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI +YS+RPG++IGKKG DIE ++ +L       +H+++ E+ KPE++A LIA SI
Sbjct: 61  AKNARITIYSSRPGVVIGKKGEDIELLKAELQRRMGVPVHVNIEEIRKPEVDAQLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLERR++FRRAMKRA+Q+AMR GA G+K+++SGRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 TQQLERRIMFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDYG + AET YG  G+KV+V   D +  +D+ +         K
Sbjct: 181 DIDYGFSEAETTYGIIGVKVWVYKGDHLGRNDAPVVEEPQEERRK 225


>gi|17547732|ref|NP_521134.1| 30S ribosomal protein S3 [Ralstonia solanacearum GMI1000]
 gi|27734516|sp|Q8XV18|RS3_RALSO RecName: Full=30S ribosomal protein S3
 gi|17430037|emb|CAD16722.1| probable 30s ribosomal protein s3 [Ralstonia solanacearum GMI1000]
          Length = 264

 Score =  263 bits (673), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 116/225 (51%), Positives = 162/225 (72%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V+  W SRW+A  +++  +L ED+++RE+L+  LK A V +++IER 
Sbjct: 1   MGQKIHPTGFRLAVSRNWASRWYASNTQFAGMLKEDIEVREFLKKKLKNASVGRVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI +YS+RPG++IGKKG DIE ++ +L       +H+++ E+ KPE++A LIA SI
Sbjct: 61  AKNARITIYSSRPGVVIGKKGEDIELLKAELQRRMGVPVHVNIEEIRKPEVDAQLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLERR++FRRAMKRA+Q+AMR GA G+K+++SGRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 TQQLERRIMFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDYG + AET YG  G+KV+V   D +  +D+ +         K
Sbjct: 181 DIDYGFSEAETTYGIIGVKVWVYKGDHLGRNDAPVVEEPQEERRK 225


>gi|160932195|ref|ZP_02079586.1| hypothetical protein CLOLEP_01030 [Clostridium leptum DSM 753]
 gi|156868797|gb|EDO62169.1| hypothetical protein CLOLEP_01030 [Clostridium leptum DSM 753]
          Length = 223

 Score =  263 bits (673), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 106/225 (47%), Positives = 150/225 (66%), Gaps = 2/225 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   R+GV   W+SRWFA+  ++G  L ED  +R++L+  L  AGV KI IER 
Sbjct: 1   MGQKVNPHGLRVGVIKDWDSRWFAKDKDFGDTLVEDYNLRKHLKKKLYGAGVPKIEIERD 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               RI ++ A+PG++IGK G +IEK+R +   + N  + +++ EV  P++NA L+A++I
Sbjct: 61  ASKVRIHIHCAKPGMVIGKGGAEIEKLRLECEKILNKPVAINIVEVKSPDLNAQLVAENI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLE+R+ FRRAMK+A+  AMRFGA G+K    GRL GAE++RTE Y EG +PLQT+RA
Sbjct: 121 AQQLEKRISFRRAMKQAIGRAMRFGAKGIKTQVGGRLGGAEIARTEQYHEGTIPLQTIRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDYG A A T YG  G+KV++   + +   ++  P A      K
Sbjct: 181 DIDYGFAEAATTYGRIGVKVWLYRGEVL--QNAGRPRARREGGNK 223


>gi|111220552|ref|YP_711346.1| 30S ribosomal protein S3 [Frankia alni ACN14a]
 gi|122954579|sp|Q0RRR5|RS3_FRAAA RecName: Full=30S ribosomal protein S3
 gi|111148084|emb|CAJ59752.1| 30S ribosomal protein S3 [Frankia alni ACN14a]
          Length = 350

 Score =  263 bits (673), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 99/218 (45%), Positives = 149/218 (68%), Gaps = 1/218 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP  FRLG+   + SRW+A   +Y A + ED+KIR+ +   +++AG++++ IERT
Sbjct: 1   MGQKVNPHGFRLGITSEFTSRWYAD-KQYKAYVGEDVKIRKMMSRGMERAGISRVDIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG++G + ++IR  L  +T  ++ L++ EV  PE++A L+AQ +
Sbjct: 60  QGRLRVDIHTARPGIVIGRRGAEADRIRGDLEKLTGKQVQLNILEVKNPEVDAQLVAQGV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QL  RV FRRAM++A+Q+AM+ GA G++V  SGRL GAE+SR+E Y EGRVPL TLRA
Sbjct: 120 AEQLSSRVSFRRAMRKAMQTAMKGGAKGIRVQCSGRLGGAEMSRSEFYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAA 218
            IDYG   A T +G  G+KV++   D V          
Sbjct: 180 DIDYGFYEARTNFGRIGVKVWIYKGDIVQSRAEREAQE 217


>gi|325123598|gb|ADY83121.1| 30S ribosomal protein S3 [Acinetobacter calcoaceticus PHEA-2]
          Length = 265

 Score =  263 bits (673), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 112/228 (49%), Positives = 159/228 (69%), Gaps = 2/228 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI  RLGV    N+ W+A   +Y   L +DL++RE+L   LK A V+ ILIER 
Sbjct: 1   MGQKVHPIGIRLGVVKRHNANWYANPKQYAEYLLKDLQVREFLTKKLKNAMVSNILIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               ++ + +ARPG++IGKKG DIEK++++L+++      +S+NE+ +P+++A L+A++I
Sbjct: 61  SGAAKVTISTARPGIVIGKKGEDIEKLQRELTSIMGVPAQVSINEIDRPDLDARLVAEAI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLE+RV+FRRAMKRAVQ+ MR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 ASQLEKRVMFRRAMKRAVQNTMRAGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD-SDSTIPA-AEHRVVEKD 226
            IDY T  AET YG+ G+KV++   + +        PA AE R  ++ 
Sbjct: 181 DIDYATMRAETTYGTIGVKVWIFRGEILGGMKQVMNPAPAEDRPAKRG 228


>gi|59710849|ref|YP_203625.1| 30S ribosomal protein S3 [Vibrio fischeri ES114]
 gi|197334087|ref|YP_002155002.1| ribosomal protein S3 [Vibrio fischeri MJ11]
 gi|75507109|sp|Q5E8A9|RS3_VIBF1 RecName: Full=30S ribosomal protein S3
 gi|226697774|sp|B5FG15|RS3_VIBFM RecName: Full=30S ribosomal protein S3
 gi|59478950|gb|AAW84737.1| 30S ribosomal subunit protein S3 [Vibrio fischeri ES114]
 gi|197315577|gb|ACH65024.1| ribosomal protein S3 [Vibrio fischeri MJ11]
          Length = 232

 Score =  263 bits (673), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 111/224 (49%), Positives = 154/224 (68%), Gaps = 1/224 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WN+ WFA   E+   L  D K+R+YL   LK+A +++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNATWFASSQEFADNLDGDFKVRQYLTKELKKASLSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  ++ +      +++ EV KPE++  L+A SI
Sbjct: 61  AKSIRVTIHTARPGVVIGKKGEDVEKLRAGVAKIAGVPAQINIAEVRKPELDGQLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVE 224
            IDY T+ A T YG  G+KV++  + EV        A E +  +
Sbjct: 181 DIDYATSSAHTQYGVIGVKVWIF-KGEVLGGMPAANAVEPKADK 223


>gi|159039828|ref|YP_001539081.1| ribosomal protein S3 [Salinispora arenicola CNS-205]
 gi|189045330|sp|A8M523|RS3_SALAI RecName: Full=30S ribosomal protein S3
 gi|157918663|gb|ABW00091.1| ribosomal protein S3 [Salinispora arenicola CNS-205]
          Length = 288

 Score =  263 bits (673), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 104/227 (45%), Positives = 151/227 (66%), Gaps = 2/227 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P  FRLG++  W SRWFA    Y   + ED+KIR  +   L++AG++K+ IERT
Sbjct: 1   MGQKVHPHGFRLGISTDWKSRWFAD-KLYKDYIGEDVKIRRMMSKGLERAGISKVDIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG+KG + ++IR KL  +T  ++ L++ EV  PE +A L+AQ +
Sbjct: 60  RDRVRVDIHTARPGIVIGRKGAEADRIRGKLEKLTGKQVQLNIIEVKSPESDAQLVAQGV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFG-ADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           A+QL  RV FRRAM++A+QSAM+     G++V  SGRL GAE+SRTE Y EGRVPL TLR
Sbjct: 120 AEQLSSRVSFRRAMRKAMQSAMKNPVCKGIRVQVSGRLGGAEMSRTEFYREGRVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
           A+I+YG   A T +G  G+KV++   D V   ++   A      E+ 
Sbjct: 180 ANIEYGFFEARTTFGRIGVKVWIYKGDAVPGRETPAEAPSRPRRERG 226


>gi|2113872|emb|CAA73678.1| rpsC [Mycobacterium bovis BCG]
          Length = 274

 Score =  263 bits (673), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 101/215 (46%), Positives = 143/215 (66%), Gaps = 2/215 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP  FRLG+   W SRW+A   +Y   + ED+ IR  L   L++AG+A + IERT
Sbjct: 1   MGQKINPHGFRLGITTDWKSRWYAD-KQYAEYVKEDVAIRRLLSSGLERAGIADVEIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG++GT+ ++IR  L  +T  ++ L++ EV  PE  A L+AQ +
Sbjct: 60  RDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTGKQVQLNILEVKNPESQAQLVAQGV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAM-RFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           A+QL  RV FRRAM++A+QSAM +    G++V  SGRL GAE++R+E Y EGRVPL TLR
Sbjct: 120 AEQLSNRVAFRRAMRKAIQSAMRQPNVKGIRVQCSGRLGGAEMNRSEFYREGRVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDST 214
           A IDYG   A+T +G  G+KV++   D V      
Sbjct: 180 ADIDYGLYEAKTTFGRIGVKVWIYKGDIVGGKREL 214


>gi|332038831|gb|EGI75273.1| 30S ribosomal protein S3 [Pseudoalteromonas haloplanktis ANT/505]
          Length = 233

 Score =  263 bits (673), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 105/210 (50%), Positives = 150/210 (71%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG++  W S W+A   ++ A L  D K+R +L   LK A V+KI+IER 
Sbjct: 1   MGQKVHPTGIRLGISKPWVSTWYASSKDFSAQLFGDHKVRTFLTKELKTASVSKIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R+ ++ +      ++++EV KPE++A L+A  I
Sbjct: 61  AKSIRVTIHTARPGVVIGKKGEDVEKLRQAVTKIAGVPAQINISEVRKPELDAQLVADGI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKR+VQ+AMR G+ G+KV  SGRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRSVQNAMRIGSKGIKVEVSGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD 210
            IDY T+ A T YG  G+KV++   + +  
Sbjct: 181 DIDYATSEALTTYGIIGVKVWIFKGEVIGG 210


>gi|256380592|ref|YP_003104252.1| ribosomal protein S3 [Actinosynnema mirum DSM 43827]
 gi|255924895|gb|ACU40406.1| ribosomal protein S3 [Actinosynnema mirum DSM 43827]
          Length = 275

 Score =  263 bits (673), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 102/231 (44%), Positives = 150/231 (64%), Gaps = 6/231 (2%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP  FRLG+   W SRW+A   +Y   + ED+KIR+ L   +++AG++K+ IERT
Sbjct: 1   MGQKINPHGFRLGITTDWKSRWYAD-KQYAEYVAEDVKIRKLLSRGMERAGISKVEIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG++G + ++IR +L  +T  ++ L++ EV  PE +A L+AQ +
Sbjct: 60  RDRVRVDIHTARPGIVIGRRGAEADRIRGELEKLTKKQVQLNILEVKNPESDAQLVAQGV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGA-DGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           A+QL  RV FRRAM++A+QSAMR     G++V   GRL GAE+SR+E Y +GRVPL TLR
Sbjct: 120 AEQLSNRVAFRRAMRKAIQSAMRSSQVKGIRVQCGGRLGGAEMSRSEHYRDGRVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSD----SDSTIPAAEHRVVEKD 226
           A IDYG   A T +G  G+KV++   D V       +     +  R   +D
Sbjct: 180 ADIDYGFFEARTTFGRIGVKVWIYKGDVVGGISAKRERDAAPSAERAPRRD 230


>gi|296168563|ref|ZP_06850367.1| 30S ribosomal protein S3 [Mycobacterium parascrofulaceum ATCC
           BAA-614]
 gi|295896626|gb|EFG76265.1| 30S ribosomal protein S3 [Mycobacterium parascrofulaceum ATCC
           BAA-614]
          Length = 279

 Score =  263 bits (673), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 102/215 (47%), Positives = 143/215 (66%), Gaps = 2/215 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP  FRLG+   W SRW+A   +Y   + ED+ IR  L   L++AG+A + IERT
Sbjct: 1   MGQKINPHGFRLGITTDWKSRWYAD-KQYADYVKEDVAIRRLLSTGLERAGIADVEIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG++GT+ ++IR  L  +T  ++ L++ EV  PE  A L+AQ +
Sbjct: 60  RDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTGKQVQLNILEVRNPESQAQLVAQGV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAM-RFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           A+QL  RV FRRAM++A+QSAM +    G++V  SGRL GAE+SR+E Y EGRVPL TLR
Sbjct: 120 AEQLSNRVAFRRAMRKAIQSAMRQPNVKGIRVQCSGRLGGAEMSRSEFYREGRVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDST 214
           A IDYG   A+T +G  G+KV++   D V      
Sbjct: 180 ADIDYGLYEAKTTFGRIGVKVWIYKGDIVGGKREL 214


>gi|152973962|ref|YP_001373479.1| 30S ribosomal protein S3 [Bacillus cereus subsp. cytotoxis NVH
           391-98]
 gi|189044950|sp|A7GK26|RS3_BACCN RecName: Full=30S ribosomal protein S3
 gi|152022714|gb|ABS20484.1| ribosomal protein S3 [Bacillus cytotoxicus NVH 391-98]
          Length = 219

 Score =  263 bits (673), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 103/220 (46%), Positives = 147/220 (66%), Gaps = 1/220 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP+  R+GV   W SRWFA   +Y  LLHED+KIREY+   LK + V+K+ IER 
Sbjct: 1   MGQKVNPVGLRVGVIRDWESRWFAE-KDYATLLHEDIKIREYITARLKDSSVSKVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                + +++A+PG++IGK GT++E +RK L+ +T   +H+++ EV K +++A L+A++I
Sbjct: 60  ANRVNVTIHTAKPGMVIGKGGTEVEALRKALNQLTGKRVHINILEVKKADLDAKLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE RV FRRA K+ +Q AMR GA G+K   SGRL GA+++R E Y EG VPL TLRA
Sbjct: 120 ARQLENRVSFRRAQKQVIQRAMRAGAKGIKTQVSGRLGGADIARAESYSEGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEH 220
            IDY TA A+T YG  G+KV++   + +            
Sbjct: 180 DIDYATAEADTTYGKLGVKVWIYRGEVLPSKKKASEEGGK 219


>gi|294142927|ref|YP_003558905.1| 30S ribosomal protein S3 [Shewanella violacea DSS12]
 gi|293329396|dbj|BAJ04127.1| ribosomal protein S3 [Shewanella violacea DSS12]
          Length = 229

 Score =  263 bits (672), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 110/226 (48%), Positives = 154/226 (68%), Gaps = 4/226 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   W S W+A  S+Y   L+ D ++R++L+  LKQA V+KI+IER 
Sbjct: 1   MGQKVHPNGIRLGITKPWISTWYADKSDYANNLNSDWEVRKFLEKKLKQASVSKIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  ++ +T     +++ E+ KPE++A L+A  I
Sbjct: 61  AKSVRVTIHTARPGVVIGKKGEDVEKLRNAVAKLTGIPAQINIAEIRKPELDAKLVADGI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQSAMR GA G+KV  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQSAMRLGAKGIKVQVSGRLGGAEIARYEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDE----VSDSDSTIPAAEHRV 222
            IDY TA + T YG  G+KV++   +     V   +      + + 
Sbjct: 181 DIDYSTAESHTQYGVIGVKVWIFKGEVLDGIVPAHEEPKQQPKRKP 226


>gi|145225619|ref|YP_001136297.1| 30S ribosomal protein S3 [Mycobacterium gilvum PYR-GCK]
 gi|315445972|ref|YP_004078851.1| 30S ribosomal protein S3P [Mycobacterium sp. Spyr1]
 gi|189045020|sp|A4TEB8|RS3_MYCGI RecName: Full=30S ribosomal protein S3
 gi|145218105|gb|ABP47509.1| SSU ribosomal protein S3P [Mycobacterium gilvum PYR-GCK]
 gi|315264275|gb|ADU01017.1| SSU ribosomal protein S3P [Mycobacterium sp. Spyr1]
          Length = 278

 Score =  263 bits (672), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 102/215 (47%), Positives = 144/215 (66%), Gaps = 2/215 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP  FRLG+   W SRW+A   +Y   + ED+ IR+ L   L++AG+A + IERT
Sbjct: 1   MGQKINPHGFRLGITTDWKSRWYAD-KQYADYIKEDVAIRKLLATGLERAGIADVEIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG++GT+ ++IR  L  +T  ++ L++ EV  PE  A L+AQ +
Sbjct: 60  RDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTKKQVQLNILEVKNPESRAQLVAQGV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAM-RFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           A+QL  RV FRRAM++A+QSAM +    G++V  SGRL GAE+SR+E Y EGRVPL TLR
Sbjct: 120 AEQLSNRVAFRRAMRKAIQSAMRQPNVKGIRVQCSGRLGGAEMSRSEFYREGRVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDST 214
           A IDYG   A+T +G  G+KV++   D V      
Sbjct: 180 ADIDYGLYEAKTTFGRIGVKVWIYKGDIVGGKREL 214


>gi|289669350|ref|ZP_06490425.1| 30S ribosomal protein S3 [Xanthomonas campestris pv. musacearum
           NCPPB4381]
          Length = 244

 Score =  263 bits (672), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 116/208 (55%), Positives = 155/208 (74%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K++P   RLG++  WNS+W+A   ++ A L  DLK+RE L+  L QAGV+KILIER 
Sbjct: 1   MGHKVHPTGIRLGISKDWNSKWYANKGDFAAYLAADLKVREMLRKKLAQAGVSKILIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K  R+ +++ARPG++IGK+G DIEK+RK++S +     H++V EV KPE++A L+A+SI
Sbjct: 61  AKTARVTIHTARPGVVIGKRGEDIEKLRKEVSELMGVPAHINVTEVRKPELDAQLVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERR++FRRAMKR+V +AMR GA G+KV  +GRLNGAE++R+E Y EGRVPL TLRA
Sbjct: 121 AQQLERRIMFRRAMKRSVGNAMRLGALGIKVNVAGRLNGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEV 208
            IDYG A A T YG  GIKV +   +  
Sbjct: 181 DIDYGFAEASTTYGIIGIKVLIYKGEVF 208


>gi|304438901|ref|ZP_07398824.1| 30S ribosomal protein S3 [Peptoniphilus duerdenii ATCC BAA-1640]
 gi|304372567|gb|EFM26150.1| 30S ribosomal protein S3 [Peptoniphilus duerdenii ATCC BAA-1640]
          Length = 252

 Score =  263 bits (672), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 96/224 (42%), Positives = 148/224 (66%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   R+G+   W+S+W+A   ++  LL ED KIREY++  L  AG+AK+ IER 
Sbjct: 1   MGQKVNPHGLRVGIIKDWDSKWYANKKDFSDLLIEDNKIREYIKTKLYAAGIAKVEIERA 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               ++ + + +PG++IG+ G  +E++R +L  +T   + ++V E+   +++A L+A+SI
Sbjct: 61  ANRVKVSISTGKPGMVIGRGGVGVEELRAELEKLTGKSVVVNVEEIKNLDMDAVLVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+ LERR+ FRRAMK+A+Q  MR GA G+K   SGRL GA+++RTE Y EG +PLQTLRA
Sbjct: 121 AEALERRISFRRAMKQAIQRTMRAGAKGIKTAVSGRLGGADMARTEGYSEGTIPLQTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVE 224
            IDYG A A+T YG  G+KV++   + +  + +  P       +
Sbjct: 181 DIDYGFAEADTTYGKLGVKVWLYKGEVLPQARNGQPRERDNRKK 224


>gi|220935486|ref|YP_002514385.1| ribosomal protein S3 [Thioalkalivibrio sp. HL-EbGR7]
 gi|219996796|gb|ACL73398.1| ribosomal protein S3 [Thioalkalivibrio sp. HL-EbGR7]
          Length = 228

 Score =  263 bits (672), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 114/226 (50%), Positives = 157/226 (69%), Gaps = 3/226 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P+ FRLGV+  WNS W+A G +Y  +L +DL+IRE+L+  L QA V++I I R 
Sbjct: 1   MGQKVHPVGFRLGVSSEWNSTWYADGRDYANVLAKDLEIREFLKERLSQASVSRIEIARP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTN---SEIHLSVNEVPKPEINATLIA 117
            +   I +++ARPG++IGKKG DIE +RK+ +       + + +++ E+ KPE++A L+A
Sbjct: 61  ARQAFITIHTARPGIVIGKKGEDIEALRKEAAAKLGLDVNSVKINIEEIRKPEVDAQLVA 120

Query: 118 QSIAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQT 177
           + IAQQLERR++FRRAMKRAV +AMR GA GVKV  +GRLNGAE++R+E Y EGRVPL T
Sbjct: 121 EGIAQQLERRIMFRRAMKRAVGNAMRLGALGVKVHVAGRLNGAEIARSEWYREGRVPLHT 180

Query: 178 LRAHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVV 223
           LRA IDYG A A T YG  G+KV+V   +       T    E +  
Sbjct: 181 LRADIDYGFAEARTTYGVIGVKVWVFKGEVFDFEQKTDGGQEGKAA 226


>gi|296268556|ref|YP_003651188.1| 30S ribosomal protein S3 [Thermobispora bispora DSM 43833]
 gi|296091343|gb|ADG87295.1| ribosomal protein S3 [Thermobispora bispora DSM 43833]
          Length = 278

 Score =  263 bits (672), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 96/207 (46%), Positives = 145/207 (70%), Gaps = 1/207 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P  FRLG+   + SRW+A    Y   + ED+ IR  LQ  +++AG++++ IERT
Sbjct: 1   MGQKVHPHGFRLGITTDFKSRWYAE-KLYKDYVAEDVAIRRMLQKGMERAGISRVEIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               ++ +++ARPG++IG++G + ++IR  L  +T  ++ L++ EV  PEI+A L+AQ +
Sbjct: 60  TDRVQVDIHTARPGIVIGRRGAEADRIRGDLEKLTGKQVQLNILEVKNPEIDAQLVAQGV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QL  RV FRRAM++A+Q+AM+ GA G+++  SGRL GAE+SR+E Y EGRVPL TLRA
Sbjct: 120 AEQLSSRVSFRRAMRKAMQTAMKSGAKGIRIQCSGRLGGAEMSRSEFYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDE 207
            IDYG   A T +G  G+KV++   D 
Sbjct: 180 DIDYGFYEARTTFGRIGVKVWIYKGDV 206


>gi|300690166|ref|YP_003751161.1| 30S ribosomal subunit protein S3 [Ralstonia solanacearum PSI07]
 gi|299077226|emb|CBJ49852.1| 30S ribosomal subunit protein S3 [Ralstonia solanacearum PSI07]
          Length = 264

 Score =  263 bits (672), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 115/225 (51%), Positives = 162/225 (72%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V+  W SRW+A  +++  +L ED+++RE+L+  LK A V +++IER 
Sbjct: 1   MGQKIHPTGFRLAVSRNWASRWYASNTQFAGMLKEDIEVREFLKKKLKNASVGRVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI +YS+RPG++IGKKG DIE ++ +L       +H+++ E+ KPE++A LIA SI
Sbjct: 61  AKNARITIYSSRPGVVIGKKGEDIELLKAELQRRMGVPVHVNIEEIRKPEVDAQLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLERR++FRRAMKRA+Q+AMR GA G+K+++SGRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 TQQLERRIMFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDYG + AET YG  G+KV+V   D +  +++ +         K
Sbjct: 181 DIDYGFSEAETTYGIIGVKVWVYKGDHLGRNEAPVVEEPQEERRK 225


>gi|326390655|ref|ZP_08212210.1| ribosomal protein S3 [Thermoanaerobacter ethanolicus JW 200]
 gi|325993333|gb|EGD51770.1| ribosomal protein S3 [Thermoanaerobacter ethanolicus JW 200]
          Length = 221

 Score =  263 bits (672), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 101/218 (46%), Positives = 151/218 (69%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   R+GV   W ++W+A   ++  LL ED+KIR Y++  L  AG+ KI+IER 
Sbjct: 1   MGQKVHPYGLRVGVTQDWLAKWYADDKDFSKLLIEDIKIRNYIKEKLYSAGIPKIVIERA 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               +I +++A+PG++IGK G  I+K+R++L  MTN  + L++ EV  PE++A L+A++I
Sbjct: 61  SNRIKIDIHAAKPGMVIGKGGAGIDKLREELEKMTNKTVILNIVEVKTPELSAQLVAENI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A Q+E+R+ +RRAMK+A+  AM+ GA G+K+  SGRL GAE++RTE Y EG VPLQTLRA
Sbjct: 121 AAQIEKRISYRRAMKQAIARAMKLGAKGIKIACSGRLAGAEIARTERYHEGVVPLQTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAA 218
            IDYG A A T YG  G+KV+++  + +      + A 
Sbjct: 181 DIDYGFAEANTTYGKIGVKVWINKGEILPQPKKQVTAE 218


>gi|254294434|ref|YP_003060457.1| ribosomal protein S3 [Hirschia baltica ATCC 49814]
 gi|254042965|gb|ACT59760.1| ribosomal protein S3 [Hirschia baltica ATCC 49814]
          Length = 253

 Score =  263 bits (672), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 127/239 (53%), Positives = 169/239 (70%), Gaps = 19/239 (7%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQC--------------- 45
           MGQK+NPI  RLGVN T +SRW+A   ++G LLHEDL++R+Y+Q                
Sbjct: 1   MGQKVNPIGLRLGVNRTADSRWYADSVDFGRLLHEDLRLRKYIQEWRPKDDNSGKRTGEV 60

Query: 46  HLKQAGVAKILIERTHKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNE 105
             ++AG++KI+IER HK CRI V+++RPG++IGKKG DIEK+RK LS     E+ +++ E
Sbjct: 61  LARRAGISKIIIERPHKKCRITVHTSRPGMVIGKKGADIEKLRKDLSKFVTDEVFVNLVE 120

Query: 106 VPKPEINATLIAQSIAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRT 165
           V KPEI+A L+A+ +A+QLERRV FRRAMKR +QSAMR GA+G+++  +GRL GAE++RT
Sbjct: 121 VRKPEIDAKLVAEDVARQLERRVSFRRAMKRTIQSAMRLGAEGIRLNVAGRLGGAEIART 180

Query: 166 ECYLEGRVPLQTLRAHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVE 224
           E Y EGRVPL TLRA IDYG A A T YG  GIKV++  + E+ + D   P A  R  E
Sbjct: 181 EWYREGRVPLHTLRADIDYGVAEAMTTYGIIGIKVWIF-KGEIMEHD---PMARDRKAE 235


>gi|153840303|ref|ZP_01992970.1| ribosomal protein S3 [Vibrio parahaemolyticus AQ3810]
 gi|149746038|gb|EDM57168.1| ribosomal protein S3 [Vibrio parahaemolyticus AQ3810]
          Length = 240

 Score =  263 bits (672), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 108/222 (48%), Positives = 152/222 (68%), Gaps = 1/222 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WN+ WFA   ++   L  D K+R++L   LK+A +++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNATWFANTKDFADNLDGDFKVRQFLTSELKKASLSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  ++ +      +++ EV KPE++A L+  SI
Sbjct: 61  AKSIRVTIHTARPGVVIGKKGEDVEKLRAAVAKIAGVPAQINIAEVRKPELDAQLVGDSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRV 222
            IDY T+ A T YG  GIK ++  + E+        A E + 
Sbjct: 181 DIDYATSSAHTQYGVIGIKTWIF-KGEILGGMPAANAVELKA 221


>gi|297545323|ref|YP_003677625.1| ribosomal protein S3 [Thermoanaerobacter mathranii subsp. mathranii
           str. A3]
 gi|296843098|gb|ADH61614.1| ribosomal protein S3 [Thermoanaerobacter mathranii subsp. mathranii
           str. A3]
          Length = 221

 Score =  263 bits (671), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 100/218 (45%), Positives = 150/218 (68%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   R+GV   W ++W+A    +   L ED+KIR Y++  L  AG++KI+IER 
Sbjct: 1   MGQKVHPYGLRVGVTQDWLAKWYADDKNFSKFLIEDIKIRNYIKEKLYAAGISKIVIERA 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               +I +++A+PG++IGK G  I+K+R++L  MTN  I L++ EV  PE++A L+A+++
Sbjct: 61  SNRIKIDIHAAKPGMVIGKGGAGIDKLREELEKMTNKTIILNIVEVKTPELSAQLVAENV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A Q+E+R+ +RRAMK+A+  AM+ GA G+K+  SGRL GAE++RTE Y EG VPLQTLRA
Sbjct: 121 AAQIEKRISYRRAMKQAIARAMKLGAKGIKIACSGRLAGAEIARTERYHEGVVPLQTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAA 218
            IDYG A A T YG  G+KV+++  + +      + A 
Sbjct: 181 DIDYGFAEANTTYGKIGVKVWINKGEILPQPKKQVTAE 218


>gi|227499189|ref|ZP_03929324.1| 30S ribosomal protein S3P [Acidaminococcus sp. D21]
 gi|226904636|gb|EEH90554.1| 30S ribosomal protein S3P [Acidaminococcus sp. D21]
          Length = 227

 Score =  263 bits (671), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 104/227 (45%), Positives = 159/227 (70%), Gaps = 1/227 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP  FR+GV   W+S+WFA   +Y   L ED+KIRE+++    QAG++++ IERT
Sbjct: 1   MGQKVNPHGFRVGVIDDWDSKWFAD-KDYQKYLLEDIKIREFIKDKQFQAGISRVAIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +  RI +Y+A+PG++IG++G++IE ++K L+ +T+S++ +++ EV  P+++ATL+A+++
Sbjct: 60  EQKMRISIYTAKPGIVIGRQGSNIELLKKDLAKLTDSKLDINIIEVKSPDMDATLVAENV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERR+ FRRAMK+ V   MR GA G+K+  SGRL GAE++RTE Y +G +PL TLRA
Sbjct: 120 AGQLERRIAFRRAMKQCVGRTMRLGAKGIKITCSGRLGGAEIARTESYRDGSIPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
           +IDYGTA A T YG  GIKV++   + +    +          E  +
Sbjct: 180 NIDYGTAEAHTTYGRIGIKVWIYKGEVLPTVKAAAKKEAPEGQEGGA 226


>gi|312795780|ref|YP_004028702.1| SSU ribosomal protein S3P [Burkholderia rhizoxinica HKI 454]
 gi|312167555|emb|CBW74558.1| SSU ribosomal protein S3P [Burkholderia rhizoxinica HKI 454]
          Length = 267

 Score =  263 bits (671), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 118/227 (51%), Positives = 166/227 (73%), Gaps = 2/227 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V+  W SRW+A  +++  +L ED+ +REYL+  LK A V++++IER 
Sbjct: 1   MGQKIHPTGFRLAVSRNWASRWYANNTQFAGMLKEDIGVREYLKKKLKNASVSRVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN R+ ++S+RPG++IGKKG DIE ++ +L       +H+++ EV KPE +A LIA SI
Sbjct: 61  AKNARLTIFSSRPGVVIGKKGEDIELLKTELQRRMGVPVHVNIEEVRKPETDAQLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLERR++FRRAMKRA+Q+AMR GA G+K++++GRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 TQQLERRIMFRRAMKRAMQNAMRLGAQGIKIMSAGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDY T+ A+T YG  G+KV+V   D +  +D  +P AE  V +K +
Sbjct: 181 DIDYATSEAKTTYGIIGVKVWVYKGDTLGRND--MPVAEEPVEDKRA 225


>gi|71891981|ref|YP_277711.1| 30S ribosomal protein S3 [Candidatus Blochmannia pennsylvanicus
           str. BPEN]
 gi|91207640|sp|Q493K2|RS3_BLOPB RecName: Full=30S ribosomal protein S3
 gi|71796087|gb|AAZ40838.1| 30S ribosomal subunit protein S3 [Candidatus Blochmannia
           pennsylvanicus str. BPEN]
          Length = 236

 Score =  263 bits (671), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 115/210 (54%), Positives = 151/210 (71%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+  TW+S W+A   ++   L  D K+R +L   L +A V++I+IER 
Sbjct: 1   MGQKVHPNGVRLGITKTWHSTWYANNKDFSDNLGNDFKVRHFLMQKLSKALVSRIIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ VY+ARPGLIIGKKG DIEK+RK ++ ++     L++ EV KPE++A L+A +I
Sbjct: 61  AKSIRVTVYTARPGLIIGKKGEDIEKLRKNIARISGVPTQLNIAEVRKPELDAKLLADNI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRVVFRRAMKR VQ+AMR GA G+KV  SGRL+GAE++RTE Y EGRVPL TLRA
Sbjct: 121 ASQLERRVVFRRAMKRVVQNAMRLGAKGIKVEVSGRLSGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD 210
            IDY  + A T YG  GIKV+V   + + D
Sbjct: 181 DIDYSLSEARTTYGIIGIKVWVFKGEILGD 210


>gi|94312242|ref|YP_585452.1| 30S ribosomal protein S3 [Cupriavidus metallidurans CH34]
 gi|123081148|sp|Q1LI43|RS3_RALME RecName: Full=30S ribosomal protein S3
 gi|93356094|gb|ABF10183.1| 30S ribosomal subunit protein S3 [Cupriavidus metallidurans CH34]
          Length = 265

 Score =  263 bits (671), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 114/221 (51%), Positives = 160/221 (72%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V+  W SRW+A  +++  +L ED+++RE+L+  LK A V +++IER 
Sbjct: 1   MGQKIHPTGFRLAVSRNWASRWYANNTKFAGMLKEDIEVREFLKKKLKNASVGRVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +N RI +YS+RPG++IGKKG DIE ++ +L       +H+++ E+ KPE +A LIA SI
Sbjct: 61  ARNARITIYSSRPGVVIGKKGEDIELLKAELQRRMGVPVHVNIEEIRKPETDAQLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLERR++FRRAMKRA+Q+AMR GA G+K+++SGRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 TQQLERRIMFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHR 221
            IDYG + AET YG  G+KV+V   D +  +D+ +      
Sbjct: 181 DIDYGFSEAETTYGIIGVKVWVYKGDHLGRNDAPVVEEPQE 221


>gi|307543831|ref|YP_003896310.1| 30S ribosomal protein S3 [Halomonas elongata DSM 2581]
 gi|307215855|emb|CBV41125.1| 30S ribosomal protein S3 [Halomonas elongata DSM 2581]
          Length = 232

 Score =  263 bits (671), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 111/220 (50%), Positives = 153/220 (69%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   RLG+     S W+A    Y   L+ DL++R +L+  LK A V+ I+IER 
Sbjct: 1   MGQKVNPTGIRLGIVKDHTSVWYAERGAYADKLNNDLEVRSFLEERLKNASVSNIIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
             N RI +++ARPG++IGKKG D++K+R+ LS M    +H+++ EV KPE++A L+AQ+I
Sbjct: 61  ANNARITIHTARPGIVIGKKGEDVDKLRRDLSQMMGVPVHVNIEEVRKPELDAKLVAQNI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKR+VQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AGQLERRVMFRRAMKRSVQNAMRLGAGGIKVQLSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEH 220
            ID+ T  A+T YG  G+KV++   + +   +     A+ 
Sbjct: 181 DIDFATYEAKTTYGIIGVKVWIFKGEILGGIEEVRAKAKQ 220


>gi|149192563|ref|ZP_01870730.1| 30S ribosomal protein S3 [Vibrio shilonii AK1]
 gi|148833604|gb|EDL50674.1| 30S ribosomal protein S3 [Vibrio shilonii AK1]
          Length = 232

 Score =  263 bits (671), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 109/224 (48%), Positives = 153/224 (68%), Gaps = 1/224 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WN+ WFA   E+   L  D K+R++L   L +A +++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNATWFANTKEFADNLDGDFKVRQFLTKELAKASLSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  ++ +      +++ EV KPE++  L+A SI
Sbjct: 61  AKSIRVTIHTARPGVVIGKKGEDVEKLRTAVAKIAGVPAQINIAEVRKPELDGQLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVE 224
            IDY T+ A T YG  GIKV++  + E+        A E +  +
Sbjct: 181 DIDYATSSAHTQYGVIGIKVWIF-KGEILGGMPAANAVEPKGDK 223


>gi|296333119|ref|ZP_06875573.1| 30S ribosomal protein S3 [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305672821|ref|YP_003864492.1| 30S ribosomal protein S3 [Bacillus subtilis subsp. spizizenii str.
           W23]
 gi|296149735|gb|EFG90630.1| 30S ribosomal protein S3 [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305411064|gb|ADM36182.1| 30S ribosomal protein S3 [Bacillus subtilis subsp. spizizenii str.
           W23]
          Length = 218

 Score =  263 bits (671), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 100/219 (45%), Positives = 149/219 (68%), Gaps = 1/219 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP+  R+GV   W S+W+A G +Y   LHEDLKIREY+   L  A V+K+ IER 
Sbjct: 1   MGQKVNPVGLRIGVIRDWESKWYA-GKDYADFLHEDLKIREYISKRLSDASVSKVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                I +++A+PG++IGK G+++E +RK L+++T   +H+++ E+ + +++A L+A +I
Sbjct: 60  ANRVNITIHTAKPGMVIGKGGSEVESLRKALNSLTGKRVHINILEIKRADLDAQLVADNI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE RV FRRA K+ +Q  MR GA GVK + SGRL GA+++R+E Y EG VPL TLRA
Sbjct: 120 ARQLENRVSFRRAQKQQIQRTMRAGAQGVKTMVSGRLGGADIARSEYYSEGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
            IDY T+ A+T YG  G+KV++   + +     T    +
Sbjct: 180 DIDYATSEADTTYGKLGVKVWIYRGEVLPTKKKTEEGGK 218


>gi|56480312|ref|NP_709102.2| 30S ribosomal protein S3 [Shigella flexneri 2a str. 301]
 gi|27734495|sp|P59184|RS3_SHIFL RecName: Full=30S ribosomal protein S3
 gi|56383863|gb|AAN44809.2| 30S ribosomal subunit protein S3 [Shigella flexneri 2a str. 301]
          Length = 233

 Score =  263 bits (671), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 112/230 (48%), Positives = 156/230 (67%), Gaps = 4/230 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++    RLG+   WNS WFA   E+   L  D K+R+YL   L +A V++I+IER 
Sbjct: 1   MGQKVHRNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLTKELAKASVSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+RK ++++      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQINIAEVRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
             QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 TSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD----SDSTIPAAEHRVVEKD 226
            IDY T+ A T YG  G+KV++   + +           PAA+ +  ++ 
Sbjct: 181 DIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEKPAAQPKKQQRK 230


>gi|312127232|ref|YP_003992106.1| 30S ribosomal protein S3 [Caldicellulosiruptor hydrothermalis 108]
 gi|312793933|ref|YP_004026856.1| 30S ribosomal protein S3 [Caldicellulosiruptor kristjanssonii
           177R1B]
 gi|312877371|ref|ZP_07737336.1| ribosomal protein S3 [Caldicellulosiruptor lactoaceticus 6A]
 gi|311777251|gb|ADQ06737.1| ribosomal protein S3 [Caldicellulosiruptor hydrothermalis 108]
 gi|311795845|gb|EFR12209.1| ribosomal protein S3 [Caldicellulosiruptor lactoaceticus 6A]
 gi|312181073|gb|ADQ41243.1| ribosomal protein S3 [Caldicellulosiruptor kristjanssonii 177R1B]
          Length = 222

 Score =  263 bits (671), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 99/222 (44%), Positives = 150/222 (67%), Gaps = 1/222 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P  FRLG+   W+SRWFA   ++   + ED KIR +++  L  AG+++I IER 
Sbjct: 1   MGQKVHPKGFRLGIIRDWDSRWFANDKDFQKYVLEDYKIRRHIKEKLYHAGISRIEIERA 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTN-SEIHLSVNEVPKPEINATLIAQS 119
            K  ++I+++A+PG++IG+ G+ +E +RK+L  +T    I L + E+  PE++A L+A++
Sbjct: 61  AKRVKVIIHTAKPGIVIGRAGSGVEALRKELEKLTGGKTISLDIKEIKVPELDAQLVAEN 120

Query: 120 IAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           IA QLE+RV FR+AMK+A+  A+R GA G+K + SGRL GA+++RTE Y EGR+PLQTLR
Sbjct: 121 IAAQLEKRVSFRKAMKQAMARALRSGAKGIKTMVSGRLGGADIARTEWYKEGRIPLQTLR 180

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHR 221
           A IDYG A A T YG  G+K ++   D +    +       +
Sbjct: 181 ADIDYGFAEAHTTYGRIGVKTWIYKGDILPQKAAASEKGGDK 222


>gi|51244982|ref|YP_064866.1| 30S ribosomal protein S3 [Desulfotalea psychrophila LSv54]
 gi|61215519|sp|Q6AP65|RS3_DESPS RecName: Full=30S ribosomal protein S3
 gi|50876019|emb|CAG35859.1| probable 30S ribosomal protein S3 [Desulfotalea psychrophila LSv54]
          Length = 217

 Score =  263 bits (671), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 104/213 (48%), Positives = 149/213 (69%), Gaps = 1/213 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP+  RL +  TW+S W+A   +Y   L ED KIR++L+  L  AG++ + IERT
Sbjct: 1   MGQKVNPLGIRLNITRTWDSVWYAD-KDYSTFLIEDQKIRKFLKKRLSHAGLSSVKIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +  RI +++ARPG++IGKKG +IE ++++L  + + ++ L + EV +PE +A L+A +I
Sbjct: 60  GEQVRIKLFTARPGIVIGKKGAEIEILKRELEKLVSRKVTLDIQEVRRPEADAQLVADNI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQL RRV FRRAMK+AV SA+RFG  G+K+  SGRL GAE+SR E   EGRVPL TLRA
Sbjct: 120 AQQLARRVAFRRAMKKAVSSALRFGVQGIKIACSGRLGGAEMSRCEWVREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDS 213
            +DY  + + T YG  G+KV++   + +SD D 
Sbjct: 180 DVDYALSESHTTYGIIGVKVWIFKGEVLSDKDK 212


>gi|146297279|ref|YP_001181050.1| ribosomal protein S3 [Caldicellulosiruptor saccharolyticus DSM
           8903]
 gi|189044962|sp|A4XLS4|RS3_CALS8 RecName: Full=30S ribosomal protein S3
 gi|145410855|gb|ABP67859.1| SSU ribosomal protein S3P [Caldicellulosiruptor saccharolyticus DSM
           8903]
          Length = 222

 Score =  263 bits (671), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 100/222 (45%), Positives = 150/222 (67%), Gaps = 1/222 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P  FRLG+   W+SRWFA   ++   L ED KIR +++  L  AG+++I IER 
Sbjct: 1   MGQKVHPKGFRLGIIKDWDSRWFANDKDFEKYLLEDYKIRRHIKEKLYNAGISRIEIERA 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTN-SEIHLSVNEVPKPEINATLIAQS 119
            K  ++I+++A+PG++IG+ G+ +E +RK+L  +T    I L + E+  PE++A L+A++
Sbjct: 61  AKRIKVIIHTAKPGIVIGRAGSGVEALRKELEKITGGKTISLDIKEIKVPELDAQLVAEN 120

Query: 120 IAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           IA QLE+RV FR+AMK+A+  A+R GA G+K + SGRL GA+++RTE Y EGR+PLQTLR
Sbjct: 121 IAAQLEKRVSFRKAMKQAMARALRSGAKGIKTMVSGRLGGADIARTEWYKEGRIPLQTLR 180

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHR 221
           A IDYG A A T YG  G+K ++   D +    +       +
Sbjct: 181 ADIDYGFAEAHTTYGRIGVKTWIYKGDVLPQKGAAAEKGGDK 222


>gi|323340380|ref|ZP_08080637.1| 30S ribosomal protein S3 [Lactobacillus ruminis ATCC 25644]
 gi|323092156|gb|EFZ34771.1| 30S ribosomal protein S3 [Lactobacillus ruminis ATCC 25644]
          Length = 218

 Score =  263 bits (671), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 99/219 (45%), Positives = 151/219 (68%), Gaps = 1/219 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP   R+G+   W+++W+A   ++ + LHEDL IR+Y++  L  A V+ + IER 
Sbjct: 1   MGQKINPTGLRVGIIRDWDAKWYAE-KDFASNLHEDLHIRKYIEKKLADASVSTVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K   + +++A+PG++IGK G+++EK+RK+L+N+T   +H+++ E+ KP+++A L+ +SI
Sbjct: 60  AKRVNVSIHTAKPGMVIGKGGSEVEKLRKELNNLTGKRVHINIVEIKKPDLDAKLVGESI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLE RV FRRAMK+A+Q  MR GA G+KV  +GRLNGA++SR E + EG VPL TLRA
Sbjct: 120 AQQLENRVAFRRAMKQAIQRTMRAGAQGIKVQVAGRLNGADMSRVERFSEGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
            IDY    A T YG  G+KV++   + + +        +
Sbjct: 180 DIDYAWVEARTTYGQLGVKVWIYRGEVLPEKKDNSKGGK 218


>gi|218667516|ref|YP_002424836.1| ribosomal protein S3 [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|218519729|gb|ACK80315.1| ribosomal protein S3 [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 228

 Score =  263 bits (671), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 111/221 (50%), Positives = 156/221 (70%), Gaps = 1/221 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK NPI  RLG+   WNSRW+   S++   L ED+K+R++++  L    V+ I+IER 
Sbjct: 9   MGQKTNPIGLRLGIIKNWNSRWY-GKSDFQEKLLEDIKVRQFIRERLAGGAVSDIIIERP 67

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            ++ RI V++ARPG++IGKKG DIEK+R  +       +H++V E+ KPE++A L+A+S+
Sbjct: 68  ARSARITVHTARPGIVIGKKGEDIEKLRHDVQKRMGVPVHINVEEIRKPELDAQLVAESV 127

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQL RR++FRRAMKRAV +AMRFGA G+++  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 128 AQQLVRRIMFRRAMKRAVTNAMRFGALGMRINCAGRLGGAEIARTEWYREGRVPLHTLRA 187

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHR 221
            IDYG A A T YG  G+KV++   + +  S +   AA  +
Sbjct: 188 DIDYGFAEANTTYGIIGVKVWIFKGEILEWSTAQTAAARQK 228


>gi|213158829|ref|YP_002320827.1| ribosomal protein S3 [Acinetobacter baumannii AB0057]
 gi|226697655|sp|B7IA33|RS3_ACIB5 RecName: Full=30S ribosomal protein S3
 gi|213057989|gb|ACJ42891.1| ribosomal protein S3 [Acinetobacter baumannii AB0057]
          Length = 250

 Score =  263 bits (671), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 111/226 (49%), Positives = 156/226 (69%), Gaps = 1/226 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI  RLGV    N+ W+A   +Y   L +DL++RE+L  +LK A V+ ILIER 
Sbjct: 1   MGQKVHPIGIRLGVVKRHNANWYANPKQYAEYLLKDLQVREFLTKNLKNAMVSNILIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               ++ + +ARPG++IGKKG DIEK++++L+N+      +S+NE+ +P+++A L+A++I
Sbjct: 61  SGAAKVTISTARPGIVIGKKGEDIEKLQRELTNIMGVPAQVSINEIDRPDLDARLVAEAI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLE+RV+FRRAMKRAVQ+ MR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 ASQLEKRVMFRRAMKRAVQNTMRAGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD-SDSTIPAAEHRVVEK 225
            IDY T  AET YG+ G+KV++   + +        PA       K
Sbjct: 181 DIDYATMRAETTYGTIGVKVWIFRGEILGGMKQVMNPAPAEERPAK 226


>gi|83748155|ref|ZP_00945182.1| SSU ribosomal protein S3P [Ralstonia solanacearum UW551]
 gi|207723101|ref|YP_002253506.1| 30s ribosomal protein s3 [Ralstonia solanacearum IPO1609]
 gi|83725123|gb|EAP72274.1| SSU ribosomal protein S3P [Ralstonia solanacearum UW551]
 gi|206588294|emb|CAQ18992.1| 30s ribosomal protein s3 [Ralstonia solanacearum IPO1609]
          Length = 264

 Score =  263 bits (671), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 116/225 (51%), Positives = 162/225 (72%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V+  W SRW+A  +++  +L ED+++RE+L+  LK A V +++IER 
Sbjct: 1   MGQKIHPTGFRLAVSRNWASRWYASNTQFAGMLKEDIEVREFLKKKLKNASVGRVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI +YS+RPG++IGKKG DIE ++ +L       +H+++ E+ KPE++A LIA SI
Sbjct: 61  AKNARITIYSSRPGVVIGKKGEDIELLKVELQRRMGVPVHVNIEEIRKPEVDAQLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLERR++FRRAMKRA+Q+AMR GA G+K+++SGRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 TQQLERRIMFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDYG + AET YG  G+KV+V   D +  +D+ +         K
Sbjct: 181 DIDYGFSEAETTYGIIGVKVWVYKGDHLGRNDAPVVEEPQEERRK 225


>gi|269217129|ref|ZP_06160983.1| ribosomal protein S3 [Slackia exigua ATCC 700122]
 gi|269129266|gb|EEZ60351.1| ribosomal protein S3 [Slackia exigua ATCC 700122]
          Length = 237

 Score =  263 bits (671), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 109/219 (49%), Positives = 150/219 (68%), Gaps = 1/219 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+ P  FRLG+   W SRW+A   +Y   L  DL IR +L+  L +A V+KI IER 
Sbjct: 1   MGQKVMPTGFRLGITEDWRSRWYAD-KDYAKTLENDLAIRRFLEKKLARAAVSKIEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               +IIV +ARPG++IGKKG +I+ +RK+++ +   ++++ V EV +PE++ATL+A+SI
Sbjct: 60  GDKTKIIVTTARPGVVIGKKGAEIDALRKEVAKVATGQVNIEVIEVKRPELDATLVARSI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE RV FRRAM++AVQSA + GA G+++  SGRL GAE+SR E Y EGRVPL TLRA
Sbjct: 120 AEQLEGRVAFRRAMRKAVQSARKSGALGIRIQCSGRLGGAEMSRREWYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
            IDYG   A T  GS G+KV++   + +       PA E
Sbjct: 180 KIDYGFTTASTTMGSIGVKVWIYHGEMLPGGKVPQPALE 218


>gi|73542857|ref|YP_297377.1| 30S ribosomal protein S3 [Ralstonia eutropha JMP134]
 gi|91207835|sp|Q46WF0|RS3_RALEJ RecName: Full=30S ribosomal protein S3
 gi|72120270|gb|AAZ62533.1| SSU ribosomal protein S3P [Ralstonia eutropha JMP134]
          Length = 264

 Score =  262 bits (670), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 113/220 (51%), Positives = 160/220 (72%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V+  W SRW+A  +++  +L ED+++R++L+  LK A V +++IER 
Sbjct: 1   MGQKIHPTGFRLAVSRNWASRWYANNTKFAGMLKEDIEVRDFLKKKLKNASVGRVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +N RI +YS+RPG++IGKKG DIE ++ +L       +H+++ E+ KPE +A LIA SI
Sbjct: 61  ARNARITIYSSRPGVVIGKKGEDIELLKAELQRRMGVPVHVNIEEIRKPETDAQLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLERR++FRRAMKRA+Q+AMR GA G+K+++SGRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 TQQLERRIMFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEH 220
            IDYG + AET YG  G+KV+V   D +  +D+ +     
Sbjct: 181 DIDYGFSEAETTYGIIGVKVWVYKGDHLGRNDAPVVEEPQ 220


>gi|307267008|ref|ZP_07548524.1| ribosomal protein S3 [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306917993|gb|EFN48251.1| ribosomal protein S3 [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 221

 Score =  262 bits (670), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 101/218 (46%), Positives = 151/218 (69%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   R+GV   W ++W+A   ++  LL ED+KIR Y++  L  AG+ KI+IER 
Sbjct: 1   MGQKVHPYGLRVGVTQDWLAKWYANDKDFSKLLIEDIKIRNYIKEKLYSAGIPKIVIERA 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               +I +++A+PG++IGK G  I+K+R++L  MTN  + L++ EV  PE++A L+A++I
Sbjct: 61  SNRIKIDIHAAKPGMVIGKGGAGIDKLREELEKMTNKTVILNIVEVKTPELSAQLVAENI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A Q+E+R+ +RRAMK+A+  AM+ GA G+K+  SGRL GAE++RTE Y EG VPLQTLRA
Sbjct: 121 AAQIEKRISYRRAMKQAIARAMKLGAKGIKIACSGRLAGAEIARTERYHEGVVPLQTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAA 218
            IDYG A A T YG  G+KV+++  + +      + A 
Sbjct: 181 DIDYGFAEANTTYGKIGVKVWINKGEILPQPKKQVTAE 218


>gi|89100343|ref|ZP_01173208.1| 30S ribosomal protein S3 [Bacillus sp. NRRL B-14911]
 gi|89084964|gb|EAR64100.1| 30S ribosomal protein S3 [Bacillus sp. NRRL B-14911]
          Length = 218

 Score =  262 bits (670), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 103/219 (47%), Positives = 152/219 (69%), Gaps = 1/219 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP+  R+GV   W S+WFA G +Y  LLHEDLK+REY+   L  A ++K+ IER 
Sbjct: 1   MGQKVNPVGLRIGVIRDWESKWFA-GKDYAELLHEDLKVREYITKRLSDASLSKVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                I +++A+PG++IGK G+++E +RK L+++T   +H+++ E+ K +I+A L+A++I
Sbjct: 60  ANRLNITIHTAKPGMVIGKGGSEVEALRKALNSLTGKRVHINILEIKKADIDAKLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE RV FRRA K+ +Q AMR GA G+K + SGRL GA+++R+E Y EG VPL TLRA
Sbjct: 120 ARQLENRVSFRRAQKQVIQRAMRAGAKGIKTMVSGRLGGADIARSESYSEGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
            IDY TA A+T YG  G+KV++   + +     T    +
Sbjct: 180 DIDYATAEADTTYGKLGVKVWIYRGEVLPTKKKTEEGGK 218


>gi|119947120|ref|YP_944800.1| ribosomal protein S3 [Psychromonas ingrahamii 37]
 gi|152060897|sp|A1T0D6|RS3_PSYIN RecName: Full=30S ribosomal protein S3
 gi|119865724|gb|ABM05201.1| SSU ribosomal protein S3P [Psychromonas ingrahamii 37]
          Length = 230

 Score =  262 bits (670), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 107/228 (46%), Positives = 153/228 (67%), Gaps = 4/228 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   ++S W+A   ++ A L  D +IR++L   LK A ++KI IER 
Sbjct: 1   MGQKVHPNGIRLGITKAFSSTWYAGKKDFAANLFSDFEIRKFLTEKLKNASLSKITIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  ++ M      ++++EV KPE++A L+A SI
Sbjct: 61  AKSVRVTIHTARPGVVIGKKGEDVEKLRTAIAKMAGVPAQINISEVRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           + QLERRV+FRRAMKRAVQ+AMR GA G+KV   GRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 SSQLERRVMFRRAMKRAVQNAMRLGAKGIKVQVGGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD----SDSTIPAAEHRVVE 224
            IDY T+ A T YG  G+KV++   + +       +   P+   R   
Sbjct: 181 DIDYSTSEAHTVYGIIGVKVWIFKGEVLGGLPLQVEEQQPSKPKRKSR 228


>gi|198282643|ref|YP_002218964.1| 30S ribosomal protein S3 [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|198247164|gb|ACH82757.1| ribosomal protein S3 [Acidithiobacillus ferrooxidans ATCC 53993]
          Length = 220

 Score =  262 bits (670), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 111/221 (50%), Positives = 156/221 (70%), Gaps = 1/221 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK NPI  RLG+   WNSRW+   S++   L ED+K+R++++  L    V+ I+IER 
Sbjct: 1   MGQKTNPIGLRLGIIKNWNSRWY-GKSDFQEKLLEDIKVRQFIRERLAGGAVSDIIIERP 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            ++ RI V++ARPG++IGKKG DIEK+R  +       +H++V E+ KPE++A L+A+S+
Sbjct: 60  ARSARITVHTARPGIVIGKKGEDIEKLRHDVQKRMGVPVHINVEEIRKPELDAQLVAESV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQL RR++FRRAMKRAV +AMRFGA G+++  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 120 AQQLVRRIMFRRAMKRAVTNAMRFGALGMRINCAGRLGGAEIARTEWYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHR 221
            IDYG A A T YG  G+KV++   + +  S +   AA  +
Sbjct: 180 DIDYGFAEANTTYGIIGVKVWIFKGEILEWSTAQTAAARQK 220


>gi|222529724|ref|YP_002573606.1| 30S ribosomal protein S3 [Caldicellulosiruptor bescii DSM 6725]
 gi|254764510|sp|B9MKH5|RS3_ANATD RecName: Full=30S ribosomal protein S3
 gi|222456571|gb|ACM60833.1| ribosomal protein S3 [Caldicellulosiruptor bescii DSM 6725]
          Length = 222

 Score =  262 bits (670), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 99/222 (44%), Positives = 150/222 (67%), Gaps = 1/222 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P  FRLG+   W+SRWFA   ++   + ED KIR +++  L  AG+++I IER 
Sbjct: 1   MGQKVHPKGFRLGIIRDWDSRWFANDKDFEKYVLEDYKIRRHIKEKLYNAGISRIEIERA 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTN-SEIHLSVNEVPKPEINATLIAQS 119
            K  ++I+++A+PG++IG+ G+ +E +RK+L  +T    I L + E+  PE++A L+A++
Sbjct: 61  AKRVKVIIHTAKPGIVIGRAGSGVEALRKELEKLTGGKTISLDIKEIKVPELDAQLVAEN 120

Query: 120 IAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           IA QLE+RV FR+AMK+A+  A+R GA G+K + SGRL GA+++RTE Y EGR+PLQTLR
Sbjct: 121 IAAQLEKRVSFRKAMKQAMARALRSGAKGIKTMVSGRLGGADIARTEWYKEGRIPLQTLR 180

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHR 221
           A IDYG A A T YG  G+K ++   D +    +       +
Sbjct: 181 ADIDYGFAEAHTTYGRIGVKTWIYKGDILPQKAAASEKGGDK 222


>gi|153867894|ref|ZP_01998088.1| 30S ribosomal protein S3 [Beggiatoa sp. SS]
 gi|152144786|gb|EDN71912.1| 30S ribosomal protein S3 [Beggiatoa sp. SS]
          Length = 218

 Score =  262 bits (670), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 108/209 (51%), Positives = 154/209 (73%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+ P  FRLG+   W+S+W+A   +Y   L+ DLK+ E+++  L QA ++++ IER 
Sbjct: 7   MGQKVPPTGFRLGIIKDWSSKWYASSKDYANYLNTDLKVPEFIKKKLAQASLSEVRIERP 66

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +N RII+++ARPG++IGKKG DI+K+R +++ M    +H+SV E+ KPE++A L+A S+
Sbjct: 67  ARNARIIIHTARPGIVIGKKGEDIDKLRTQVTEMMGIPVHISVEEIRKPEVDAHLVAVSV 126

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERR++FRRAMKR V +AMR GA G+++  SGRLNGAE++R E Y EGRVPL TLRA
Sbjct: 127 AQQLERRIMFRRAMKRVVGNAMRLGAQGIRINVSGRLNGAEIARKEWYREGRVPLHTLRA 186

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVS 209
            IDYG A A T YG  G+KV++   + + 
Sbjct: 187 DIDYGFAEAHTTYGVIGVKVWIFKGEIIG 215


>gi|95931437|ref|ZP_01314143.1| ribosomal protein S3 [Desulfuromonas acetoxidans DSM 684]
 gi|95132505|gb|EAT14198.1| ribosomal protein S3 [Desulfuromonas acetoxidans DSM 684]
          Length = 211

 Score =  262 bits (670), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 112/212 (52%), Positives = 157/212 (74%), Gaps = 1/212 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P+ FRLGV  TW S+W+A   +Y   +HEDLK+R YL+  L  AG++KI IER 
Sbjct: 1   MGQKVHPVGFRLGVIRTWESKWYAD-EDYARFVHEDLKLRNYLKKRLYHAGISKIEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               ++ +Y+ARPG+IIGK+G+++E ++++L+ +T+ EI L++ EV KPE+NA L+A+ +
Sbjct: 60  AGKMKLNIYAARPGIIIGKRGSEVEALKQELAKLTDKEIFLNIQEVRKPEMNAQLVAEGV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV FRRAMKR+V  ++RFGA G+K+  SGRL GAE+SRTE Y EGRVPL T+RA
Sbjct: 120 ALQLERRVAFRRAMKRSVGQSLRFGAQGIKITCSGRLGGAEMSRTEWYREGRVPLHTIRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSD 212
            IDYG A A+T YG  G+KV +   + +S   
Sbjct: 180 DIDYGFAEAKTTYGIIGVKVLIFKGEVLSREQ 211


>gi|312140912|ref|YP_004008248.1| 30S ribosomal protein s3 rpsc [Rhodococcus equi 103S]
 gi|325675450|ref|ZP_08155134.1| 30S ribosomal protein S3 [Rhodococcus equi ATCC 33707]
 gi|311890251|emb|CBH49569.1| 30S ribosomal protein S3 RpsC [Rhodococcus equi 103S]
 gi|325553421|gb|EGD23099.1| 30S ribosomal protein S3 [Rhodococcus equi ATCC 33707]
          Length = 265

 Score =  262 bits (670), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 102/220 (46%), Positives = 146/220 (66%), Gaps = 2/220 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP  FRLG+   W SRW+A   +Y   + ED+ IR+ L   +++AG+AK+ IERT
Sbjct: 1   MGQKINPHGFRLGITTDWKSRWYAD-KQYAEYVKEDVAIRKLLATGMERAGIAKVEIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG++G + ++IR +L  +T  ++ L++ EV   E  A L+AQ +
Sbjct: 60  RDRVRVDIHTARPGIVIGRRGAEADRIRAELEKLTGKQVQLNILEVKNAEAEAQLVAQGV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAM-RFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           A+QL  RV FRRAM++A+QSAM +    G++V  SGRL GAE+SR+E Y EGRVPL TLR
Sbjct: 120 AEQLSNRVAFRRAMRKAIQSAMRQPNVKGIRVQCSGRLGGAEMSRSEFYREGRVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
           A IDYG   A+T +G  G+KV++   D V        AA 
Sbjct: 180 ADIDYGLYEAKTTFGRIGVKVWIYKGDIVGGKRELSAAAP 219


>gi|238021596|ref|ZP_04602022.1| hypothetical protein GCWU000324_01496 [Kingella oralis ATCC 51147]
 gi|237866210|gb|EEP67252.1| hypothetical protein GCWU000324_01496 [Kingella oralis ATCC 51147]
          Length = 232

 Score =  262 bits (670), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 110/226 (48%), Positives = 160/226 (70%), Gaps = 2/226 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P+ FRL VN  W+S+WFA+ +++  +L +D+ +REYL   L  A V +I+IER 
Sbjct: 1   MGQKIHPVGFRLAVNKDWSSKWFAKSTDFATVLKQDIDVREYLSKRLANASVGRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ RI ++SARPG++IG+KG DIE +++ L  +    +H+++ E+ +PE++A +IA  I
Sbjct: 61  AKSARITIHSARPGVVIGQKGADIEILKQDLEKLLGVAVHVNIEEIRRPELDAQIIADGI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLE+RV FRRAMKRA+Q+AMR GA G+K++ SGRLNGA+++R+E Y EGRVPL TLRA
Sbjct: 121 AQQLEKRVQFRRAMKRAMQNAMRAGAKGIKIMTSGRLNGADIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            +DY T+ A T YG  G+KV+V   +         P  E+R   + 
Sbjct: 181 DVDYATSEALTTYGIIGLKVWVYKGE--MGQVQAQPERENRRSNRK 224


>gi|209693930|ref|YP_002261858.1| 30S ribosomal protein S3 [Aliivibrio salmonicida LFI1238]
 gi|226697660|sp|B6EPT1|RS3_ALISL RecName: Full=30S ribosomal protein S3
 gi|208007881|emb|CAQ78011.1| 30S ribosomal subunit protein S3 [Aliivibrio salmonicida LFI1238]
          Length = 232

 Score =  262 bits (670), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 112/224 (50%), Positives = 154/224 (68%), Gaps = 1/224 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WN+ WFA   E+   L  D K+R+YL   LK+A +++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNATWFASSQEFADNLDGDFKVRQYLTKELKKASLSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  ++ +      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGVVIGKKGEDVEKLRAGVAKIAGVPAQINIAEVRKPELDAHLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+KV   GRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQNAMRLGAQGIKVQVGGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVE 224
            IDY TA A T YG  G+KV++  + EV        A E +  +
Sbjct: 181 DIDYATASAHTQYGVIGVKVWIF-KGEVLGGMPAANAVEPKADK 223


>gi|163752600|ref|ZP_02159779.1| ribosomal protein S3 [Shewanella benthica KT99]
 gi|161327512|gb|EDP98719.1| ribosomal protein S3 [Shewanella benthica KT99]
          Length = 229

 Score =  262 bits (670), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 110/226 (48%), Positives = 153/226 (67%), Gaps = 4/226 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   W S W+A  S+Y   L+ D ++R+YL+  LKQA V+KI+IER 
Sbjct: 1   MGQKVHPNGIRLGITKPWISTWYADKSDYAKNLNSDWEVRKYLEKKLKQASVSKIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  ++ +T     +++ E+ KPE++A L+A  I
Sbjct: 61  AKSIRVTIHTARPGVVIGKKGEDVEKLRNAVAKLTGIPAQINIAEIRKPELDAKLVADGI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++R E Y EGRVPL T RA
Sbjct: 121 ASQLERRVMFRRAMKRAVQNAMRLGAKGIKVQVSGRLGGAEIARYEWYREGRVPLHTFRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRD----EVSDSDSTIPAAEHRV 222
            IDY TA + T YG  G+KV+V   +     V   +      + + 
Sbjct: 181 DIDYSTAESHTQYGVIGVKVWVFKGEVLDGVVPAHEEPKQQPKRKP 226


>gi|302871504|ref|YP_003840140.1| ribosomal protein S3 [Caldicellulosiruptor obsidiansis OB47]
 gi|302574363|gb|ADL42154.1| ribosomal protein S3 [Caldicellulosiruptor obsidiansis OB47]
          Length = 222

 Score =  262 bits (670), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 99/222 (44%), Positives = 150/222 (67%), Gaps = 1/222 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P  FRLG+   W+SRWFA   ++   + ED KIR +++  L  AG+++I IER 
Sbjct: 1   MGQKVHPKGFRLGIIRDWDSRWFANDKDFDKYVLEDYKIRRHIKEKLYNAGISRIEIERA 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTN-SEIHLSVNEVPKPEINATLIAQS 119
            K  ++I+++A+PG++IG+ G+ +E +RK+L  +T    I L + E+  PE++A L+A++
Sbjct: 61  AKRVKVIIHTAKPGIVIGRAGSGVEALRKELEKLTGGKTISLDIKEIKVPELDAQLVAEN 120

Query: 120 IAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           IA QLE+RV FR+AMK+A+  A+R GA G+K + SGRL GA+++RTE Y EGR+PLQTLR
Sbjct: 121 IAAQLEKRVSFRKAMKQAMARALRSGAKGIKTMVSGRLGGADIARTEWYKEGRIPLQTLR 180

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHR 221
           A IDYG A A T YG  G+K ++   D +    +       +
Sbjct: 181 ADIDYGFAEAHTTYGRIGVKTWIYKGDILPQKVAASEKGGDK 222


>gi|78044912|ref|YP_361112.1| 30S ribosomal protein S3 [Carboxydothermus hydrogenoformans Z-2901]
 gi|91207645|sp|Q3A9S2|RS3_CARHZ RecName: Full=30S ribosomal protein S3
 gi|77997027|gb|ABB15926.1| ribosomal protein S3 [Carboxydothermus hydrogenoformans Z-2901]
          Length = 222

 Score =  262 bits (669), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 102/219 (46%), Positives = 156/219 (71%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   R+G+   W+++WFA    Y  LLHEDLKIR+Y++    QAG+++I+IER 
Sbjct: 1   MGQKVHPKGLRIGIIKDWDAKWFADKKHYQELLHEDLKIRKYIKTKFYQAGISRIVIERA 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               ++ +++ARPG++IGK GT+IE +RK+L  MT  +I++++ E+  PEI+A L+A++I
Sbjct: 61  SNRVKVTIHTARPGMVIGKGGTEIEVLRKELEKMTGKQININIAEIKVPEIDAQLVAENI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A Q+E+R+ ++RAMK+AV  A++ GA G+KV  SGRL GAE++R+E Y EG+VPL TLRA
Sbjct: 121 AAQIEKRISYKRAMKQAVSRALKMGAQGIKVACSGRLAGAEIARSEWYSEGKVPLTTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
            IDYG A A T YG  G+KV++   + + +      + E
Sbjct: 181 DIDYGFAEALTTYGKIGVKVWIYKGEVLPEVKKESVSTE 219


>gi|167036807|ref|YP_001664385.1| 30S ribosomal protein S3 [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|167039526|ref|YP_001662511.1| 30S ribosomal protein S3 [Thermoanaerobacter sp. X514]
 gi|256752638|ref|ZP_05493490.1| ribosomal protein S3 [Thermoanaerobacter ethanolicus CCSD1]
 gi|300915223|ref|ZP_07132538.1| ribosomal protein S3 [Thermoanaerobacter sp. X561]
 gi|307725147|ref|YP_003904898.1| 30S ribosomal protein S3 [Thermoanaerobacter sp. X513]
 gi|320115229|ref|YP_004185388.1| 30S ribosomal protein S3 [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
 gi|166853766|gb|ABY92175.1| ribosomal protein S3 [Thermoanaerobacter sp. X514]
 gi|166855641|gb|ABY94049.1| ribosomal protein S3 [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|256748458|gb|EEU61510.1| ribosomal protein S3 [Thermoanaerobacter ethanolicus CCSD1]
 gi|300888947|gb|EFK84094.1| ribosomal protein S3 [Thermoanaerobacter sp. X561]
 gi|307582208|gb|ADN55607.1| ribosomal protein S3 [Thermoanaerobacter sp. X513]
 gi|319928320|gb|ADV79005.1| ribosomal protein S3 [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
          Length = 221

 Score =  262 bits (669), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 101/218 (46%), Positives = 151/218 (69%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   R+GV   W ++W+A   ++  LL ED+KIR Y++  L  AG+ KI+IER 
Sbjct: 1   MGQKVHPYGLRVGVTQDWLTKWYADDKDFSKLLIEDIKIRNYIKEKLYAAGIPKIVIERA 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               +I +++A+PG++IGK G  I+K+R++L  MTN  + L++ EV  PE++A L+A++I
Sbjct: 61  SNRIKIDIHAAKPGMVIGKGGAGIDKLREELEKMTNKTVILNIVEVKTPELSAQLVAENI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A Q+E+R+ +RRAMK+A+  AM+ GA G+K+  SGRL GAE++RTE Y EG VPLQTLRA
Sbjct: 121 AAQIEKRISYRRAMKQAIARAMKLGAKGIKIACSGRLAGAEIARTERYHEGVVPLQTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAA 218
            IDYG A A T YG  G+KV+++  + +      + A 
Sbjct: 181 DIDYGFAEANTTYGKIGVKVWINKGEILPQPKKQVTAE 218


>gi|167626800|ref|YP_001677300.1| 30S ribosomal protein S3 [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|241667381|ref|ZP_04754959.1| 30S ribosomal protein S3 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254875930|ref|ZP_05248640.1| 30S ribosomal protein S3 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|167596801|gb|ABZ86799.1| 30S ribosomal protein S3 [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|254841951|gb|EET20365.1| 30S ribosomal protein S3 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
          Length = 222

 Score =  262 bits (669), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 104/219 (47%), Positives = 154/219 (70%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   RLG+    NS W+A  S+Y   L+ED+K+RE+L   L  A V+KI IER 
Sbjct: 1   MGQKVNPNGIRLGIVKEHNSTWYADSSDYATKLNEDIKVREFLHKKLASAAVSKIQIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +N +I +++ARPG++IGKKG D+EK+R  ++ +    + +++ EV KPEI+A L+A S+
Sbjct: 61  AQNAKITIHTARPGIVIGKKGEDVEKLRADVNKLMGVPVQINIEEVRKPEIDAKLVADSV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLE+RV+FRRAMK+A+Q+AM+ GA G+K++ SGRL GAE++R+E   +GRVPLQT RA
Sbjct: 121 AQQLEKRVMFRRAMKKAMQAAMKSGAKGIKIMVSGRLGGAEIARSEWARDGRVPLQTFRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
            +DY T+ A T YG  G+KV++   + +    +     +
Sbjct: 181 DVDYATSKALTTYGIIGVKVWIYKGEVLPGQMNQKNNKK 219


>gi|54307547|ref|YP_128567.1| 30S ribosomal protein S3 [Photobacterium profundum SS9]
 gi|61215569|sp|Q6LVB0|RS3_PHOPR RecName: Full=30S ribosomal protein S3
 gi|46911967|emb|CAG18765.1| putative ribosomal protein S3 [Photobacterium profundum SS9]
          Length = 229

 Score =  262 bits (669), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 108/227 (47%), Positives = 155/227 (68%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WN+ WFA   E+   L  D K+R++L   LK+A +++++IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNTTWFANSQEFADNLDGDFKVRQFLIKELKKASLSRVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  +S +      ++++EV KPE++A L+  SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRAHISKIAGVPAQINISEVRKPELDAQLVGDSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+KV   GRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQNAMRLGAKGIKVQVGGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDY T+ A T YG  G+KV++   + +       P A+    ++ S
Sbjct: 181 DIDYATSSAHTQYGVIGVKVWIFKGEVLGGMPIEEPKADKPKKQRKS 227


>gi|311070769|ref|YP_003975692.1| 30S ribosomal protein S3 [Bacillus atrophaeus 1942]
 gi|310871286|gb|ADP34761.1| 30S ribosomal protein S3 [Bacillus atrophaeus 1942]
          Length = 218

 Score =  262 bits (669), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 99/219 (45%), Positives = 149/219 (68%), Gaps = 1/219 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP+  R+GV   W S+W+A G +Y   LHEDLKIREY+   L  A V+K+ IER 
Sbjct: 1   MGQKVNPVGLRIGVIRDWESKWYA-GKDYADFLHEDLKIREYISKRLSDASVSKVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                I +++A+PG++IGK G+++E +RK L+++T   +H+++ E+ + +++A L+A +I
Sbjct: 60  ANRVNITIHTAKPGMVIGKGGSEVEALRKALNSLTGKRVHINILEIKRADLDAQLVADNI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE R+ FRRA K+ +Q  MR GA GVK + SGRL GA+++R+E Y EG VPL TLRA
Sbjct: 120 ARQLENRISFRRAQKQQIQRTMRAGAQGVKTMVSGRLGGADIARSEYYSEGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
            IDY T+ A+T YG  G+KV++   + +     T    +
Sbjct: 180 DIDYATSEADTTYGKLGVKVWIYRGEVLPTKKKTEEGGK 218


>gi|317131375|ref|YP_004090689.1| ribosomal protein S3 [Ethanoligenens harbinense YUAN-3]
 gi|315469354|gb|ADU25958.1| ribosomal protein S3 [Ethanoligenens harbinense YUAN-3]
          Length = 221

 Score =  262 bits (669), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 98/210 (46%), Positives = 145/210 (69%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   R+GV   W+SRWFA+ + +G LL ED  +R YL+  L  AG+ +I IER 
Sbjct: 1   MGQKVNPHGLRVGVIKDWDSRWFAKDNVFGDLLVEDYNLRNYLKKKLFSAGIPRIEIERD 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               RI ++ A+PG++IGK G +I+K+R +L       + +++ EV  P++NA L+A++I
Sbjct: 61  ASRVRIHIHCAKPGMVIGKGGVEIDKLRTELEARLGKPVSINIVEVRSPDVNAQLVAENI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLE+R+ FRRAMK+++  AM+ GA G+KV  +GRL GAE++R E Y EG +PLQTLRA
Sbjct: 121 AAQLEKRISFRRAMKQSIGRAMKLGAKGIKVTVAGRLGGAEIARVEHYHEGTIPLQTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD 210
            IDYG + A+T YG  G+KV++   + + +
Sbjct: 181 DIDYGFSEAKTTYGRIGVKVWIYKGEVLPE 210


>gi|304315946|ref|YP_003851091.1| ribosomal protein S3 [Thermoanaerobacterium thermosaccharolyticum
           DSM 571]
 gi|302777448|gb|ADL68007.1| ribosomal protein S3 [Thermoanaerobacterium thermosaccharolyticum
           DSM 571]
          Length = 221

 Score =  262 bits (669), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 104/218 (47%), Positives = 156/218 (71%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP   R+GV+  W+++WFA+  ++  LL ED+KIR++++  +  +GV KI IER 
Sbjct: 1   MGQKINPRGLRVGVSQDWDAKWFAKDKDFSDLLIEDIKIRDFIKNKIYASGVPKIEIERA 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               +I VY+A+PG++IGK G  IE++R+++  MTN ++ +++ EV  PE++A L+A++I
Sbjct: 61  ANRIKIDVYTAKPGMVIGKGGAGIEELRQEIEKMTNKKVIINIVEVKNPELDAQLVAENI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERR+ FRRAMK+++  AM+ GA G+K+  SGRL GAE++RTE Y EG VPLQTLRA
Sbjct: 121 ASQLERRISFRRAMKQSISRAMKQGAKGIKIACSGRLAGAEIARTERYHEGVVPLQTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAA 218
           +IDYG A A T YG  G+KV+++  + +      + A 
Sbjct: 181 NIDYGFAEANTTYGKIGVKVWINKGEILPQPKKQVTAE 218


>gi|307694146|ref|ZP_07636383.1| ribosomal protein S3 [Ruminococcaceae bacterium D16]
          Length = 287

 Score =  262 bits (669), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 108/216 (50%), Positives = 146/216 (67%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   R+GV   W+SRW+A+    G LL ED KIR+YL+  L  AG+ KI IER 
Sbjct: 1   MGQKVNPHGLRVGVIKDWDSRWYAKNELVGDLLVEDKKIRDYLKKTLYSAGIPKIEIERD 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           +   RI ++ ARPG++IGK G +I+KI  KL  M    + L + EV   +++A L+A++I
Sbjct: 61  NAKVRIYLHCARPGVVIGKGGEEIKKIEAKLVKMIGKPVDLKIVEVKNADMDAQLVAENI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLE+R+ FRRAMK A+  AMR GA G+K   SGRL GAE++RTE Y +G +PLQTLRA
Sbjct: 121 AQQLEKRIGFRRAMKNAMGRAMRSGARGIKTCCSGRLGGAEIARTEHYHDGTIPLQTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIP 216
            IDYG A A T YG  G+KV++   + ++ +  T P
Sbjct: 181 DIDYGFAEAATTYGRIGVKVWIYKGEVLTQALRTTP 216


>gi|221307934|ref|ZP_03589781.1| 30S ribosomal protein S3 [Bacillus subtilis subsp. subtilis str.
           168]
 gi|221312255|ref|ZP_03594060.1| 30S ribosomal protein S3 [Bacillus subtilis subsp. subtilis str.
           NCIB 3610]
 gi|221317189|ref|ZP_03598483.1| 30S ribosomal protein S3 [Bacillus subtilis subsp. subtilis str.
           JH642]
 gi|221321452|ref|ZP_03602746.1| 30S ribosomal protein S3 [Bacillus subtilis subsp. subtilis str.
           SMY]
 gi|255767030|ref|NP_388003.2| 30S ribosomal protein S3 [Bacillus subtilis subsp. subtilis str.
           168]
 gi|321313793|ref|YP_004206080.1| 30S ribosomal protein S3 [Bacillus subtilis BSn5]
 gi|239938933|sp|P21465|RS3_BACSU RecName: Full=30S ribosomal protein S3; Short=BS3; AltName:
           Full=BS2
 gi|1165309|gb|AAC45962.1| S3 [Bacillus subtilis]
 gi|225184657|emb|CAB11898.2| ribosomal protein S3 (BS3) [Bacillus subtilis subsp. subtilis str.
           168]
 gi|320020067|gb|ADV95053.1| 30S ribosomal protein S3 [Bacillus subtilis BSn5]
          Length = 218

 Score =  262 bits (669), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 99/219 (45%), Positives = 148/219 (67%), Gaps = 1/219 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP+  R+GV   W S+W+A G +Y   LHEDLKIREY+   L  A V+K+ IER 
Sbjct: 1   MGQKVNPVGLRIGVIRDWESKWYA-GKDYADFLHEDLKIREYISKRLSDASVSKVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                I +++A+PG++IGK G+++E +RK L+++T   +H+++ E+ + +++A L+A +I
Sbjct: 60  ANRVNITIHTAKPGMVIGKGGSEVEALRKALNSLTGKRVHINILEIKRADLDAQLVADNI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE RV FRRA K+ +Q  MR GA GVK + SGRL GA+++R+E Y EG VPL TLRA
Sbjct: 120 ARQLENRVSFRRAQKQQIQRTMRAGAQGVKTMVSGRLGGADIARSEYYSEGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
            IDY T+ A+T YG  G+KV++   + +          +
Sbjct: 180 DIDYATSEADTTYGKLGVKVWIYRGEVLPTKKKNEEGGK 218


>gi|56961938|ref|YP_173660.1| 30S ribosomal protein S3 [Bacillus clausii KSM-K16]
 gi|61215396|sp|Q5WLQ6|RS3_BACSK RecName: Full=30S ribosomal protein S3
 gi|56908172|dbj|BAD62699.1| 30S ribosomal protein S3 [Bacillus clausii KSM-K16]
          Length = 220

 Score =  262 bits (669), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 99/211 (46%), Positives = 150/211 (71%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP+  R+GV   W+S+W+A   +Y  LLHED+ IRE+++  LK A V+K+ IER 
Sbjct: 1   MGQKVNPVGLRVGVIRDWDSKWYAGKKDYADLLHEDIAIREHVEGRLKDASVSKVEIERA 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                I + +A+PG++IGK G+++E +RK L+ +T   +H++++E+ + +++A L+A++I
Sbjct: 61  ANRVNITISTAKPGMVIGKGGSEVEALRKSLNELTGKRVHINISEIKQADLDAKLVAENI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE R+ FRRAMK+A+Q  MR GA G+K   SGRL GA+++R E Y EG VPL TLRA
Sbjct: 121 ARQLENRISFRRAMKQAIQRTMRAGAKGIKTQVSGRLGGADIARAEHYSEGTVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDS 211
            IDYGTA A+T YG  G+K++V   + +   
Sbjct: 181 DIDYGTAEADTTYGKIGVKIWVYRGEVLPTK 211


>gi|41410265|ref|NP_963101.1| 30S ribosomal protein S3 [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|61215641|sp|Q73SA8|RS3_MYCPA RecName: Full=30S ribosomal protein S3
 gi|41399099|gb|AAS06717.1| RpsC [Mycobacterium avium subsp. paratuberculosis K-10]
          Length = 280

 Score =  262 bits (669), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 101/215 (46%), Positives = 142/215 (66%), Gaps = 2/215 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP  FRLG+   W SRW+A   +Y   + ED+ IR  L   L++AG+A + IERT
Sbjct: 1   MGQKINPYGFRLGITTDWKSRWYAD-KQYADYVKEDVAIRRLLSTGLERAGIADVEIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG++GT+ ++IR  L  +T  ++ L++ EV  PE  A L+AQ +
Sbjct: 60  RDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTGKQVQLNILEVRNPESQAQLVAQGV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAM-RFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           A+QL  RV FRRAM++A+QSAM +    G++V  SGRL GAE+SR+E Y EGRVPL TLR
Sbjct: 120 AEQLSNRVAFRRAMRKAIQSAMRQPNVKGIRVQCSGRLGGAEMSRSEFYREGRVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDST 214
           A I YG   A+T +G  G+KV++   D V      
Sbjct: 180 ADIGYGLYEAKTTFGRIGVKVWIYKGDVVGGKREL 214


>gi|154684640|ref|YP_001419801.1| 30S ribosomal protein S3 [Bacillus amyloliquefaciens FZB42]
 gi|308172013|ref|YP_003918718.1| 30S ribosomal protein S3 (BS3) [Bacillus amyloliquefaciens DSM 7]
 gi|171854993|sp|A7Z0P4|RS3_BACA2 RecName: Full=30S ribosomal protein S3
 gi|154350491|gb|ABS72570.1| RpsC [Bacillus amyloliquefaciens FZB42]
 gi|307604877|emb|CBI41248.1| ribosomal protein S3 (BS3) [Bacillus amyloliquefaciens DSM 7]
 gi|328551823|gb|AEB22315.1| 30S ribosomal protein S3 [Bacillus amyloliquefaciens TA208]
 gi|328910082|gb|AEB61678.1| 30S ribosomal protein S3 [Bacillus amyloliquefaciens LL3]
          Length = 218

 Score =  261 bits (668), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 98/219 (44%), Positives = 149/219 (68%), Gaps = 1/219 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP+  R+GV   W S+W+A G +Y   LHEDLKIRE++   L  A V+K+ IER 
Sbjct: 1   MGQKVNPVGLRIGVIRDWESKWYA-GKDYADFLHEDLKIREFISKRLSDASVSKVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                I +++A+PG++IGK G+++E +RK L+++T   +H+++ E+ + +++A L+A +I
Sbjct: 60  ANRVNITIHTAKPGMVIGKGGSEVEALRKALNSLTGKRVHINILEIKRADLDAQLVADNI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE R+ FRRA K+ +Q  MR GA GVK + SGRL GA+++R+E Y EG VPL TLRA
Sbjct: 120 ARQLENRISFRRAQKQQIQRTMRAGAQGVKTMVSGRLGGADIARSEYYSEGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
            IDY T+ A+T YG  G+KV++   + +     T    +
Sbjct: 180 DIDYATSEADTTYGKLGVKVWIYRGEVLPTKKKTEEGGK 218


>gi|315122812|ref|YP_004063301.1| 30S ribosomal protein S3 [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313496214|gb|ADR52813.1| 30S ribosomal protein S3 [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 225

 Score =  261 bits (668), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 179/227 (78%), Positives = 201/227 (88%), Gaps = 2/227 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPILFRLGVNCTW+SRWFARGSEYG LLHEDLKIR+YL+ +LKQAGVAKILIERT
Sbjct: 1   MGQKINPILFRLGVNCTWSSRWFARGSEYGTLLHEDLKIRKYLEGNLKQAGVAKILIERT 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HK C I VYSARPGLIIGKKG+DI++IRK LS MT SEIHL+VNEV KPEINATLIAQSI
Sbjct: 61  HKKCFITVYSARPGLIIGKKGSDIDRIRKNLSKMTPSEIHLNVNEVSKPEINATLIAQSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRVVFRRAMKRAVQSAMRFGA+G+K+I SGRLNG ELSRTECYLEGRVPLQTLRA
Sbjct: 121 AQQLERRVVFRRAMKRAVQSAMRFGAEGIKIICSGRLNGLELSRTECYLEGRVPLQTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
           +IDYG+A+A+TAYG CG+KVYVS+R+          ++  R +EK +
Sbjct: 181 NIDYGSAIAKTAYGICGVKVYVSIREV--SDSDNATSSNRRPLEKSN 225


>gi|284049251|ref|YP_003399590.1| ribosomal protein S3 [Acidaminococcus fermentans DSM 20731]
 gi|283953472|gb|ADB48275.1| ribosomal protein S3 [Acidaminococcus fermentans DSM 20731]
          Length = 225

 Score =  261 bits (668), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 104/219 (47%), Positives = 159/219 (72%), Gaps = 1/219 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP  FR+GV   W+S+WFA   +Y   L ED+KIR++++    QAG++++ IERT
Sbjct: 1   MGQKVNPHGFRVGVIADWDSKWFAD-KDYQKNLLEDIKIRDFIKDKQFQAGISRVTIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +  RI +Y+A+PG++IG++G++IE ++K L+ MT+S++ +++ EV +P+++ATL+A+++
Sbjct: 60  EQKMRISIYTAKPGIVIGRQGSNIELLKKDLAKMTDSKLDINIIEVKQPDMDATLVAENV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERR+ FRRAMK+ V   MR GA G+K+  +GRL GAE++RTE Y +G +PL TLRA
Sbjct: 120 ASQLERRIAFRRAMKQCVGRTMRLGAKGIKIQCAGRLGGAEIARTESYRDGSIPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
           +IDYGTA A T YG  GIKV++   + +        A E
Sbjct: 180 NIDYGTAEAHTTYGRIGIKVWIYKGEVLPTKAVKKEAPE 218


>gi|169794600|ref|YP_001712393.1| 30S ribosomal protein S3 [Acinetobacter baumannii AYE]
 gi|184159592|ref|YP_001847931.1| 30S ribosomal protein S3 [Acinetobacter baumannii ACICU]
 gi|215482189|ref|YP_002324371.1| ribosomal protein S3 [Acinetobacter baumannii AB307-0294]
 gi|239503228|ref|ZP_04662538.1| 30S ribosomal protein S3 [Acinetobacter baumannii AB900]
 gi|260557033|ref|ZP_05829250.1| ribosomal protein S3 [Acinetobacter baumannii ATCC 19606]
 gi|294839741|ref|ZP_06784424.1| 30S ribosomal protein S3 [Acinetobacter sp. 6013113]
 gi|294842659|ref|ZP_06787342.1| 30S ribosomal protein S3 [Acinetobacter sp. 6014059]
 gi|294860419|ref|ZP_06798188.1| 30S ribosomal protein S3 [Acinetobacter sp. 6013150]
 gi|301345016|ref|ZP_07225757.1| 30S ribosomal protein S3 [Acinetobacter baumannii AB056]
 gi|301512053|ref|ZP_07237290.1| 30S ribosomal protein S3 [Acinetobacter baumannii AB058]
 gi|301595190|ref|ZP_07240198.1| 30S ribosomal protein S3 [Acinetobacter baumannii AB059]
 gi|152060837|sp|A3M978|RS3_ACIBT RecName: Full=30S ribosomal protein S3
 gi|226697654|sp|B7GW08|RS3_ACIB3 RecName: Full=30S ribosomal protein S3
 gi|226697656|sp|B2HZA2|RS3_ACIBC RecName: Full=30S ribosomal protein S3
 gi|226697658|sp|B0V6X4|RS3_ACIBY RecName: Full=30S ribosomal protein S3
 gi|169147527|emb|CAM85388.1| 30S ribosomal protein S3 [Acinetobacter baumannii AYE]
 gi|183211186|gb|ACC58584.1| 30S ribosomal subunit protein S3 [Acinetobacter baumannii ACICU]
 gi|193078474|gb|ABO13472.2| 30S ribosomal protein S3 [Acinetobacter baumannii ATCC 17978]
 gi|213987863|gb|ACJ58162.1| ribosomal protein S3 [Acinetobacter baumannii AB307-0294]
 gi|260409639|gb|EEX02940.1| ribosomal protein S3 [Acinetobacter baumannii ATCC 19606]
 gi|322509502|gb|ADX04956.1| 30S ribosomal protein S3 [Acinetobacter baumannii 1656-2]
 gi|323519522|gb|ADX93903.1| 30S ribosomal protein S3 [Acinetobacter baumannii TCDC-AB0715]
          Length = 250

 Score =  261 bits (668), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 111/226 (49%), Positives = 155/226 (68%), Gaps = 1/226 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI  RLGV    N+ W+A   +Y   L +DL++RE+L   LK A V+ ILIER 
Sbjct: 1   MGQKVHPIGIRLGVVKRHNANWYANPKQYAEYLLKDLQVREFLTKKLKNAMVSNILIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               ++ + +ARPG++IGKKG DIEK++++L+N+      +S+NE+ +P+++A L+A++I
Sbjct: 61  SGAAKVTISTARPGIVIGKKGEDIEKLQRELTNIMGVPAQVSINEIDRPDLDARLVAEAI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLE+RV+FRRAMKRAVQ+ MR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 ASQLEKRVMFRRAMKRAVQNTMRAGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD-SDSTIPAAEHRVVEK 225
            IDY T  AET YG+ G+KV++   + +        PA       K
Sbjct: 181 DIDYATMRAETTYGTIGVKVWIFRGEILGGMKQVMNPAPAEERPAK 226


>gi|84394584|ref|ZP_00993288.1| 30S ribosomal protein S3 [Vibrio splendidus 12B01]
 gi|86148903|ref|ZP_01067148.1| 30S ribosomal protein S3 [Vibrio sp. MED222]
 gi|218710743|ref|YP_002418364.1| 30S ribosomal protein S3 [Vibrio splendidus LGP32]
 gi|254764557|sp|B7VLF1|RS3_VIBSL RecName: Full=30S ribosomal protein S3
 gi|84374804|gb|EAP91747.1| 30S ribosomal protein S3 [Vibrio splendidus 12B01]
 gi|85833311|gb|EAQ51524.1| 30S ribosomal protein S3 [Vibrio sp. MED222]
 gi|218323762|emb|CAV20118.1| Ribosomal protein S3 [Vibrio splendidus LGP32]
          Length = 232

 Score =  261 bits (668), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 108/224 (48%), Positives = 154/224 (68%), Gaps = 1/224 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WN+ WFA  +E+   L  D K+R++L   L++A +++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNATWFANTNEFADNLDGDFKVRQFLTKELQKASLSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  ++ +      +++ EV KPE++  L+A SI
Sbjct: 61  AKSIRVTIHTARPGVVIGKKGEDVEKLRAAVAKIAGVPAQINIAEVRKPELDGQLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+KV   GRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQNAMRLGAKGIKVQVGGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVE 224
            IDY T+ A T YG  GIKV++  + E+        A E +  +
Sbjct: 181 DIDYATSSAHTQYGVIGIKVWIF-KGEILGGMPAANAVEPKGDK 223


>gi|120596995|ref|YP_961569.1| 30S ribosomal protein S3 [Shewanella sp. W3-18-1]
 gi|146294835|ref|YP_001185259.1| 30S ribosomal protein S3 [Shewanella putrefaciens CN-32]
 gi|152060906|sp|A1REC0|RS3_SHESW RecName: Full=30S ribosomal protein S3
 gi|189045337|sp|A4YBX7|RS3_SHEPC RecName: Full=30S ribosomal protein S3
 gi|120557088|gb|ABM23015.1| SSU ribosomal protein S3P [Shewanella sp. W3-18-1]
 gi|145566525|gb|ABP77460.1| SSU ribosomal protein S3P [Shewanella putrefaciens CN-32]
 gi|319424586|gb|ADV52660.1| ribosomal protein S3 [Shewanella putrefaciens 200]
          Length = 230

 Score =  261 bits (668), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 107/226 (47%), Positives = 155/226 (68%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   W S W+A  S+Y   L+ D ++R++L   L+ A V+KI+IER 
Sbjct: 1   MGQKVHPNGIRLGITKPWISTWYADKSDYANNLNSDWEVRKFLVEKLQAASVSKIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+E +R  +S +  +   +++ E+ KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGVVIGKKGEDVEVLRAAVSKLAGTPAQINIAEIRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVMFRRAMKRAVQNAMRIGAQGIKVQVSGRLGGAEIARDEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            IDY T+ + T YG  G+KV++   + +      I   + +  ++ 
Sbjct: 181 DIDYSTSESHTQYGVIGVKVWIFKGEVLDGMLPQIEEPKQQQPKRK 226


>gi|786159|dbj|BAA08837.1| ribosomal protein S3 [Bacillus subtilis]
          Length = 218

 Score =  261 bits (668), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 99/219 (45%), Positives = 147/219 (67%), Gaps = 1/219 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP+  R+GV   W S+W+A G +Y   LHEDLKIREY+   L  A V+K+ IER 
Sbjct: 1   MGQKVNPVGLRIGVIRDWESKWYA-GKDYADFLHEDLKIREYISKRLSDASVSKVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                I +++A+PG++IGK G+++E +RK L+++T   +H+++ E+ + +++A L+A +I
Sbjct: 60  ANRVNITIHTAKPGMVIGKGGSEVEALRKALNSLTGKRVHINILEIKRADLDAQLVADNI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE RV FRRA K+ +Q  MR GA GVK + SGRL GA+++R E Y EG VPL TLRA
Sbjct: 120 ARQLENRVSFRRAQKQQIQRTMRAGAQGVKTMVSGRLGGADIARPEYYSEGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
            IDY T+ A+T YG  G+KV++   + +          +
Sbjct: 180 DIDYATSEADTTYGKLGVKVWIYRGEVLPTKKKNEEGGK 218


>gi|254502211|ref|ZP_05114362.1| ribosomal protein S3 [Labrenzia alexandrii DFL-11]
 gi|222438282|gb|EEE44961.1| ribosomal protein S3 [Labrenzia alexandrii DFL-11]
          Length = 233

 Score =  261 bits (668), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 129/218 (59%), Positives = 165/218 (75%), Gaps = 1/218 (0%)

Query: 10  FRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERTHKNCRIIVY 69
            RLG+N TW+SRW+A  +EYG LLHED +IREYL   LKQA V+K++IER HK CR+ ++
Sbjct: 1   MRLGINRTWDSRWYANKNEYGDLLHEDFRIREYLMKELKQAAVSKVVIERPHKKCRVSIH 60

Query: 70  SARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSIAQQLERRVV 129
           S RPG++IGKKG DIE++RKK++ +TNSE+HL++ EV KPEI+ATL+A SIAQQLERRV 
Sbjct: 61  SGRPGVVIGKKGADIERLRKKIAEITNSEVHLNIVEVRKPEIDATLVAASIAQQLERRVA 120

Query: 130 FRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRAHIDYGTAVA 189
           FRRAMKRAVQSAMR GA G+++   GRL GAE++R E Y EGRVPL TLRA IDYG A A
Sbjct: 121 FRRAMKRAVQSAMRLGAQGIRINCGGRLGGAEIARIEWYREGRVPLHTLRADIDYGVASA 180

Query: 190 ETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            TAYG CG+KV++  + E+ + D            + +
Sbjct: 181 HTAYGVCGVKVWIF-KGEILEHDPMASERRATAASEGN 217


>gi|152989978|ref|YP_001355700.1| 30S ribosomal protein S3 [Nitratiruptor sp. SB155-2]
 gi|189045023|sp|A6Q1I4|RS3_NITSB RecName: Full=30S ribosomal protein S3
 gi|151421839|dbj|BAF69343.1| 30S ribosomal protein S3 [Nitratiruptor sp. SB155-2]
          Length = 229

 Score =  261 bits (668), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 107/218 (49%), Positives = 149/218 (68%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI  RLG+N  W SRWF   ++    + ED KIR++L+  L  AG++ I+IERT
Sbjct: 1   MGQKVNPIGLRLGINRNWESRWFPDFNKMPERVEEDNKIRKFLKKELYYAGISNIIIERT 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K  R+ + +ARPG+IIGKKG DIEK+++KL  +   E+ +++ E  +P+ +A L A+++
Sbjct: 61  AKKLRVTIVAARPGIIIGKKGADIEKLKQKLQKLVGKEVFINIKEEKRPQASAQLAAENV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV FRRAMK+ +Q+A + G  G+KV  +GRL GAE++RTE YLEGRVPL TLRA
Sbjct: 121 ATQLERRVAFRRAMKKVIQAAQKAGVKGIKVQVAGRLGGAEMARTEWYLEGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAA 218
            IDYG A A T YG  G+KV++   + +       P  
Sbjct: 181 KIDYGFAEAHTTYGVIGVKVWIFKGEVLQKGIRPEPTE 218


>gi|291542041|emb|CBL15151.1| SSU ribosomal protein S3P [Ruminococcus bromii L2-63]
          Length = 223

 Score =  261 bits (668), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 106/219 (48%), Positives = 152/219 (69%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   R+GV   W+SRWFA   ++GA L ED  +R+ L+  L   G++KI IER 
Sbjct: 1   MGQKVNPHGLRVGVIKDWDSRWFANKKDFGATLVEDYNLRKTLKAQLYNFGISKIEIERD 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K  +I ++ A+PGL+IGK G++IEK+R +   M    + +++ EV  PE++A L+A+SI
Sbjct: 61  GKKVKISIHCAKPGLVIGKGGSEIEKLRAQCEKMLGKPVAINIVEVKAPELDAQLVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLE+R+ FRRAMK ++ +AMR GA G+K++ SGRL GAE++R+E Y EG +PLQTLRA
Sbjct: 121 AQQLEKRISFRRAMKMSIGNAMRRGAKGIKIMCSGRLGGAEIARSEQYHEGTIPLQTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
            IDYG A A T YG  G+KV++   + +++  S  P  E
Sbjct: 181 DIDYGFAEANTTYGKVGVKVWLYKGEVLNEVKSRKPRRE 219


>gi|90414962|ref|ZP_01222924.1| 30S ribosomal protein S3 [Photobacterium profundum 3TCK]
 gi|90323901|gb|EAS40501.1| 30S ribosomal protein S3 [Photobacterium profundum 3TCK]
          Length = 229

 Score =  261 bits (668), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 109/227 (48%), Positives = 155/227 (68%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WN+ WFA   E+   L  D K+R++L   LK+A +++++IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNTTWFANSQEFADNLDGDFKVRQFLIKELKKASLSRVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  +S +      ++++EV KPE++A L+  SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRAHISKIAGVPAQINISEVRKPELDAQLVGDSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+KV   GRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQNAMRLGAKGIKVQVGGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDY T+ A T YG  GIKV++   + +       P A+    ++ S
Sbjct: 181 DIDYATSSAHTQYGVIGIKVWIFKGEVLGGMPIEEPKADKPKKQRKS 227


>gi|296282588|ref|ZP_06860586.1| 30S ribosomal protein S3 [Citromicrobium bathyomarinum JL354]
          Length = 231

 Score =  261 bits (668), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 125/225 (55%), Positives = 165/225 (73%), Gaps = 4/225 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK NPI  RL +N TW+SRW+A G +Y  LL ED++IR+++   L QA ++K++IER 
Sbjct: 1   MGQKSNPIGLRLQINRTWDSRWYAEGRDYAKLLKEDIEIRKHIVNSLPQAAISKVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K CRI +Y+ARPG+IIGKKG DIEK+R  LS MT SE+ L++ E+ KPEI+A L+AQ I
Sbjct: 61  AKLCRISIYAARPGVIIGKKGADIEKLRTTLSRMTESEVKLNIVEIRKPEIDAKLVAQGI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QL RRV FRRAMKRAVQSA+R GA+G+++   GRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 ADQLVRRVAFRRAMKRAVQSALRLGAEGIRITCGGRLGGAEIARVEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
           ++DY  A A TAYG  GIK ++  + E+   D   P A+ R++ +
Sbjct: 181 NVDYAEAEALTAYGIIGIKCWIF-KGEILAHD---PTAQDRLMME 221


>gi|269798544|ref|YP_003312444.1| ribosomal protein S3 [Veillonella parvula DSM 2008]
 gi|282849870|ref|ZP_06259253.1| ribosomal protein S3 [Veillonella parvula ATCC 17745]
 gi|294792800|ref|ZP_06757947.1| ribosomal protein S3 [Veillonella sp. 6_1_27]
 gi|294794554|ref|ZP_06759690.1| ribosomal protein S3 [Veillonella sp. 3_1_44]
 gi|269095173|gb|ACZ25164.1| ribosomal protein S3 [Veillonella parvula DSM 2008]
 gi|282580307|gb|EFB85707.1| ribosomal protein S3 [Veillonella parvula ATCC 17745]
 gi|294454884|gb|EFG23257.1| ribosomal protein S3 [Veillonella sp. 3_1_44]
 gi|294456699|gb|EFG25062.1| ribosomal protein S3 [Veillonella sp. 6_1_27]
          Length = 222

 Score =  261 bits (668), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 99/220 (45%), Positives = 156/220 (70%), Gaps = 1/220 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   R+G+   W+++W+A   ++ A LHED+KIR +L+  L  AG+++I IERT
Sbjct: 1   MGQKVNPHGLRVGIVKDWDAKWYAD-KDFAANLHEDVKIRNFLKETLFIAGISRIEIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           +K  ++ +++A+PG++IG+ G  IE I+K ++  T+ ++ +++ E+ + +++ATL+A++I
Sbjct: 60  NKRIKLTIHTAKPGMVIGRGGAGIEDIKKAMTRFTDKQVDVNIAEIKQADMDATLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERR+ FRRAMK+AV   MR GA G+K++ SGRL GAE++R+E Y EG +PL TLRA
Sbjct: 120 AGQLERRIGFRRAMKQAVGRTMRLGAKGIKIMVSGRLGGAEIARSESYREGSIPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEH 220
            IDYGTA A T YG  GIKV++   + + ++       E 
Sbjct: 180 DIDYGTAEAHTTYGCIGIKVWIYKGEVLPEAKQAPAKKEE 219


>gi|24371835|ref|NP_715877.1| 30S ribosomal protein S3 [Shewanella oneidensis MR-1]
 gi|113968550|ref|YP_732343.1| 30S ribosomal protein S3 [Shewanella sp. MR-4]
 gi|114045713|ref|YP_736263.1| 30S ribosomal protein S3 [Shewanella sp. MR-7]
 gi|117918663|ref|YP_867855.1| 30S ribosomal protein S3 [Shewanella sp. ANA-3]
 gi|27734494|sp|P59183|RS3_SHEON RecName: Full=30S ribosomal protein S3
 gi|123130850|sp|Q0HNT1|RS3_SHESM RecName: Full=30S ribosomal protein S3
 gi|123326998|sp|Q0I099|RS3_SHESR RecName: Full=30S ribosomal protein S3
 gi|152060905|sp|A0KRN0|RS3_SHESA RecName: Full=30S ribosomal protein S3
 gi|24345648|gb|AAN53322.1|AE015473_9 ribosomal protein S3 [Shewanella oneidensis MR-1]
 gi|113883234|gb|ABI37286.1| SSU ribosomal protein S3P [Shewanella sp. MR-4]
 gi|113887155|gb|ABI41206.1| SSU ribosomal protein S3P [Shewanella sp. MR-7]
 gi|117610995|gb|ABK46449.1| SSU ribosomal protein S3P [Shewanella sp. ANA-3]
          Length = 230

 Score =  261 bits (668), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 109/226 (48%), Positives = 156/226 (69%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   W S W+A  S+Y   L+ D ++R+YL   L+ A V+KI+IER 
Sbjct: 1   MGQKVHPNGIRLGITKPWISTWYADKSDYANNLNSDWEVRKYLADKLQAASVSKIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+E +R  +S +  +   +++ E+ KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGVVIGKKGEDVEVLRAAVSKLAGTPAQINIAEIRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVMFRRAMKRAVQNAMRIGAQGIKVEVSGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            IDY T+ + T YG  GIKV++   + +      I   + +  ++ 
Sbjct: 181 DIDYSTSESHTQYGVIGIKVWIFKGEVLDGMLPQIEEPKQQQPKRK 226


>gi|126176349|ref|YP_001052498.1| 30S ribosomal protein S3 [Shewanella baltica OS155]
 gi|152998755|ref|YP_001364436.1| 30S ribosomal protein S3 [Shewanella baltica OS185]
 gi|160873332|ref|YP_001552648.1| 30S ribosomal protein S3 [Shewanella baltica OS195]
 gi|217975195|ref|YP_002359946.1| 30S ribosomal protein S3 [Shewanella baltica OS223]
 gi|304412771|ref|ZP_07394373.1| ribosomal protein S3 [Shewanella baltica OS183]
 gi|307307435|ref|ZP_07587170.1| ribosomal protein S3 [Shewanella baltica BA175]
 gi|189045334|sp|A3DA66|RS3_SHEB5 RecName: Full=30S ribosomal protein S3
 gi|189045335|sp|A6WHT4|RS3_SHEB8 RecName: Full=30S ribosomal protein S3
 gi|189045336|sp|A9KWA8|RS3_SHEB9 RecName: Full=30S ribosomal protein S3
 gi|254764545|sp|B8EBJ9|RS3_SHEB2 RecName: Full=30S ribosomal protein S3
 gi|125999554|gb|ABN63629.1| SSU ribosomal protein S3P [Shewanella baltica OS155]
 gi|151363373|gb|ABS06373.1| ribosomal protein S3 [Shewanella baltica OS185]
 gi|160858854|gb|ABX47388.1| ribosomal protein S3 [Shewanella baltica OS195]
 gi|217500330|gb|ACK48523.1| ribosomal protein S3 [Shewanella baltica OS223]
 gi|304348851|gb|EFM13267.1| ribosomal protein S3 [Shewanella baltica OS183]
 gi|306910223|gb|EFN40656.1| ribosomal protein S3 [Shewanella baltica BA175]
 gi|315265559|gb|ADT92412.1| ribosomal protein S3 [Shewanella baltica OS678]
          Length = 230

 Score =  261 bits (668), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 107/226 (47%), Positives = 156/226 (69%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   W S W+A  S+Y + L+ D ++R++L   L+ A V+KI+IER 
Sbjct: 1   MGQKVHPNGIRLGITKPWISTWYADKSDYASNLNSDWEVRKFLVEKLQAASVSKIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+E +R  +S +  +   +++ E+ KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGVVIGKKGEDVEVLRAAVSKLAGTPAQINIAEIRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVMFRRAMKRAVQNAMRIGAQGIKVQVSGRLGGAEIARDEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            IDY T+ + T YG  G+KV++   + +      I   + +  ++ 
Sbjct: 181 DIDYSTSESHTQYGVIGVKVWIFKGEVLDGMLPQIEEPKQQQPKRK 226


>gi|91791545|ref|YP_561196.1| 30S ribosomal protein S3 [Shewanella denitrificans OS217]
 gi|123166585|sp|Q12SV3|RS3_SHEDO RecName: Full=30S ribosomal protein S3
 gi|91713547|gb|ABE53473.1| SSU ribosomal protein S3P [Shewanella denitrificans OS217]
          Length = 229

 Score =  261 bits (668), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 110/225 (48%), Positives = 157/225 (69%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   W S W+A  S+Y   L+ D ++R+YL   LK A V+KI+IER 
Sbjct: 1   MGQKVHPNGIRLGITKPWISTWYADKSDYANNLNSDWEVRQYLTEKLKAASVSKIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+E +R +++ +T +   +++ E+ KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGVVIGKKGEDVEVLRAQVAKITGTTAQINIAEIRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVMFRRAMKRAVQNAMRIGAQGIKVEVSGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDY T+ + T YG  G+KV++   + +      I   + +   K
Sbjct: 181 DIDYSTSESHTQYGVIGVKVWIFKGEVLDGLVPQIEEPKQQPKRK 225


>gi|268680581|ref|YP_003305012.1| ribosomal protein S3 [Sulfurospirillum deleyianum DSM 6946]
 gi|268618612|gb|ACZ12977.1| ribosomal protein S3 [Sulfurospirillum deleyianum DSM 6946]
          Length = 237

 Score =  261 bits (667), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 113/227 (49%), Positives = 156/227 (68%), Gaps = 3/227 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI  RLG+N  W+SRWF         + ED KIR +L+  L  AGV++ILIERT
Sbjct: 1   MGQKVNPIGLRLGINRNWDSRWFPGKQTLATSIGEDYKIRTFLKKELYYAGVSQILIERT 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K  R+ V +ARPG+IIGKKG+DIEK+R KLS + N ++++++ E  +P+ +A L A+++
Sbjct: 61  AKKLRVTVVAARPGIIIGKKGSDIEKLRLKLSKLINKDVNVNIKEERRPQSSAQLCAENV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV FRRAMK+ +Q A + GA G+K+  +GRL GAE++RTE YLEGRVPL TLRA
Sbjct: 121 AMQLERRVAFRRAMKKVIQGAQKSGAKGIKISVAGRLGGAEMARTEWYLEGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
            IDYG A A T YG  G+KV++   + +      +   +    EK++
Sbjct: 181 KIDYGFAEAHTTYGVIGVKVWIFKGEVLV---KGLAPEKEEASEKEN 224


>gi|114561342|ref|YP_748855.1| 30S ribosomal protein S3 [Shewanella frigidimarina NCIMB 400]
 gi|122301110|sp|Q089P8|RS3_SHEFN RecName: Full=30S ribosomal protein S3
 gi|114332635|gb|ABI70017.1| SSU ribosomal protein S3P [Shewanella frigidimarina NCIMB 400]
          Length = 229

 Score =  261 bits (667), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 113/225 (50%), Positives = 155/225 (68%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   W S W+A  S+Y   L+ D ++R+YL   LK A V+KI+IER 
Sbjct: 1   MGQKVHPNGIRLGITKPWISTWYADKSDYANNLNSDWEVRQYLTEKLKAASVSKIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+E +R  +S +T +   +++ E+ KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEVLRAYVSKITGTTAQINIAEIRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 AQQLERRVMFRRAMKRAVQNAMRIGAQGIKVQVSGRLGGAEIARAEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDY TA + T YG  GIKV++   + +      I   + +   K
Sbjct: 181 DIDYSTAESHTQYGVIGIKVWIFKGEVLDGLVPAIEEPKQQPKRK 225


>gi|268609587|ref|ZP_06143314.1| SSU ribosomal protein S3P [Ruminococcus flavefaciens FD-1]
          Length = 261

 Score =  261 bits (667), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 98/225 (43%), Positives = 148/225 (65%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   R+GV   W+SRW+A  +++G  L ED  +R +++  L  AGV +I IER 
Sbjct: 1   MGQKVNPHGLRVGVIKDWDSRWYANKADFGDTLVEDYNVRNFIKKSLYAAGVPRIEIERF 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               RI ++ A+PG++IG+ G +IEK+R +L  M   ++ +++ EV +P++++ L+A+ I
Sbjct: 61  ADKVRIHIHCAKPGIVIGRGGAEIEKLRVQLEKMMKKQVFINIIEVKQPDMDSQLVAEKI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A  LE RV FRRAMK+++   MR GA G+KV  SGRL GAE++R+E Y EG +PLQT+RA
Sbjct: 121 ALDLENRVSFRRAMKQSIGRTMRLGAKGIKVKVSGRLAGAEIARSESYHEGTIPLQTIRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDYG A A+T YG  G+KV++   + +    +   A   +V  K
Sbjct: 181 DIDYGFAEADTTYGKLGVKVWIYKGEVLKGDAAKAAAQREKVERK 225


>gi|326332197|ref|ZP_08198477.1| ribosomal protein S3 [Nocardioidaceae bacterium Broad-1]
 gi|325949903|gb|EGD41963.1| ribosomal protein S3 [Nocardioidaceae bacterium Broad-1]
          Length = 275

 Score =  261 bits (667), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 100/207 (48%), Positives = 148/207 (71%), Gaps = 1/207 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP  FRLG++    SRW+A   +Y   + ED+KIR+ L   +++AG+AK+ IERT
Sbjct: 1   MGQKINPNGFRLGISTDHKSRWYAD-KQYKEYVGEDVKIRKLLSKGMERAGIAKVEIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG++G + +++R +L  +T  ++ L++ EV  PE++A L+AQ +
Sbjct: 60  RDRVRVDIHTARPGIVIGRRGAEADRLRTELEKLTGKQVQLNILEVKNPEVDAQLVAQGV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QL  RV FRRAM++A+Q+ MR GA G+++  SGRLNGAE+SRTE Y EGRVPL TLRA
Sbjct: 120 AEQLSGRVQFRRAMRKAMQTTMRSGAKGIRIQCSGRLNGAEMSRTEFYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDE 207
            IDYG   A T +G  G+KV++   + 
Sbjct: 180 DIDYGFYEARTTFGRIGVKVWIYKGEV 206


>gi|254506464|ref|ZP_05118606.1| ribosomal protein S3 [Vibrio parahaemolyticus 16]
 gi|260779497|ref|ZP_05888387.1| SSU ribosomal protein S3p (S3e) [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|323492125|ref|ZP_08097287.1| 30S ribosomal protein S3 [Vibrio brasiliensis LMG 20546]
 gi|219550638|gb|EED27621.1| ribosomal protein S3 [Vibrio parahaemolyticus 16]
 gi|260604306|gb|EEX30610.1| SSU ribosomal protein S3p (S3e) [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|323313686|gb|EGA66788.1| 30S ribosomal protein S3 [Vibrio brasiliensis LMG 20546]
          Length = 232

 Score =  261 bits (667), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 109/224 (48%), Positives = 154/224 (68%), Gaps = 1/224 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WN+ WFA   ++   L  D K+R++L   LK+A +++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNATWFANTKDFADNLDGDFKVRQFLTSELKKASLSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  ++ +      +++ EV KPE++A L+  SI
Sbjct: 61  AKSIRVTIHTARPGVVIGKKGEDVEKLRAAVAKIAGVPAQINIAEVRKPELDAQLVGDSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVE 224
            IDY T+ A T YG  GIKV++  + E+        A E +  +
Sbjct: 181 DIDYATSSAHTQYGVIGIKVWIF-KGEILGGMPAANAVEPKGDK 223


>gi|253995724|ref|YP_003047788.1| 30S ribosomal protein S3 [Methylotenera mobilis JLW8]
 gi|253982403|gb|ACT47261.1| ribosomal protein S3 [Methylotenera mobilis JLW8]
          Length = 240

 Score =  261 bits (667), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 123/211 (58%), Positives = 157/211 (74%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI FRL V   W SRW+A    + A+L  D+K+RE+L   L  A V++I+IER 
Sbjct: 1   MGQKINPIGFRLSVQKNWASRWYANSKNFPAMLQSDIKVREFLNKKLASAAVSRIMIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN +I +YSARPG++IGKKG DIE +R  L  +    +HL++ EV KPE++ATLIAQSI
Sbjct: 61  AKNAKITIYSARPGVVIGKKGEDIESLRSSLQGLMGVPVHLNIEEVRKPELDATLIAQSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLE+RV+FRRAMKRA+Q+AMR GA G+K+++SGRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLEKRVMFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDS 211
            IDYG A A T YG  GIKV+V   +  + +
Sbjct: 181 DIDYGVAEASTTYGIIGIKVWVFKGEIFAGN 211


>gi|313893202|ref|ZP_07826779.1| ribosomal protein S3 [Veillonella sp. oral taxon 158 str. F0412]
 gi|313442555|gb|EFR60970.1| ribosomal protein S3 [Veillonella sp. oral taxon 158 str. F0412]
          Length = 221

 Score =  261 bits (667), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 99/219 (45%), Positives = 156/219 (71%), Gaps = 1/219 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   R+G+   W+++W+A   ++ A LHED+KIR +L+  L  AG+++I IERT
Sbjct: 1   MGQKVNPHGLRVGIVKDWDAKWYAD-KDFAANLHEDVKIRNFLKETLFIAGISRIEIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           +K  ++ +++A+PG++IG+ G  IE I+K ++  T+ ++ +++ E+ + +++ATL+A++I
Sbjct: 60  NKRIKLTIHTAKPGMVIGRGGAGIEDIKKAMTRFTDKQVDVNIAEIKQADMDATLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERR+ FRRAMK+AV   MR GA G+K++ SGRL GAE++R+E Y EG +PL TLRA
Sbjct: 120 AGQLERRIGFRRAMKQAVGRTMRLGAKGIKIMVSGRLGGAEIARSESYREGSIPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
            IDYGTA A T YG  GIKV++   + + ++       E
Sbjct: 180 DIDYGTAEAHTTYGCIGIKVWIYKGEVLPEAKQPAKKEE 218


>gi|160947694|ref|ZP_02094861.1| hypothetical protein PEPMIC_01629 [Parvimonas micra ATCC 33270]
 gi|158446828|gb|EDP23823.1| hypothetical protein PEPMIC_01629 [Parvimonas micra ATCC 33270]
          Length = 244

 Score =  261 bits (667), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 102/231 (44%), Positives = 157/231 (67%), Gaps = 4/231 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   R+G+   W+SRWFA   E+G LL ED  IR+ ++  +  +GV K+ IER+
Sbjct: 1   MGQKVNPHGLRVGIIKDWDSRWFADKKEFGNLLVEDHNIRKLVKKEVALSGVPKVEIERS 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               ++ V++A+PG++IGK G  +E++R K+  +T  ++ ++V EV +P+++A L+A++I
Sbjct: 61  ANRVKVTVFTAKPGMVIGKSGAGVEELRVKIEKLTGKKVIVNVEEVKRPDLSAQLVAENI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV FRRAMK+A+Q +++ GA G+K   SGRL GA+++RTE Y EG +PLQTLRA
Sbjct: 121 AGQLERRVSFRRAMKQAMQRSLKAGAKGIKTAVSGRLGGADMARTEGYSEGTIPLQTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSD----STIPAAEHRVVEKDS 227
            I+YG A A+T YG  G+KV++   + +           PA + R  +KD+
Sbjct: 181 DIEYGFAEADTTYGKLGVKVWLYKGEVLPGMKAAVIEERPAKKDRRNKKDN 231


>gi|320352923|ref|YP_004194262.1| 30S ribosomal protein S3P [Desulfobulbus propionicus DSM 2032]
 gi|320121425|gb|ADW16971.1| SSU ribosomal protein S3P [Desulfobulbus propionicus DSM 2032]
          Length = 221

 Score =  261 bits (667), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 103/220 (46%), Positives = 153/220 (69%), Gaps = 1/220 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP+  R+ +  +W S W+A   +Y   LH+D  IR+YL+  L  AGV++I+IERT
Sbjct: 1   MGQKVNPVGLRINITRSWESIWYAD-KDYANNLHQDQLIRKYLKQRLFHAGVSRIVIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +  ++ +++ARPG++IGKKGT+IE ++K L         + + EV +PE +A L+A++I
Sbjct: 60  GEKVKVKLFTARPGIVIGKKGTEIEGLKKDLETKFKRNCFIDIQEVRRPEADAQLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLE+R+ FRRAMK+++ SA+RFG  G+K+  SGRL GAE+SRTE + EGRVPL TLRA
Sbjct: 120 ASQLEKRIAFRRAMKKSINSALRFGVQGIKISCSGRLGGAEMSRTEWFKEGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEH 220
            IDYGTA A+T YG  G+KV++   + ++D++        
Sbjct: 180 DIDYGTAEAKTTYGIIGVKVWIFKGEILADTEQVSEQPSQ 219


>gi|288917236|ref|ZP_06411605.1| ribosomal protein S3 [Frankia sp. EUN1f]
 gi|288351427|gb|EFC85635.1| ribosomal protein S3 [Frankia sp. EUN1f]
          Length = 320

 Score =  261 bits (667), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 100/218 (45%), Positives = 148/218 (67%), Gaps = 1/218 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP  FRLG+   + SRW+A   +Y A + ED+KIR+ +   +++AG++++ IERT
Sbjct: 1   MGQKVNPHGFRLGITSEFTSRWYAD-KQYKAYVGEDVKIRKMMSRGMERAGISRVDIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG++G + ++IR  L  +T  ++ L++ EV  PE +A L+AQ +
Sbjct: 60  QGRLRVDIHTARPGIVIGRRGAEADRIRGDLEKLTGKQVQLNILEVKNPETDAQLVAQGV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QL  RV FRRAM++A+QSAM+ GA G++V  SGRL GAE+SR+E Y EGRVPL TLRA
Sbjct: 120 AEQLSSRVSFRRAMRKAMQSAMKGGAKGIRVQCSGRLGGAEMSRSEFYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAA 218
            IDYG   A T +G  G+KV++   D V          
Sbjct: 180 DIDYGFYEARTNFGRIGVKVWIYKGDVVQSRAEREAQE 217


>gi|297569416|ref|YP_003690760.1| ribosomal protein S3 [Desulfurivibrio alkaliphilus AHT2]
 gi|296925331|gb|ADH86141.1| ribosomal protein S3 [Desulfurivibrio alkaliphilus AHT2]
          Length = 221

 Score =  261 bits (667), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 104/212 (49%), Positives = 147/212 (69%), Gaps = 1/212 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI  RL +  TW+S W+A   +Y   + ED  +++YL+  L  AGV+KI I RT
Sbjct: 1   MGQKVNPIGLRLNIVRTWDSIWYAD-KDYSRNILEDQDLKKYLKKRLFHAGVSKIQILRT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IGKKG++I+ ++  L   T     + + EV +PE +A L+A++I
Sbjct: 60  GDKIRVKLHTARPGIVIGKKGSEIDALKADLEKRTGRVCAVDIQEVRRPEADAQLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERR+ FRRAMK++V  A++FGA G+KV  SGRL GAE+SR E Y EGRVPL TLRA
Sbjct: 120 AQQLERRIAFRRAMKKSVNMALKFGAKGIKVACSGRLGGAEMSRREWYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSD 212
            IDYG A A T YG  G+KV++   + +++ D
Sbjct: 180 DIDYGLAEARTTYGIIGVKVWIFKGEVLAEED 211


>gi|114567835|ref|YP_754989.1| 30S ribosomal protein S3 [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
 gi|122317289|sp|Q0AUI6|RS3_SYNWW RecName: Full=30S ribosomal protein S3
 gi|114338770|gb|ABI69618.1| SSU ribosomal protein S3P [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
          Length = 227

 Score =  261 bits (667), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 95/225 (42%), Positives = 158/225 (70%), Gaps = 1/225 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P  FR+G+   W+S W+A   +Y  LLHED+K+R++++     AG++K+ I+RT
Sbjct: 1   MGQKVHPKGFRIGIIRDWDSNWYAD-RDYSELLHEDVKLRKFIKDRFYAAGISKVEIQRT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++A+PG+IIG+ G ++E+++  L+ MT   +++++ E+ +PE++A ++A+++
Sbjct: 60  GNRIRVTIHTAKPGIIIGRGGIEVERLKVNLAEMTKKNVNINIQEIRRPEMDAQIVAENV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLE+R+ FRRAMK+ V   MR G  G+K+  SGRL GAE++RTE Y EG+VPL TLRA
Sbjct: 120 AQQLEKRISFRRAMKQTVGRTMRSGGIGIKIAISGRLGGAEIARTEWYAEGKVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDYG A A T YG  GIKV+++  + + ++       + + +E+
Sbjct: 180 DIDYGFAEANTTYGKIGIKVWINRGEILPEAKQRPKEPKQKEMEE 224


>gi|157377443|ref|YP_001476043.1| 30S ribosomal protein S3 [Shewanella sediminis HAW-EB3]
 gi|157319817|gb|ABV38915.1| ribosomal protein S3 [Shewanella sediminis HAW-EB3]
          Length = 229

 Score =  261 bits (667), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 109/226 (48%), Positives = 153/226 (67%), Gaps = 4/226 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   W S W+A  S+Y   L  D ++R++L+  LKQA V+KI+IER 
Sbjct: 1   MGQKVHPNGIRLGITKPWISTWYADKSDYANNLTSDSEVRKFLEKKLKQASVSKIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  ++ +T     +++ E+ KPE++A L+A  I
Sbjct: 61  AKSVRVTIHTARPGVVIGKKGEDVEKLRNAVAKLTGIPAQINIAEIRKPELDAKLVADGI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+KV   GRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQNAMRLGAKGIKVQVGGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRD----EVSDSDSTIPAAEHRV 222
            IDY TA + T YG  G+KV+V   +     V   +      + + 
Sbjct: 181 DIDYSTAESHTQYGVIGVKVWVFKGEVLDGVVPAHEEPKQQPKRKP 226


>gi|311029055|ref|ZP_07707145.1| 30S ribosomal protein S3 [Bacillus sp. m3-13]
          Length = 218

 Score =  261 bits (667), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 102/219 (46%), Positives = 152/219 (69%), Gaps = 1/219 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI  R+GV   W S+W+A G +Y  LLHED+K+REY+   L  A V+K+ IER 
Sbjct: 1   MGQKVNPIGLRVGVIRDWESKWYA-GKDYANLLHEDIKVREYIAKRLNDASVSKVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                + V++A+PG++IGK GT++E +RK L+ +T   +H+++ E+ + +++A L+A++I
Sbjct: 60  ANRLNVTVHTAKPGMVIGKGGTEVEALRKALNQLTGKRVHINILEIKRADLDAKLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE RV FRRA K+++Q AMR GA G+K + SGRL GA+++R+E Y EG VPL TLRA
Sbjct: 120 ARQLENRVSFRRAQKQSLQRAMRAGAKGIKTMVSGRLGGADIARSEHYSEGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
            IDYGTA A+T YG  G+KV++   + +          +
Sbjct: 180 DIDYGTAEADTTYGKLGVKVWIYRGEVLPTKKKNEEGGK 218


>gi|169632356|ref|YP_001706092.1| 30S ribosomal protein S3 [Acinetobacter baumannii SDF]
 gi|226697657|sp|B0VQS4|RS3_ACIBS RecName: Full=30S ribosomal protein S3
 gi|169151148|emb|CAO99820.1| 30S ribosomal protein S3 [Acinetobacter baumannii]
          Length = 250

 Score =  261 bits (667), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 110/226 (48%), Positives = 155/226 (68%), Gaps = 1/226 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P+  RLGV    N+ W+A   +Y   L +DL++RE+L   LK A V+ ILIER 
Sbjct: 1   MGQKVHPVGIRLGVVKRHNANWYANPKQYAEYLLKDLQVREFLTKKLKNAMVSNILIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               ++ + +ARPG++IGKKG DIEK++++L+N+      +S+NE+ +P+++A L+A++I
Sbjct: 61  SGAAKVTISTARPGIVIGKKGEDIEKLQRELTNIMGVPAQVSINEIDRPDLDARLVAEAI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLE+RV+FRRAMKRAVQ+ MR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 ASQLEKRVMFRRAMKRAVQNTMRAGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD-SDSTIPAAEHRVVEK 225
            IDY T  AET YG+ G+KV++   + +        PA       K
Sbjct: 181 DIDYATMRAETTYGTIGVKVWIFRGEILGGMKQVMNPAPAEERPAK 226


>gi|255099238|ref|ZP_05328215.1| 30S ribosomal protein S3 [Clostridium difficile QCD-63q42]
          Length = 266

 Score =  261 bits (667), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 112/224 (50%), Positives = 150/224 (66%), Gaps = 1/224 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFA-RGSEYGALLHEDLKIREYLQCHLKQAGVAKILIER 59
           MGQK+NP   R+GV   W+SRWFA    E+G LL ED  IR++L+  L  AGVAKI IER
Sbjct: 1   MGQKVNPHGLRVGVIKDWDSRWFATDKKEFGNLLLEDHNIRKFLKKRLYSAGVAKIEIER 60

Query: 60  THKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQS 119
           +    ++ ++ A+PG++IG+ G  IE ++ +L  MT   I +++ EV   + NA L+A++
Sbjct: 61  SANKIKMDLHVAKPGVVIGRAGAGIEALKAELEKMTKKTIIVNIVEVRSTDKNAQLVAEN 120

Query: 120 IAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           IA  +ERRV FRRAMK+A+Q AM+ GA G+KV ASGRL GAE++RTE Y EG VPLQTLR
Sbjct: 121 IALAIERRVAFRRAMKQAIQRAMKSGAKGIKVSASGRLGGAEMARTEGYSEGNVPLQTLR 180

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVV 223
           A IDYG A A+T YG  GIKV++   + +   D   P  E R  
Sbjct: 181 ADIDYGFAEADTTYGKIGIKVWICNGEVLPTRDGVNPREESRKS 224


>gi|126697646|ref|YP_001086543.1| 30S ribosomal protein S3 [Clostridium difficile 630]
 gi|254973737|ref|ZP_05270209.1| 30S ribosomal protein S3 [Clostridium difficile QCD-66c26]
 gi|255091127|ref|ZP_05320605.1| 30S ribosomal protein S3 [Clostridium difficile CIP 107932]
 gi|255305021|ref|ZP_05349193.1| 30S ribosomal protein S3 [Clostridium difficile ATCC 43255]
 gi|255312781|ref|ZP_05354364.1| 30S ribosomal protein S3 [Clostridium difficile QCD-76w55]
 gi|255515540|ref|ZP_05383216.1| 30S ribosomal protein S3 [Clostridium difficile QCD-97b34]
 gi|255648635|ref|ZP_05395537.1| 30S ribosomal protein S3 [Clostridium difficile QCD-37x79]
 gi|255654168|ref|ZP_05399577.1| 30S ribosomal protein S3 [Clostridium difficile QCD-23m63]
 gi|260681852|ref|YP_003213137.1| 30S ribosomal protein S3 [Clostridium difficile CD196]
 gi|260685450|ref|YP_003216583.1| 30S ribosomal protein S3 [Clostridium difficile R20291]
 gi|296449793|ref|ZP_06891562.1| 30S ribosomal protein S3 [Clostridium difficile NAP08]
 gi|296877857|ref|ZP_06901879.1| 30S ribosomal protein S3 [Clostridium difficile NAP07]
 gi|306518758|ref|ZP_07405105.1| 30S ribosomal protein S3 [Clostridium difficile QCD-32g58]
 gi|122974217|sp|Q18CG5|RS3_CLOD6 RecName: Full=30S ribosomal protein S3
 gi|115249083|emb|CAJ66894.1| 30S ribosomal protein S3 [Clostridium difficile]
 gi|260208015|emb|CBA60197.1| 30S ribosomal protein S3 [Clostridium difficile CD196]
 gi|260211466|emb|CBE01590.1| 30S ribosomal protein S3 [Clostridium difficile R20291]
 gi|296261391|gb|EFH08217.1| 30S ribosomal protein S3 [Clostridium difficile NAP08]
 gi|296431157|gb|EFH16982.1| 30S ribosomal protein S3 [Clostridium difficile NAP07]
          Length = 271

 Score =  261 bits (667), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 112/224 (50%), Positives = 150/224 (66%), Gaps = 1/224 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFA-RGSEYGALLHEDLKIREYLQCHLKQAGVAKILIER 59
           MGQK+NP   R+GV   W+SRWFA    E+G LL ED  IR++L+  L  AGVAKI IER
Sbjct: 1   MGQKVNPHGLRVGVIKDWDSRWFATDKKEFGNLLLEDHNIRKFLKKRLYSAGVAKIEIER 60

Query: 60  THKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQS 119
           +    ++ ++ A+PG++IG+ G  IE ++ +L  MT   I +++ EV   + NA L+A++
Sbjct: 61  SANKIKMDLHVAKPGVVIGRAGAGIEALKAELEKMTKKTIIVNIVEVRSTDKNAQLVAEN 120

Query: 120 IAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           IA  +ERRV FRRAMK+A+Q AM+ GA G+KV ASGRL GAE++RTE Y EG VPLQTLR
Sbjct: 121 IALAIERRVAFRRAMKQAIQRAMKSGAKGIKVSASGRLGGAEMARTEGYSEGNVPLQTLR 180

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVV 223
           A IDYG A A+T YG  GIKV++   + +   D   P  E R  
Sbjct: 181 ADIDYGFAEADTTYGKIGIKVWICNGEVLPTRDGVNPREESRKS 224


>gi|116667412|pdb|2GY9|C Chain C, Structure Of The 30s Subunit Of A Pre-Translocational E.
           Coli Ribosome Obtained By Fitting Atomic Models For Rna
           And Protein Components Into Cryo-Em Map Emd-1056
 gi|116667464|pdb|2GYB|C Chain C, Structure Of The 30s Subunit Of A Secm-Stalled E. Coli
           Ribosome Complex Obtained By Fitting Atomic Models For
           Rna And Protein Components Into Cryo-Em Map Emd-1143
 gi|224510724|pdb|3FIH|C Chain C, Ternary Complex-Bound E.Coli 70s Ribosome. This Entry
           Consists Of The 30s Subunit, Trnas And The Ternary
           Complex.
 gi|294662219|pdb|2WWL|C Chain C, E.Coli 70s Ribosome Stalled During Translation Of Tnac
           Leader Peptide. This File Contains The 30s, The P-Site
           Trna And The Tnac Leader Peptide (Part 1 Of 2).
 gi|308387967|pdb|3OFO|C Chain C, Crystal Structure Of The E. Coli Ribosome Bound To
           Erythromycin. This File Contains The 30s Subunit Of The
           First 70s Ribosome.
 gi|308387988|pdb|3OFP|C Chain C, Crystal Structure Of The E. Coli Ribosome Bound To
           Erythromycin. This File Contains The 30s Subunit Of The
           Second 70s Ribosome.
 gi|309320025|pdb|3OFA|C Chain C, Crystal Structure Of The E. Coli Ribosome Bound To
           Chloramphenicol. This File Contains The 30s Subunit Of
           The First 70s Ribosome.
 gi|309320046|pdb|3OFB|C Chain C, Crystal Structure Of The E. Coli Ribosome Bound To
           Chloramphenicol. This File Contains The 30s Subunit Of
           The Second 70s Ribosome.
 gi|309320129|pdb|3OFX|C Chain C, Crystal Structure Of The E. Coli Ribosome Bound To
           Clindamycin. This File Contains The 30s Subunit Of The
           First 70s Ribosome.
 gi|309320150|pdb|3OFY|C Chain C, Crystal Structure Of The E. Coli Ribosome Bound To
           Clindamycin. This File Contains The 30s Subunit Of The
           Second 70s Ribosome
 gi|315113614|pdb|3OAQ|C Chain C, Crystal Structure Of The E. Coli Ribosome Bound To
           Telithromycin. This File Contains The 30s Subunit Of The
           First 70s Ribosome.
 gi|315113635|pdb|3OAR|C Chain C, Crystal Structure Of The E. Coli Ribosome Bound To
           Telithromycin. This File Contains The 30s Subunit Of The
           Second 70s Ribosome
          Length = 206

 Score =  261 bits (667), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 109/206 (52%), Positives = 148/206 (71%)

Query: 2   GQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERTH 61
           GQK++P   RLG+   WNS WFA   E+   L  D K+R+YL   L +A V++I+IER  
Sbjct: 1   GQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLTKELAKASVSRIVIERPA 60

Query: 62  KNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSIA 121
           K+ R+ +++ARPG++IGKKG D+EK+RK ++++      +++ EV KPE++A L+A SI 
Sbjct: 61  KSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQINIAEVRKPELDAKLVADSIT 120

Query: 122 QQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRAH 181
            QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA 
Sbjct: 121 SQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRAD 180

Query: 182 IDYGTAVAETAYGSCGIKVYVSLRDE 207
           IDY T+ A T YG  G+KV++   + 
Sbjct: 181 IDYNTSEAHTTYGVIGVKVWIFKGEI 206


>gi|306802322|ref|ZP_07438990.1| ribosomal protein S3 [Mycobacterium tuberculosis SUMu008]
 gi|308350987|gb|EFP39838.1| ribosomal protein S3 [Mycobacterium tuberculosis SUMu008]
          Length = 241

 Score =  261 bits (667), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 102/215 (47%), Positives = 143/215 (66%), Gaps = 2/215 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP  FRLG+   W SRW+A   +Y   + ED+ IR  L   L++AG+A + IERT
Sbjct: 1   MGQKINPHGFRLGITTDWKSRWYAD-KQYAEYVKEDVAIRRLLSSGLERAGIADVEIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG++GT+ ++IR  L  +T  ++ L++ EV  PE  A L+AQ +
Sbjct: 60  RDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTGKQVQLNILEVKNPESQAQLVAQGV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAM-RFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           A+QL  RV FRRAM++A+QSAM +    G++V  SGRL GAE+SR+E Y EGRVPL TLR
Sbjct: 120 AEQLSNRVAFRRAMRKAIQSAMRQPNVKGIRVQCSGRLGGAEMSRSEFYREGRVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDST 214
           A IDYG   A+T +G  G+KV++   D V      
Sbjct: 180 ADIDYGLYEAKTTFGRIGVKVWIYKGDIVGGKREL 214


>gi|117924161|ref|YP_864778.1| 30S ribosomal protein S3P [Magnetococcus sp. MC-1]
 gi|152060871|sp|A0L5X9|RS3_MAGSM RecName: Full=30S ribosomal protein S3
 gi|117607917|gb|ABK43372.1| SSU ribosomal protein S3P [Magnetococcus sp. MC-1]
          Length = 210

 Score =  261 bits (667), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 114/205 (55%), Positives = 153/205 (74%), Gaps = 1/205 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P  FRLG   TW++RWFA    Y  LL ED+KIR +L+  L  A V+KI+IER 
Sbjct: 1   MGQKVHPTGFRLGTTKTWDTRWFAD-RNYADLLLEDIKIRAWLKKRLAHASVSKIVIERP 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +  RI +++ARPG+IIGKKG DIEK++  +  +T+SE+ +++ E+ KPE +A L+A+++
Sbjct: 60  AQKARINIHTARPGIIIGKKGGDIEKLKNDIKAITSSEVQINIVEIRKPEADAQLVAENV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRV FRR+MKRAV SAMR GA+G+++  +GRL GAE++RTE Y EGRVPL TLRA
Sbjct: 120 AQQLERRVAFRRSMKRAVTSAMRLGAEGIRINCAGRLGGAEIARTEWYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLR 205
            IDYG A A T YG  G+KV+V   
Sbjct: 180 DIDYGFAEAHTTYGIIGVKVWVYKG 204


>gi|113869425|ref|YP_727914.1| 30S ribosomal protein S3 [Ralstonia eutropha H16]
 gi|194291016|ref|YP_002006923.1| 30S ribosomal protein s3 [Cupriavidus taiwanensis LMG 19424]
 gi|122946539|sp|Q0K625|RS3_RALEH RecName: Full=30S ribosomal protein S3
 gi|226697693|sp|B3R7R7|RS3_CUPTR RecName: Full=30S ribosomal protein S3
 gi|113528201|emb|CAJ94546.1| SSU ribosomal protein S3 [Ralstonia eutropha H16]
 gi|193224851|emb|CAQ70862.1| 30S ribosomal subunit protein S3 [Cupriavidus taiwanensis LMG
           19424]
          Length = 265

 Score =  261 bits (666), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 112/220 (50%), Positives = 160/220 (72%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V+  W SRW+A  +++  +L ED+++R++L+  LK A V +++IER 
Sbjct: 1   MGQKIHPTGFRLAVSRNWASRWYASNTKFAGMLKEDIEVRDFLKKKLKNASVGRVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +N RI +YS+RPG++IGKKG DIE ++ +L       +H+++ E+ KPE +A LIA SI
Sbjct: 61  ARNARITIYSSRPGVVIGKKGEDIELLKAELQRRMGVPVHVNIEEIRKPETDAQLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLERR++FRRAMKRA+Q+AMR GA G+K++++GRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 TQQLERRIMFRRAMKRAMQNAMRLGAQGIKIMSAGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEH 220
            IDYG + AET YG  G+KV+V   D +  +D+ +     
Sbjct: 181 DIDYGFSEAETTYGIIGVKVWVYKGDHLGRNDAPVVEEPQ 220


>gi|116624196|ref|YP_826352.1| 30S ribosomal protein S3P [Candidatus Solibacter usitatus
           Ellin6076]
 gi|122253088|sp|Q01W98|RS3_SOLUE RecName: Full=30S ribosomal protein S3
 gi|116227358|gb|ABJ86067.1| SSU ribosomal protein S3P [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 344

 Score =  261 bits (666), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 107/222 (48%), Positives = 154/222 (69%), Gaps = 3/222 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P  FRLG N  W SRWFA    Y  LL EDL+++  L+  LK AGV+ I ++R 
Sbjct: 1   MGQKVHPYGFRLGFNKPWRSRWFA-KQGYAKLLQEDLELKAALRERLKSAGVSSIEVDRP 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ + ++RPG+IIG+KG +IEK+++ ++  T  E+ + + EV KPE++A L+++SI
Sbjct: 60  GNKLRVTIRTSRPGIIIGRKGAEIEKLKQDMAKKTKREVFIDIQEVHKPELDAQLVSESI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLE+RV FRRAM++AV SA+RFG  G+KV  SGRLNGAE++R+E YL+G++PL TLRA
Sbjct: 120 ALQLEKRVAFRRAMRKAVDSALRFGCKGIKVRVSGRLNGAEIARSEWYLQGQLPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDE--VSDSDSTIPAAEH 220
            IDYG A A T YG  GIK ++   +   ++   + +P  E 
Sbjct: 180 DIDYGFAEAHTTYGVIGIKAWLYKGEILDLTKRRNLLPEPEP 221


>gi|52078615|ref|YP_077406.1| 30S ribosomal protein S3 [Bacillus licheniformis ATCC 14580]
 gi|52783977|ref|YP_089806.1| 30S ribosomal protein S3 [Bacillus licheniformis ATCC 14580]
 gi|319649110|ref|ZP_08003318.1| 30S ribosomal protein S3 [Bacillus sp. BT1B_CT2]
 gi|81691248|sp|Q65PA1|RS3_BACLD RecName: Full=30S ribosomal protein S3
 gi|52001826|gb|AAU21768.1| ribosomal protein S3 (BS3) [Bacillus licheniformis ATCC 14580]
 gi|52346479|gb|AAU39113.1| RpsC [Bacillus licheniformis ATCC 14580]
 gi|317388810|gb|EFV69629.1| 30S ribosomal protein S3 [Bacillus sp. BT1B_CT2]
          Length = 218

 Score =  261 bits (666), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 97/219 (44%), Positives = 149/219 (68%), Gaps = 1/219 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP+  R+GV   W S+W+A G +Y   LHEDLKIRE++   L  A V+K+ IER 
Sbjct: 1   MGQKVNPVGLRIGVIRDWESKWYA-GKDYADFLHEDLKIREFINQRLSDASVSKVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                I +++A+PG++IGK G+++E +RK L+++T   +H+++ E+ + +++A L+A +I
Sbjct: 60  ANRVNITIHTAKPGMVIGKGGSEVEALRKALNSLTGKRVHINILEIKRADLDAQLVADNI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE R+ FRRA K+ +Q  MR GA G+K + SGRL GA+++R+E Y EG VPL TLRA
Sbjct: 120 ARQLENRISFRRAQKQQIQRTMRAGAQGIKTMVSGRLGGADIARSEYYSEGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
            IDY T+ A+T YG  G+KV++   + +     T    +
Sbjct: 180 DIDYATSEADTTYGKLGVKVWIYRGEVLPTKKKTEEGGK 218


>gi|312884697|ref|ZP_07744398.1| 30S ribosomal protein S3 [Vibrio caribbenthicus ATCC BAA-2122]
 gi|323495510|ref|ZP_08100584.1| 30S ribosomal protein S3 [Vibrio sinaloensis DSM 21326]
 gi|309367610|gb|EFP95161.1| 30S ribosomal protein S3 [Vibrio caribbenthicus ATCC BAA-2122]
 gi|323319391|gb|EGA72328.1| 30S ribosomal protein S3 [Vibrio sinaloensis DSM 21326]
          Length = 232

 Score =  261 bits (666), Expect = 7e-68,   Method: Composition-based stats.
 Identities = 109/224 (48%), Positives = 154/224 (68%), Gaps = 1/224 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WN+ WFA   ++   L  D K+R++L   LK+A +++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNATWFANTKDFADNLDGDFKVRQFLTSELKKASLSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  ++ +      +++ EV KPE++A L+  SI
Sbjct: 61  AKSIRVTIHTARPGVVIGKKGEDVEKLRTAVAKIAGVPAQINIAEVRKPELDAQLVGDSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVE 224
            IDY T+ A T YG  GIKV++  + E+        A E +  +
Sbjct: 181 DIDYATSSAHTQYGVIGIKVWIF-KGEILGGMPAANAVEPKGDK 223


>gi|125975390|ref|YP_001039300.1| SSU ribosomal protein S3P [Clostridium thermocellum ATCC 27405]
 gi|256005323|ref|ZP_05430289.1| ribosomal protein S3 [Clostridium thermocellum DSM 2360]
 gi|281419352|ref|ZP_06250367.1| ribosomal protein S3 [Clostridium thermocellum JW20]
 gi|152060857|sp|A3DJH8|RS3_CLOTH RecName: Full=30S ribosomal protein S3
 gi|125715615|gb|ABN54107.1| SSU ribosomal protein S3P [Clostridium thermocellum ATCC 27405]
 gi|255990759|gb|EEU00875.1| ribosomal protein S3 [Clostridium thermocellum DSM 2360]
 gi|281406972|gb|EFB37235.1| ribosomal protein S3 [Clostridium thermocellum JW20]
 gi|316939506|gb|ADU73540.1| ribosomal protein S3 [Clostridium thermocellum DSM 1313]
          Length = 226

 Score =  261 bits (666), Expect = 7e-68,   Method: Composition-based stats.
 Identities = 100/220 (45%), Positives = 146/220 (66%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   R+G+   W+++W+A    +   L ED KIR++++  L  AG+++I IER 
Sbjct: 1   MGQKVNPHGLRIGIIKDWDTKWYANDKNFSEYLVEDFKIRKFIKNKLYSAGISRIEIERA 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               +I V++A+PGLIIGK G  IE++RK+L  MT   I +++ E+  PE++A ++A++I
Sbjct: 61  ANKVKINVHAAKPGLIIGKGGAGIEELRKQLEKMTQKNILINITEIKVPELDAQIVAENI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLE+R+ FRRAMK+A+  AMR GA G+K   SGR+ GAE++RTE Y EG +PLQTLRA
Sbjct: 121 ASQLEKRISFRRAMKQAMARAMRLGAKGIKTAVSGRIAGAEIARTEHYHEGTIPLQTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEH 220
            IDYG A A T YG  G+KV++   + +          E 
Sbjct: 181 DIDYGFAEANTTYGKLGVKVWIYKGEVLPAVKKDKGRKEE 220


>gi|88860953|ref|ZP_01135589.1| 30S ribosomal subunit protein S3 [Pseudoalteromonas tunicata D2]
 gi|88817166|gb|EAR26985.1| 30S ribosomal subunit protein S3 [Pseudoalteromonas tunicata D2]
          Length = 235

 Score =  261 bits (666), Expect = 7e-68,   Method: Composition-based stats.
 Identities = 107/210 (50%), Positives = 150/210 (71%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG++  W S W+A   ++  +L  D K+R +L   LK A V+KI+IER 
Sbjct: 1   MGQKVHPTGIRLGISKPWVSTWYANTKDFPEMLFGDHKVRTFLTKELKAASVSKIIIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  +S +      ++++E+ KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRLVVSKIAGVPAQINISEIRKPELDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQNAMRIGAKGIKVEVSGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD 210
            IDY T+ A T YG  G+KV++   + +  
Sbjct: 181 DIDYSTSEALTTYGIIGVKVWIFKGEVIGG 210


>gi|296113791|ref|YP_003627729.1| 30S ribosomal protein S3 [Moraxella catarrhalis RH4]
 gi|295921485|gb|ADG61836.1| 30S ribosomal protein S3 [Moraxella catarrhalis RH4]
 gi|326562136|gb|EGE12464.1| 30S ribosomal protein S3 [Moraxella catarrhalis 7169]
 gi|326564499|gb|EGE14725.1| 30S ribosomal protein S3 [Moraxella catarrhalis 46P47B1]
 gi|326565682|gb|EGE15845.1| 30S ribosomal protein S3 [Moraxella catarrhalis 12P80B1]
 gi|326566251|gb|EGE16403.1| 30S ribosomal protein S3 [Moraxella catarrhalis 103P14B1]
 gi|326567097|gb|EGE17219.1| 30S ribosomal protein S3 [Moraxella catarrhalis BC1]
 gi|326568361|gb|EGE18441.1| 30S ribosomal protein S3 [Moraxella catarrhalis BC7]
 gi|326572262|gb|EGE22257.1| 30S ribosomal protein S3 [Moraxella catarrhalis BC8]
 gi|326574604|gb|EGE24544.1| 30S ribosomal protein S3 [Moraxella catarrhalis O35E]
 gi|326574860|gb|EGE24790.1| 30S ribosomal protein S3 [Moraxella catarrhalis 101P30B1]
 gi|326576184|gb|EGE26099.1| 30S ribosomal protein S3 [Moraxella catarrhalis CO72]
          Length = 240

 Score =  261 bits (666), Expect = 7e-68,   Method: Composition-based stats.
 Identities = 107/222 (48%), Positives = 152/222 (68%), Gaps = 1/222 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI  RLGV    N+ W+A   +Y   L  D ++R +L+  L+ A V+ I IER 
Sbjct: 1   MGQKVHPIGIRLGVIKKHNANWYANPKQYSEYLLNDFQVRNFLRKKLEGAMVSHIYIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               +I ++SARPG+IIGKKG DIE ++K+L+ +      +++ E+ +P+++A L+A+ I
Sbjct: 61  TGAAKITIHSARPGIIIGKKGEDIESLQKELTKLMGVPAQVNIQEISQPDLDARLVAEGI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ++MR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQNSMRSGAQGIKVELSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDST-IPAAEHR 221
            IDY +  AET YG+ G+KV++   + +   +S   P  E +
Sbjct: 181 DIDYASVRAETTYGTIGVKVWIFRSEVLDGMNSAYNPVVEDK 222


>gi|300742051|ref|ZP_07072072.1| ribosomal protein S3 [Rothia dentocariosa M567]
 gi|311111967|ref|YP_003983189.1| 30S ribosomal protein S3 [Rothia dentocariosa ATCC 17931]
 gi|300381236|gb|EFJ77798.1| ribosomal protein S3 [Rothia dentocariosa M567]
 gi|310943461|gb|ADP39755.1| 30S ribosomal protein S3 [Rothia dentocariosa ATCC 17931]
          Length = 265

 Score =  261 bits (666), Expect = 7e-68,   Method: Composition-based stats.
 Identities = 108/222 (48%), Positives = 155/222 (69%), Gaps = 5/222 (2%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSE----YGALLHEDLKIREYLQCHLKQAGVAKIL 56
           MGQKI+P  FRLG+     S+WFA  ++    Y   + ED+KIRE L  +L +AGVAK+ 
Sbjct: 1   MGQKIHPNGFRLGITTEHVSKWFADSNKPGERYADFVREDVKIRELLAKNLDRAGVAKVE 60

Query: 57  IERTHKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLI 116
           IERT    R+ +++ARPG++IG++G + ++IR +L  +T  +I L++ EV  P+++A L+
Sbjct: 61  IERTRDRVRVDIHTARPGIVIGRRGAEADRIRGELEKLTGKQIQLNILEVSNPDLSAQLV 120

Query: 117 AQSIAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQ 176
           AQSIA+QL  RV FRRAMK+A+QSA R GA G+++  SGRL GAE+SR+E Y EGRVPL 
Sbjct: 121 AQSIAEQLAARVAFRRAMKKAIQSAQRAGAKGIRIQCSGRLGGAEMSRSEFYREGRVPLH 180

Query: 177 TLRAHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAA 218
           TLRA+IDYG   A+T +G  G+KV++   D ++D +     A
Sbjct: 181 TLRANIDYGFFEAKTTFGRIGVKVWIYKGD-LTDKELAAQQA 221


>gi|323706456|ref|ZP_08118017.1| ribosomal protein S3 [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323534176|gb|EGB23966.1| ribosomal protein S3 [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 221

 Score =  261 bits (666), Expect = 7e-68,   Method: Composition-based stats.
 Identities = 105/218 (48%), Positives = 155/218 (71%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP   R+GV+  W ++WFA+  ++  LL ED+KIR+Y++  +  +GV KI IER 
Sbjct: 1   MGQKINPRGLRVGVSQDWYAKWFAKDKDFSDLLIEDIKIRDYIKNKIYASGVPKIEIERA 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               +I VY+A+PG++IGK G  IE++R+++  MTN ++ +++ EV  PE++A L+A++I
Sbjct: 61  ANRIKIDVYTAKPGMVIGKGGAGIEELRQEIEKMTNKKVVINIVEVKNPELDAQLVAENI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERR+ FRRAMK+++  AM+ GA G+K+  SGRL GAE++RTE Y EG VPLQTLRA
Sbjct: 121 ASQLERRISFRRAMKQSIARAMKQGAKGIKIACSGRLAGAEIARTERYHEGVVPLQTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAA 218
           +IDYG A A T YG  G+KV+++  + +      + A 
Sbjct: 181 NIDYGFAEANTTYGKIGVKVWINKGEILPQPKKQVTAE 218


>gi|289523363|ref|ZP_06440217.1| ribosomal protein S3 [Anaerobaculum hydrogeniformans ATCC BAA-1850]
 gi|289503055|gb|EFD24219.1| ribosomal protein S3 [Anaerobaculum hydrogeniformans ATCC BAA-1850]
          Length = 224

 Score =  261 bits (666), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 99/214 (46%), Positives = 146/214 (68%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P+ +RLGV   W SRW+A    +   LHED+K+R++++     AG++ + IER 
Sbjct: 1   MGQKVHPVGYRLGVIRDWESRWYADKKNFAKQLHEDIKLRKWIKDRWGHAGISTVEIERI 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R  +++ARPG++IGK G++I+++R +L  MT S++ ++V E+  P+ NA ++A+ I
Sbjct: 61  GNVIRFTIWTARPGVVIGKGGSEIQEVRDELQKMTGSKVMINVQEIKNPDKNAQIVAEGI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A  LERRV FRRAMK+A+  AM+ GA G+K   SGRL GAE++R E YLEGR+PL TLRA
Sbjct: 121 ASALERRVSFRRAMKQAIFRAMKAGALGIKTQCSGRLGGAEIARREWYLEGRLPLSTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDST 214
            IDYG A A+T YG  G+KV++   D +      
Sbjct: 181 DIDYGFAEAKTMYGVIGVKVWIYNGDVLPSLKEQ 214


>gi|256847769|ref|ZP_05553214.1| ribosomal protein S3 [Lactobacillus coleohominis 101-4-CHN]
 gi|256715458|gb|EEU30434.1| ribosomal protein S3 [Lactobacillus coleohominis 101-4-CHN]
          Length = 219

 Score =  261 bits (666), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 96/219 (43%), Positives = 148/219 (67%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP  FR+GV   W+++W+A    Y   L+EDL+IR+Y++  L  A V+ I IER 
Sbjct: 1   MGQKINPNGFRVGVIRPWSAKWYADKKHYAEYLNEDLRIRKYIEKRLADASVSTIEIERA 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                + +++ARPG++IGK G+++E +R +L+ +T   +H++V E+ KP+++A L+ +++
Sbjct: 61  ANRVNVSIHTARPGMVIGKGGSEVEALRLELNKLTGKRVHINVVEIKKPDLDAHLVGENV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLE R+ FRRAM+ A+Q AMR GA G+K+  +GRLNGA++SR E Y +G VPL TLRA
Sbjct: 121 AQQLENRIAFRRAMRGAMQRAMRAGAKGIKIQVAGRLNGADMSRVESYSDGTVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
            IDY    A T YG+ GIK ++   + + +  +     +
Sbjct: 181 DIDYSWDEARTTYGALGIKTWIYRGEVLPEKKNNSKGGK 219


>gi|184155985|ref|YP_001844325.1| 30S ribosomal protein S3 [Lactobacillus fermentum IFO 3956]
 gi|227515493|ref|ZP_03945542.1| ribosomal protein S3 [Lactobacillus fermentum ATCC 14931]
 gi|260662758|ref|ZP_05863652.1| 30S ribosomal protein S3 [Lactobacillus fermentum 28-3-CHN]
 gi|183227329|dbj|BAG27845.1| 30S ribosomal protein S3 [Lactobacillus fermentum IFO 3956]
 gi|227086106|gb|EEI21418.1| ribosomal protein S3 [Lactobacillus fermentum ATCC 14931]
 gi|260552839|gb|EEX25838.1| 30S ribosomal protein S3 [Lactobacillus fermentum 28-3-CHN]
          Length = 219

 Score =  261 bits (666), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 97/217 (44%), Positives = 147/217 (67%), Gaps = 1/217 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP  FR+GV   W ++W+A    Y A L+EDL+IR+Y++  L  A V+ + IER 
Sbjct: 1   MGQKINPNGFRVGVIRDWTAKWYAD-KNYAAYLNEDLRIRKYIEKRLADASVSTVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                + +++A+PG++IGK G+++E +RK+L+N+TN  +H++V E+ KP+++A L+ +S+
Sbjct: 60  ANRVNVSIHTAKPGMVIGKGGSEVEALRKELNNLTNKRVHINVVEIKKPDLDAHLVGESV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE R+ FRRAM+ A+Q  MR GA G+K+  +GRLNGA++SR E Y +G VPL TLRA
Sbjct: 120 AEQLENRIAFRRAMRGAMQRTMRAGAKGIKIQVAGRLNGADMSRIESYSDGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPA 217
            IDY    A T YG  GIK ++   + +    +    
Sbjct: 180 DIDYSWDEAHTTYGVLGIKTWIYRGEVLPAKKNNEAK 216


>gi|257054476|ref|YP_003132308.1| 30S ribosomal protein S3P [Saccharomonospora viridis DSM 43017]
 gi|256584348|gb|ACU95481.1| SSU ribosomal protein S3P [Saccharomonospora viridis DSM 43017]
          Length = 286

 Score =  261 bits (666), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 98/211 (46%), Positives = 143/211 (67%), Gaps = 2/211 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP  FRLG+   W SRW+A   +Y   + ED+KIR+ L   +++AG++K+ IERT
Sbjct: 1   MGQKINPHGFRLGITTDWKSRWYAD-KQYSEYVAEDVKIRKLLSTGMERAGISKVEIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +  R+ +++ARPG++IG++G + ++IR  L  +T  ++ L++ EV  PE +A L+AQ I
Sbjct: 60  RERVRVDIHTARPGIVIGRRGAEADRIRGALEKLTGKQVQLNILEVKNPEADAQLVAQGI 119

Query: 121 AQQLERRVVFRRAMKRAVQ-SAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           A+QL  RV FRRAM++A+Q S       G++V  SGRL GAE+SR+E Y +GRVPL TLR
Sbjct: 120 AEQLSNRVAFRRAMRKAIQTSMRSPQVKGIRVQCSGRLGGAEMSRSEHYRDGRVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSD 210
           A IDYG   A T +G  G+KV++   D +  
Sbjct: 180 ADIDYGFFEARTTFGRIGVKVWIYKGDLIGG 210


>gi|237747371|ref|ZP_04577851.1| small subunit ribosomal protein S3 [Oxalobacter formigenes HOxBLS]
 gi|229378722|gb|EEO28813.1| small subunit ribosomal protein S3 [Oxalobacter formigenes HOxBLS]
          Length = 282

 Score =  261 bits (666), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 116/225 (51%), Positives = 161/225 (71%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V   W+SRW+A  + +  +L+EDLK R YL+  LK A V +++IER 
Sbjct: 1   MGQKIHPTGFRLAVARNWSSRWYAGNTNFAGMLNEDLKARAYLKKKLKNASVGQVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN R  +YS+RPG++IGKKG DIE ++  LS +    +H+++ EV KPEI+A LIA SI
Sbjct: 61  AKNARFTIYSSRPGVVIGKKGEDIEVLKSDLSRIMGVPVHVNIEEVRKPEIHAQLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLE+R++FRRAM+RA+Q+AMR GA G+K+++SGRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 TQQLEKRIMFRRAMRRAMQNAMRLGAVGIKIMSSGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDYG + A+T YG  G+KV+V   D + + ++      +   +K
Sbjct: 181 DIDYGFSEAQTTYGIIGVKVWVYKGDRLENGEAPKIETPNEEDKK 225


>gi|304405610|ref|ZP_07387269.1| ribosomal protein S3 [Paenibacillus curdlanolyticus YK9]
 gi|304345649|gb|EFM11484.1| ribosomal protein S3 [Paenibacillus curdlanolyticus YK9]
          Length = 221

 Score =  261 bits (666), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 108/227 (47%), Positives = 158/227 (69%), Gaps = 9/227 (3%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP+  R+G+   W S+WFA G ++G LL ED+KIREYL+  LK A V++I IER 
Sbjct: 1   MGQKVNPVGLRIGIIRDWESKWFA-GKDFGDLLIEDVKIREYLKNKLKDAAVSRIEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTN-SEIHLSVNEVPKPEINATLIAQS 119
                + + +A+PG++IGK G+++E +R +L+ +TN  ++H+++ E+   +++A L+A+S
Sbjct: 60  ANRVNVTINTAKPGMVIGKGGSEVENLRNQLAKITNGKKVHINITEIKHADLDAILVAES 119

Query: 120 IAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           IAQQLERR  FRRA+K+A+Q  MR GA G+K   SGRL GAE++RTE Y EG VPL TLR
Sbjct: 120 IAQQLERRTSFRRALKQAIQRTMRSGAKGIKTSVSGRLGGAEIARTEGYSEGTVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
           A IDYGTA A T YG  G+KV++   + +       PAA+ +  ++ 
Sbjct: 180 ADIDYGTAEAHTTYGRIGVKVWIYRGEIL-------PAAKKKAAQEG 219


>gi|262373515|ref|ZP_06066793.1| ribosomal protein S3 [Acinetobacter junii SH205]
 gi|262311268|gb|EEY92354.1| ribosomal protein S3 [Acinetobacter junii SH205]
          Length = 250

 Score =  261 bits (666), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 111/226 (49%), Positives = 155/226 (68%), Gaps = 1/226 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI  RLGV    N+ W+A   +Y   L +DL++RE+L   LK A V+ ILIER 
Sbjct: 1   MGQKVHPIGIRLGVVKRHNANWYASPKQYAEYLLKDLQVREFLTKKLKNAMVSNILIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               ++ + +ARPG++IGKKG DIEK++++L+N+      +S+NE+ +P+++A L+A++I
Sbjct: 61  TGAAKVTISTARPGIVIGKKGEDIEKLQRELTNIMGVPAQVSINEIDRPDLDARLVAEAI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLE+RV+FRRAMKRAVQ+ MR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 ASQLEKRVMFRRAMKRAVQNTMRAGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD-SDSTIPAAEHRVVEK 225
            IDY T  AET YG+ G+KV++   + +        PA       K
Sbjct: 181 DIDYATMRAETTYGTIGVKVWIFRGEILGGMKQVMNPAPAEERPAK 226


>gi|299541938|ref|ZP_07052261.1| 30S ribosomal protein S3 [Lysinibacillus fusiformis ZC1]
 gi|298725676|gb|EFI66317.1| 30S ribosomal protein S3 [Lysinibacillus fusiformis ZC1]
          Length = 217

 Score =  261 bits (666), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 98/213 (46%), Positives = 149/213 (69%), Gaps = 1/213 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI  R+G+   W S+W+A   +Y  LLHED+K+R+Y++  LK A V+K+ IER 
Sbjct: 1   MGQKVHPIGLRVGIIRDWESKWYAE-KDYATLLHEDIKVRKYIETALKDASVSKVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                I +++A+PG++IGK GT++E +RK LS++T   +H+++ E+ + +++A L+A++I
Sbjct: 60  ANRVNITIHTAKPGMVIGKGGTEVENLRKYLSDLTGKRVHINIIEIKRADLDARLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE RV FRRA K+A+Q  +R GA G+K   SGRL GA+++R E Y EG VPL TLRA
Sbjct: 120 ARQLENRVSFRRAQKQAIQRTIRAGAKGIKTQVSGRLGGADIARAEHYSEGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDS 213
            IDY  A A+T YG  G+KV++   + +    S
Sbjct: 180 DIDYAHAEADTTYGKLGVKVWIYRGEVLPTKKS 212


>gi|226309814|ref|YP_002769708.1| 30S ribosomal protein S3 [Brevibacillus brevis NBRC 100599]
 gi|254764515|sp|C0ZII6|RS3_BREBN RecName: Full=30S ribosomal protein S3
 gi|226092762|dbj|BAH41204.1| 30S ribosomal protein S3 [Brevibacillus brevis NBRC 100599]
          Length = 220

 Score =  261 bits (666), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 97/212 (45%), Positives = 152/212 (71%), Gaps = 1/212 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P+  R+GV   W S+W+A   ++  LLHEDLKIR+Y++  LK A V+ I IER 
Sbjct: 1   MGQKVSPVGLRIGVIRDWESKWYAD-KDFATLLHEDLKIRKYVKGRLKDAAVSTIEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                + +++A+PG++IGK G+++E +RK L+++T   +H+++NE+ +P+++ATL+A++I
Sbjct: 60  ANRVNVTIHTAKPGMVIGKGGSEVETLRKTLTDLTGKRVHININEIKRPDLDATLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE R+ FRRA K+++   +R GA G+K + SGRL GA+++R+E Y EG VPL TLRA
Sbjct: 120 ARQLENRISFRRAQKQSITRTLRSGAKGIKTLVSGRLGGADIARSEGYSEGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSD 212
            IDYGTA A T YG  G+KV++   + +    
Sbjct: 180 DIDYGTAEAHTTYGRIGVKVWIYRGEVLPARK 211


>gi|254822781|ref|ZP_05227782.1| 30S ribosomal protein S3 [Mycobacterium intracellulare ATCC 13950]
          Length = 227

 Score =  261 bits (666), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 102/215 (47%), Positives = 143/215 (66%), Gaps = 2/215 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP  FRLG+   W SRW+A   +Y   + ED+ IR  L   L++AG+A + IERT
Sbjct: 1   MGQKINPHGFRLGITTDWKSRWYAD-KQYSDYVKEDVAIRRLLSTGLERAGIADVEIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG++GT+ ++IR  L  +T  ++ L++ EV  PE  A L+AQ +
Sbjct: 60  RDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTGKQVQLNILEVRNPESQAQLVAQGV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAM-RFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           A+QL  RV FRRAM++A+QSAM +    G++V  SGRL GAE+SR+E Y EGRVPL TLR
Sbjct: 120 AEQLSNRVAFRRAMRKAIQSAMRQPNVKGIRVQCSGRLGGAEMSRSEFYREGRVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDST 214
           A IDYG   A+T +G  G+KV++   D V      
Sbjct: 180 ADIDYGLYEAKTTFGRIGVKVWIYKGDIVGGKREL 214


>gi|255319809|ref|ZP_05361014.1| ribosomal protein S3 [Acinetobacter radioresistens SK82]
 gi|262380342|ref|ZP_06073496.1| ribosomal protein S3 [Acinetobacter radioresistens SH164]
 gi|255303128|gb|EET82340.1| ribosomal protein S3 [Acinetobacter radioresistens SK82]
 gi|262297788|gb|EEY85703.1| ribosomal protein S3 [Acinetobacter radioresistens SH164]
          Length = 250

 Score =  261 bits (666), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 112/228 (49%), Positives = 159/228 (69%), Gaps = 2/228 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI  RLGV    N+ W+A   +Y   L +DL++RE+L   LK A ++ ILIER 
Sbjct: 1   MGQKVHPIGIRLGVVKRHNANWYANPKQYAEYLLKDLQVREFLTKKLKSAMISNILIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               ++ + +ARPG++IGKKG DIEK++++L+N+      +S+NE+ +P+++A L+A++I
Sbjct: 61  TGAAKVTISTARPGIVIGKKGEDIEKLQRELTNIMGVPAQVSINEIDRPDLDARLVAEAI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLE+RV+FRRAMKRAVQ+ MR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 ASQLEKRVMFRRAMKRAVQNTMRAGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD-SDSTIPA-AEHRVVEKD 226
            IDY T  AET YG+ G+KV++   + +        PA AE R  ++ 
Sbjct: 181 DIDYATMRAETTYGTIGVKVWIFRGEILGGMKQVMNPAPAEERPAKRG 228


>gi|212634835|ref|YP_002311360.1| 30S ribosomal protein S3 [Shewanella piezotolerans WP3]
 gi|212556319|gb|ACJ28773.1| Ribosomal protein S3 [Shewanella piezotolerans WP3]
          Length = 229

 Score =  260 bits (665), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 109/226 (48%), Positives = 155/226 (68%), Gaps = 4/226 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   W S W+A  S+Y   L  D ++R++L+  LKQA V+KI+IER 
Sbjct: 1   MGQKVHPNGIRLGITKPWISTWYADKSDYANNLSSDWEVRKFLEKKLKQASVSKIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  ++ +T +   +++ E+ KPE++A L+A  I
Sbjct: 61  AKSVRVTIHTARPGVVIGKKGEDVEKLRNAVAKLTGTPAQINIAEIRKPELDAKLVADGI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDE----VSDSDSTIPAAEHRV 222
            IDY T+ + T YG  G+KV+V   +     V   +      + + 
Sbjct: 181 DIDYSTSESHTQYGVIGVKVWVFKGEVLDGIVPQHEEPKQQPKRKP 226


>gi|50086209|ref|YP_047719.1| 30S ribosomal protein S3 [Acinetobacter sp. ADP1]
 gi|61215530|sp|Q6F7R8|RS3_ACIAD RecName: Full=30S ribosomal protein S3
 gi|49532185|emb|CAG69897.1| 30S ribosomal protein S3 [Acinetobacter sp. ADP1]
          Length = 250

 Score =  260 bits (665), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 111/226 (49%), Positives = 157/226 (69%), Gaps = 1/226 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI  RLGV    N+ W+A   +Y   L +DL++RE+L   LK A V+ ILIER 
Sbjct: 1   MGQKVHPIGIRLGVVKRHNANWYANPKQYAEYLLKDLQVREFLTKKLKSAMVSNILIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               ++ + +ARPG++IGKKG DIEK++++L+N+      +S+NE+ +P+++A L+A++I
Sbjct: 61  TGAAKVTISTARPGIVIGKKGEDIEKLQRELTNIMGVPAQVSINEIDRPDLDARLVAEAI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLE+RV+FRRAMKRAVQ++MR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 ASQLEKRVMFRRAMKRAVQNSMRAGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD-SDSTIPAAEHRVVEK 225
            IDY T  AET YG+ G+KV++   + +        PA +     K
Sbjct: 181 DIDYATMRAETTYGTIGVKVWIFRGEILGGMKQVMNPAPQEERPAK 226


>gi|157960020|ref|YP_001500054.1| 30S ribosomal protein S3 [Shewanella pealeana ATCC 700345]
 gi|167626033|ref|YP_001676327.1| 30S ribosomal protein S3 [Shewanella halifaxensis HAW-EB4]
 gi|157845020|gb|ABV85519.1| ribosomal protein S3 [Shewanella pealeana ATCC 700345]
 gi|167356055|gb|ABZ78668.1| ribosomal protein S3 [Shewanella halifaxensis HAW-EB4]
          Length = 229

 Score =  260 bits (665), Expect = 9e-68,   Method: Composition-based stats.
 Identities = 108/226 (47%), Positives = 154/226 (68%), Gaps = 4/226 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   W S W+A  S+Y   L  D ++R++L+  LKQA V+KI+IER 
Sbjct: 1   MGQKVHPNGIRLGITKPWISTWYADKSDYANNLSSDWEVRKFLEKKLKQASVSKIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  ++ +T     +++ E+ KPE++A L+A  I
Sbjct: 61  AKSVRVTIHTARPGVVIGKKGEDVEKLRNAVAKLTGIPAQINIAEIRKPELDAKLVADGI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRD----EVSDSDSTIPAAEHRV 222
            IDY T+ + T YG  G+KV+V   +     +   +      + + 
Sbjct: 181 DIDYSTSESHTQYGVIGVKVWVFKGEVLDGVLPQHEEPKQQPKRKP 226


>gi|90962400|ref|YP_536316.1| 30S ribosomal protein S3 [Lactobacillus salivarius UCC118]
 gi|227891550|ref|ZP_04009355.1| 30S ribosomal protein S3 [Lactobacillus salivarius ATCC 11741]
 gi|301300212|ref|ZP_07206424.1| ribosomal protein S3 [Lactobacillus salivarius ACS-116-V-Col5a]
 gi|123086755|sp|Q1WS96|RS3_LACS1 RecName: Full=30S ribosomal protein S3
 gi|90821594|gb|ABE00233.1| SSU ribosomal protein S3P [Lactobacillus salivarius UCC118]
 gi|227866697|gb|EEJ74118.1| 30S ribosomal protein S3 [Lactobacillus salivarius ATCC 11741]
 gi|300215028|gb|ADJ79444.1| 30S ribosomal protein S3 [Lactobacillus salivarius CECT 5713]
 gi|300852153|gb|EFK79825.1| ribosomal protein S3 [Lactobacillus salivarius ACS-116-V-Col5a]
          Length = 218

 Score =  260 bits (665), Expect = 9e-68,   Method: Composition-based stats.
 Identities = 97/219 (44%), Positives = 150/219 (68%), Gaps = 1/219 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   R+G+   W+++W+A   ++ + LHEDL+IR+Y++  L  A V+ + IER 
Sbjct: 1   MGQKVNPTGLRVGIIRDWDAKWYAE-KDFASNLHEDLRIRKYIESKLADASVSTVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K   I +++A+PG++IGK G+++EK+RK+L+N+T   +H+++ E+ KP+++A L+ +SI
Sbjct: 60  AKRVNISIHTAKPGMVIGKGGSEVEKLRKELNNLTGKRVHINIVEIKKPDLDAKLVGESI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE RV FRRAMK+A+Q  MR GA G+KV  +GRLNGA++SR E + EG VPL TLRA
Sbjct: 120 AEQLENRVAFRRAMKQAIQRTMRAGAKGIKVQVAGRLNGADMSRVERFSEGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
            IDY    A T YG  G+K ++   + +          +
Sbjct: 180 DIDYSWVEAHTTYGKLGVKTWIYRGEVLPAKKENSKGGK 218


>gi|325288584|ref|YP_004264765.1| SSU ribosomal protein S3P [Syntrophobotulus glycolicus DSM 8271]
 gi|324963985|gb|ADY54764.1| SSU ribosomal protein S3P [Syntrophobotulus glycolicus DSM 8271]
          Length = 220

 Score =  260 bits (665), Expect = 9e-68,   Method: Composition-based stats.
 Identities = 100/221 (45%), Positives = 151/221 (68%), Gaps = 2/221 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   R+GV  +W  RW+A    YG LLHEDL+IR+++   L+QAGV K+ IER 
Sbjct: 1   MGQKVNPNGLRIGVIRSWEGRWYAD-KNYGDLLHEDLQIRKFVVQKLQQAGVPKVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTN-SEIHLSVNEVPKPEINATLIAQS 119
               ++ +++A+PG++IG+ GT++E +R+ L  +T   ++ +++ E+ KPE++A L+A+S
Sbjct: 60  ANRVKVSIHAAKPGIVIGRGGTEVENLRRDLEKLTGGKQVAVNIVEIKKPELDAKLVAES 119

Query: 120 IAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           +AQQL++RV FRRAMK+ V   +R G  G+K+  SGRL GAE++RTE Y EG+VPL TLR
Sbjct: 120 VAQQLKKRVSFRRAMKQTVGRTIRAGGQGIKISCSGRLGGAEIARTEWYNEGKVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEH 220
           A IDYG A A+T YG  G+KV++   + +    +       
Sbjct: 180 ADIDYGFAEADTTYGKIGVKVWIYKGEVLPTKKAAQEEGGK 220


>gi|299143188|ref|ZP_07036268.1| ribosomal protein S3 [Peptoniphilus sp. oral taxon 386 str. F0131]
 gi|298517673|gb|EFI41412.1| ribosomal protein S3 [Peptoniphilus sp. oral taxon 386 str. F0131]
          Length = 253

 Score =  260 bits (665), Expect = 9e-68,   Method: Composition-based stats.
 Identities = 93/225 (41%), Positives = 146/225 (64%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   R+G+   W+S+W+A    +  LL ED KIR+Y++  L  AG++K+ IER 
Sbjct: 1   MGQKVNPHGLRVGIIKDWDSKWYANKKNFADLLVEDNKIRKYIKKKLYTAGISKVEIERA 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               ++ + +A+PG++IG+ G  +E++R +L  +T   + L++ E+   ++++ L+A++I
Sbjct: 61  ANKVKVSISTAKPGMVIGRGGVGVEELRTELEKLTKKSVVLNIEEIKNQDLDSQLVAEAI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+ LERRV FRRAMK+A+Q  MR GA G+K   SGRL GA+++RTE Y EG +PLQTLRA
Sbjct: 121 AESLERRVSFRRAMKQAIQRTMRAGALGIKTAVSGRLGGADMARTEGYSEGTIPLQTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDYG A A+T YG  G+KV++   + + +              +
Sbjct: 181 DIDYGFAEADTTYGKLGVKVWLYKGEVLPEKKDEKKNNRDNKRRR 225


>gi|222148372|ref|YP_002549329.1| 30S ribosomal protein S3 [Agrobacterium vitis S4]
 gi|221735360|gb|ACM36323.1| 30S ribosomal protein S3 [Agrobacterium vitis S4]
          Length = 226

 Score =  260 bits (665), Expect = 9e-68,   Method: Composition-based stats.
 Identities = 144/215 (66%), Positives = 174/215 (80%), Gaps = 3/215 (1%)

Query: 13  GVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERTHKNCRIIVYSAR 72
           G+N TW+SRWFA  +EYG LLHEDLKIR YL   LKQAG+AK++IER HK CR+ ++SAR
Sbjct: 2   GINRTWDSRWFADNAEYGKLLHEDLKIRAYLMDELKQAGIAKVVIERPHKKCRVTIHSAR 61

Query: 73  PGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSIAQQLERRVVFRR 132
           PGLIIGKKG DIEK+RKKLS MTNSE HL++ EV KPE++ATL+AQSIAQQLERR+ FRR
Sbjct: 62  PGLIIGKKGADIEKLRKKLSEMTNSETHLNIVEVRKPEVDATLVAQSIAQQLERRIAFRR 121

Query: 133 AMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRAHIDYGTAVAETA 192
           AMKRAVQSAMR GA+G+K+  +GRL GAE++RTE Y EGRVPL TLRA IDYG A A TA
Sbjct: 122 AMKRAVQSAMRLGAEGIKITCAGRLGGAEIARTEWYREGRVPLHTLRADIDYGVAEATTA 181

Query: 193 YGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
           YG CGIKV++  + E+ + D    A+E R +E D+
Sbjct: 182 YGICGIKVWIF-KGEILEHDPM--ASERRALESDA 213


>gi|311744803|ref|ZP_07718599.1| 30S ribosomal protein S3 [Aeromicrobium marinum DSM 15272]
 gi|311311920|gb|EFQ81841.1| 30S ribosomal protein S3 [Aeromicrobium marinum DSM 15272]
          Length = 276

 Score =  260 bits (665), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 96/207 (46%), Positives = 147/207 (71%), Gaps = 1/207 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP  FRLG++    SRW+A    Y + + ED+KIR+ L   + +AG++++ IERT
Sbjct: 1   MGQKINPHGFRLGISTDHKSRWYAD-KLYSSYVGEDVKIRKLLTKGMDRAGISRVEIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG++G + ++IR  L  +T  ++ L++ EV +PE++A L+AQ +
Sbjct: 60  RDRVRVDIHTARPGIVIGRRGAEADRIRGDLEKLTGKQVQLNILEVKQPEMDAQLVAQGV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QL  RV FRRAM++A+Q+ MR GA G+++  SGRL GAE+SR+E Y EGRVPL TLRA
Sbjct: 120 AEQLSGRVQFRRAMRKAMQTTMRSGAKGIRIQCSGRLGGAEMSRSEFYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDE 207
            +DYG   A+T +G  G+KV++   + 
Sbjct: 180 DVDYGFYEAKTTFGRIGVKVWIYKGEV 206


>gi|254455646|ref|ZP_05069075.1| ribosomal protein S3 [Candidatus Pelagibacter sp. HTCC7211]
 gi|207082648|gb|EDZ60074.1| ribosomal protein S3 [Candidatus Pelagibacter sp. HTCC7211]
          Length = 226

 Score =  260 bits (665), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 108/208 (51%), Positives = 151/208 (72%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP+ FRLGVN  W+S W+A+  ++G  L ED KIREY++ ++  +GV+K++IERT
Sbjct: 1   MGQKVNPVGFRLGVNRGWDSVWYAKKKDFGNYLIEDFKIREYIKKNVINSGVSKVMIERT 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
              C + +Y++RPG +IGKKG+DI+KI+  LS  T +E+ L++ EV KPE NA L+A++I
Sbjct: 61  SNKCYVTIYTSRPGFVIGKKGSDIDKIKNNLSKFTTNEVALNIKEVKKPETNAYLVAENI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQL +R+ +RRAMKRA+QS +R GA G+KV  SGRL G E++RTE   +G +P  TLRA
Sbjct: 121 AQQLVKRISYRRAMKRAMQSCIRLGARGIKVSVSGRLGGNEIARTEWLRDGSIPSHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEV 208
            IDY  A A T YG  GIKV++   +  
Sbjct: 181 DIDYAEAEALTTYGIIGIKVWIYKGEVF 208


>gi|255326848|ref|ZP_05367924.1| ribosomal protein S3 [Rothia mucilaginosa ATCC 25296]
 gi|283457551|ref|YP_003362134.1| 30S ribosomal protein S3 [Rothia mucilaginosa DY-18]
 gi|255296065|gb|EET75406.1| ribosomal protein S3 [Rothia mucilaginosa ATCC 25296]
 gi|283133549|dbj|BAI64314.1| ribosomal protein S3 [Rothia mucilaginosa DY-18]
          Length = 265

 Score =  260 bits (665), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 109/222 (49%), Positives = 156/222 (70%), Gaps = 5/222 (2%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSE----YGALLHEDLKIREYLQCHLKQAGVAKIL 56
           MGQKI+P  FRLG+     S+WFA  ++    Y   + ED+KIRE L  +L +AGVAK+ 
Sbjct: 1   MGQKIHPNGFRLGITTDHVSKWFADSNKPGERYADFVREDVKIRELLAKNLDRAGVAKVE 60

Query: 57  IERTHKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLI 116
           IERT    R+ +++ARPG++IG++G + ++IR +L  +TN +I L++ EV  P+++A L+
Sbjct: 61  IERTRDRVRVDIHTARPGIVIGRRGAEADRIRGELEKLTNKQIQLNILEVANPDLSAQLV 120

Query: 117 AQSIAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQ 176
           AQSIA+QL  RV FRRAMK+A+QSA R GA G+++  SGRL GAE+SR+E Y EGRVPL 
Sbjct: 121 AQSIAEQLASRVAFRRAMKKAIQSAQRAGAKGIRIQCSGRLGGAEMSRSEFYREGRVPLH 180

Query: 177 TLRAHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAA 218
           TLRA+IDYG   A+T +G  G+KV++   D ++D +     A
Sbjct: 181 TLRANIDYGFFEAKTTFGRIGVKVWIYKGD-LTDKELAAQQA 221


>gi|221194416|ref|ZP_03567473.1| ribosomal protein S3 [Atopobium rimae ATCC 49626]
 gi|221185320|gb|EEE17710.1| ribosomal protein S3 [Atopobium rimae ATCC 49626]
          Length = 235

 Score =  260 bits (665), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 107/222 (48%), Positives = 152/222 (68%), Gaps = 4/222 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+ P  FRLGV   W SRW+A    Y   L  DL IR YL+  L++A +A+I IER 
Sbjct: 1   MGQKVQPTGFRLGVTENWRSRWYAD-KNYAENLGNDLAIRSYLEKRLEKAAIARIDIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDI---EKIRKKLSNMTNSEIHLSVNEVPKPEINATLIA 117
               ++ ++SARPG++IGKKG +I       ++++ +   ++++ V EV +PE++A L+A
Sbjct: 60  GDKVKVTIFSARPGIVIGKKGAEIDGLRADLERVAKVGKGQVNVDVIEVKRPELDANLVA 119

Query: 118 QSIAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQT 177
           +SIA+QLE+RV FRRAM++AVQSA + GA G+++  SGRLNGAE+ R E Y EGRVPL T
Sbjct: 120 ESIAEQLEQRVAFRRAMRKAVQSARKAGAKGIRIQCSGRLNGAEMGRREWYREGRVPLHT 179

Query: 178 LRAHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
           LRA + YGTA A T  G+CGIKV++ L +++    +  PA E
Sbjct: 180 LRAVVAYGTATARTTMGACGIKVWIYLGEKMPGQPAPNPALE 221


>gi|325000486|ref|ZP_08121598.1| ribosomal protein S3 [Pseudonocardia sp. P1]
          Length = 230

 Score =  260 bits (664), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 104/220 (47%), Positives = 149/220 (67%), Gaps = 2/220 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP  FRLG+   W SRW+A   +Y   + ED++IR+ L   +++AG++K+ IERT
Sbjct: 1   MGQKINPHGFRLGITTDWKSRWYAD-KQYSEYVKEDVEIRKMLSKGMERAGISKVEIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG++G + ++IR  L  +T  ++ L++ EV   E +A L+AQ +
Sbjct: 60  RDRVRVDIHTARPGIVIGRRGAEADRIRGNLEKLTKKQVQLNILEVKASESDAQLVAQGV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMR-FGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           A+QL  RV FRRAM++A+QSAMR     G++V  SGRL GAE+SR+E Y EGRVPL TLR
Sbjct: 120 AEQLSNRVAFRRAMRKAIQSAMRSPQVKGIRVQCSGRLGGAEMSRSEFYREGRVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
           A IDYG   A T++G  G+KV++   D V       PAAE
Sbjct: 180 ADIDYGLFEARTSFGRIGVKVWIYKGDVVGGRREGAPAAE 219


>gi|319955862|ref|YP_004167125.1| SSU ribosomal protein s3p [Nitratifractor salsuginis DSM 16511]
 gi|319418266|gb|ADV45376.1| SSU ribosomal protein S3P [Nitratifractor salsuginis DSM 16511]
          Length = 230

 Score =  260 bits (664), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 112/224 (50%), Positives = 153/224 (68%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI  RLG+N  W SRW+       + + ED KIR++L+  L  AGV+ I+IERT
Sbjct: 1   MGQKVNPIGLRLGINRNWESRWYPAKDRAPSFVAEDHKIRKFLKKELFFAGVSNIIIERT 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K  RI + +ARPG+IIGK+G DIEK++ KL  M   ++ +++ E  +P+ +A L A++I
Sbjct: 61  VKKIRITIVTARPGIIIGKRGADIEKLKAKLQKMLGKDVAINIKEEKRPQASAQLAAENI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV FRRAMK+A+Q A++ GA G+KV  SGRL GAE++RTE YLEGRVPL TLRA
Sbjct: 121 ATQLERRVAFRRAMKKAIQGALKSGAKGIKVQVSGRLGGAEMARTEWYLEGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVE 224
            IDYG A A T YG+ G+KV++   + +       P  E +  +
Sbjct: 181 KIDYGFAEALTTYGNIGVKVWIFKGEVLQKGIQPEPKEERKSRK 224


>gi|254776901|ref|ZP_05218417.1| 30S ribosomal protein S3 [Mycobacterium avium subsp. avium ATCC
           25291]
          Length = 224

 Score =  260 bits (664), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 102/215 (47%), Positives = 143/215 (66%), Gaps = 2/215 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP  FRLG+   W SRW+A   +Y   + ED+ IR  L   L++AG+A + IERT
Sbjct: 1   MGQKINPHGFRLGITTDWKSRWYAD-KQYADYVKEDVAIRRLLSTGLERAGIADVEIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG++GT+ ++IR  L  +T  ++ L++ EV  PE  A L+AQ +
Sbjct: 60  RDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTGKQVQLNILEVRNPESQAQLVAQGV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAM-RFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           A+QL  RV FRRAM++A+QSAM +    G++V  SGRL GAE+SR+E Y EGRVPL TLR
Sbjct: 120 AEQLSNRVAFRRAMRKAIQSAMRQPNVKGIRVQCSGRLGGAEMSRSEFYREGRVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDST 214
           A IDYG   A+T +G  G+KV++   D V      
Sbjct: 180 ADIDYGLYEAKTTFGRIGVKVWIYKGDVVGGKREL 214


>gi|284992868|ref|YP_003411422.1| 30S ribosomal protein S3 [Geodermatophilus obscurus DSM 43160]
 gi|284066113|gb|ADB77051.1| ribosomal protein S3 [Geodermatophilus obscurus DSM 43160]
          Length = 308

 Score =  260 bits (664), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 95/208 (45%), Positives = 142/208 (68%), Gaps = 2/208 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP  FRLG+   + SRW+A    Y   + ED+ IR+ +   +++AG++K+ IERT
Sbjct: 1   MGQKVNPHGFRLGITTDYKSRWYAD-KLYKDYVKEDVAIRKLMSKGMERAGISKVEIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG++G + ++IR +L  +T  ++ L++ EV  PE +A L+AQ +
Sbjct: 60  RDRVRVDIHTARPGIVIGRRGAEADRIRGELEKLTGKQVQLNILEVKNPEADAQLVAQGV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMR-FGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           A+QL  RV FRRAM++A+QSA R     G++V  SGRL G E+SR+E Y EGRVPL TLR
Sbjct: 120 AEQLSSRVSFRRAMRKAMQSAQRSPQVKGIRVQCSGRLGGTEMSRSEFYREGRVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDE 207
           A+IDYG   A T +G  G+KV++   D 
Sbjct: 180 ANIDYGIYEARTTFGRIGVKVWIYKGDV 207


>gi|226953877|ref|ZP_03824341.1| 30S ribosomal protein S3 [Acinetobacter sp. ATCC 27244]
 gi|294651628|ref|ZP_06728932.1| 30S ribosomal protein S3 [Acinetobacter haemolyticus ATCC 19194]
 gi|226835360|gb|EEH67743.1| 30S ribosomal protein S3 [Acinetobacter sp. ATCC 27244]
 gi|292822477|gb|EFF81376.1| 30S ribosomal protein S3 [Acinetobacter haemolyticus ATCC 19194]
          Length = 250

 Score =  260 bits (664), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 110/226 (48%), Positives = 155/226 (68%), Gaps = 1/226 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI  RLGV    N+ W+A   +Y   L +DL++RE+L   LK A ++ ILIER 
Sbjct: 1   MGQKVHPIGIRLGVVKRHNANWYASPKQYAEYLLKDLQVREFLTKKLKNAMISNILIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               ++ + +ARPG++IGKKG DIEK++++L+N+      +S+NE+ +P+++A L+A++I
Sbjct: 61  TGAAKVTISTARPGIVIGKKGEDIEKLQRELTNIMGVPAQVSINEIDRPDLDARLVAEAI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLE+RV+FRRAMKRAVQ+ MR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 ASQLEKRVMFRRAMKRAVQNTMRAGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD-SDSTIPAAEHRVVEK 225
            IDY T  AET YG+ G+KV++   + +        PA       K
Sbjct: 181 DIDYATMRAETTYGTIGVKVWIFRGEILGGMKQVMNPAPAEERPAK 226


>gi|78776493|ref|YP_392808.1| 30S ribosomal protein S3 [Sulfurimonas denitrificans DSM 1251]
 gi|91207849|sp|Q30TV8|RS3_SULDN RecName: Full=30S ribosomal protein S3
 gi|78497033|gb|ABB43573.1| SSU ribosomal protein S3P [Sulfurimonas denitrificans DSM 1251]
          Length = 241

 Score =  260 bits (664), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 115/226 (50%), Positives = 153/226 (67%), Gaps = 3/226 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI  RLG+N  W SRWF       A L ED KIR YL+  L  AGV+ I+IERT
Sbjct: 1   MGQKVNPIGLRLGINRNWESRWFPNFKTAAAYLGEDHKIRTYLKKELYYAGVSNIVIERT 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K  R+ + +ARPG+IIGKKG+DIEK++  L  +    + +++ E  K +I++ L+A+++
Sbjct: 61  AKRLRVTIIAARPGIIIGKKGSDIEKLKDTLQALVGKPLSVNIKEEKKAQISSQLVAENV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV FRRAMK+ +Q+A R GA G+KV  SGRL GAE++RTE YLEGRVPL TLRA
Sbjct: 121 ATQLERRVAFRRAMKKVMQNAQRGGAKGIKVSVSGRLGGAEMARTEWYLEGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            IDYG A A T YG  G+KV++   + ++     IPA      +K+
Sbjct: 181 KIDYGFAEAHTTYGCIGVKVWIFKGEVLT---KGIPAEVKEEQQKE 223


>gi|94676477|ref|YP_588782.1| ribosomal protein S3 [Baumannia cicadellinicola str. Hc
           (Homalodisca coagulata)]
 gi|123260548|sp|Q1LTD2|RS3_BAUCH RecName: Full=30S ribosomal protein S3
 gi|94219627|gb|ABF13786.1| ribosomal protein S3 [Baumannia cicadellinicola str. Hc
           (Homalodisca coagulata)]
          Length = 233

 Score =  260 bits (664), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 108/219 (49%), Positives = 153/219 (69%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P  FRLG+   WNS W+A   E+   L+ D K+R++L   L +A +++++IER 
Sbjct: 1   MGQKVHPNGFRLGIIKYWNSTWYANKKEFAQYLNSDFKVRQFLASELTKASISRVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ RI +++ARPG+IIGKKG D+EK+RK +S +      +++ EV KPE+NA L+A+SI
Sbjct: 61  AKSIRITIHTARPGIIIGKKGEDVEKLRKSISLIAGVPSQINIAEVRKPELNAKLVAESI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
             Q+ERRV+FRRAMKRAVQ+ +R GA G+KV  SGRL+G E++RTE Y EGRVPL TLRA
Sbjct: 121 VSQIERRVIFRRAMKRAVQNTIRLGAKGIKVEVSGRLSGVEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
            IDY  + A T YG  G+KV++   + +    +  P  E
Sbjct: 181 DIDYHVSEAHTTYGVIGVKVWIFKGEILDGMMAVEPTIE 219


>gi|312135490|ref|YP_004002828.1| 30S ribosomal protein S3 [Caldicellulosiruptor owensensis OL]
 gi|311775541|gb|ADQ05028.1| ribosomal protein S3 [Caldicellulosiruptor owensensis OL]
          Length = 222

 Score =  260 bits (664), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 99/222 (44%), Positives = 149/222 (67%), Gaps = 1/222 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P  FRLG    W+SRWFA   ++   + ED KIR +++  L  AG+++I IER 
Sbjct: 1   MGQKVHPKGFRLGFIRDWDSRWFANDKDFDKYVLEDYKIRRHIKEKLYNAGISRIEIERA 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTN-SEIHLSVNEVPKPEINATLIAQS 119
            K  ++I+++A+PG++IG+ G+ +E +RK+L  +T    I L + E+  PE++A L+A++
Sbjct: 61  AKRVKVIIHTAKPGIVIGRAGSGVEALRKELEKLTGGKTISLDIKEIKVPELDAQLVAEN 120

Query: 120 IAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           IA QLE+RV FR+AMK+A+  A+R GA G+K + SGRL GA+++RTE Y EGR+PLQTLR
Sbjct: 121 IAAQLEKRVSFRKAMKQAMARALRSGAKGIKTMVSGRLGGADIARTEWYKEGRIPLQTLR 180

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHR 221
           A IDYG A A T YG  G+K ++   D +    +       +
Sbjct: 181 ADIDYGFAEAHTTYGRIGVKTWIYKGDILPQKVAASEKGGDK 222


>gi|308233858|ref|ZP_07664595.1| ribosomal protein S3 [Atopobium vaginae DSM 15829]
 gi|328943566|ref|ZP_08241031.1| 30S ribosomal protein S3 [Atopobium vaginae DSM 15829]
 gi|327491535|gb|EGF23309.1| 30S ribosomal protein S3 [Atopobium vaginae DSM 15829]
          Length = 236

 Score =  260 bits (664), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 97/222 (43%), Positives = 147/222 (66%), Gaps = 3/222 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+ P  FRLG+   W SRW+A  + Y   +  DL+IR+YL+  L  A ++++ IER 
Sbjct: 1   MGQKVQPTGFRLGITEQWRSRWYAGKNNYAQNVGSDLEIRKYLKKRLASAALSRVEIERA 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDI---EKIRKKLSNMTNSEIHLSVNEVPKPEINATLIA 117
               ++++ ++RPG++IGKKGT+I    K  +K++ +   ++++ V E+ +P+++A L A
Sbjct: 61  GDKVKVVILTSRPGIVIGKKGTEIDDLRKDVQKIAKVGKGDVNVEVVEIKQPDLDAQLTA 120

Query: 118 QSIAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQT 177
             IA+QLE RV FRRA+++AVQ A + GA G+++  SGRLNGAE+ R E   EGRVPL T
Sbjct: 121 DRIAEQLEGRVAFRRAVRKAVQGATKAGAKGIRIQCSGRLNGAEMGRVEWSREGRVPLHT 180

Query: 178 LRAHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
           LRA IDY  A A T  G+ GIKV++ L +++    +  PA E
Sbjct: 181 LRAKIDYAQATASTTMGAVGIKVWIYLGEKLPGQSAPNPALE 222


>gi|330470167|ref|YP_004407910.1| ribosomal protein S3 [Verrucosispora maris AB-18-032]
 gi|328813138|gb|AEB47310.1| ribosomal protein S3 [Verrucosispora maris AB-18-032]
          Length = 284

 Score =  260 bits (664), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 102/219 (46%), Positives = 149/219 (68%), Gaps = 2/219 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P  FRLG++  W SRWFA    Y   + ED+KIR  +   L++AG++K+ IERT
Sbjct: 1   MGQKVHPHGFRLGISTDWKSRWFAD-KLYKDYIGEDVKIRRMMSKGLERAGISKVDIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG+KG + ++IR +L  +T  ++ L++ EV  PE +A L+AQ +
Sbjct: 60  RDRVRVDIHTARPGIVIGRKGAEADRIRGELEKLTGKQVQLNIIEVKNPESDAQLVAQGV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFG-ADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           A+QL  RV FRRAM++A+QSAM+     G++V  SGRL GAE+SRTE Y EGRVPL TLR
Sbjct: 120 AEQLSSRVSFRRAMRKAMQSAMKNPMCKGIRVQVSGRLGGAEMSRTEFYREGRVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAA 218
           A+I+YG   A T +G  G+KV++   D V   ++   A 
Sbjct: 180 ANIEYGFFEARTTFGRIGVKVWIYKGDAVPGRETPAEAP 218


>gi|262280219|ref|ZP_06058003.1| ribosomal protein S3 [Acinetobacter calcoaceticus RUH2202]
 gi|262257997|gb|EEY76731.1| ribosomal protein S3 [Acinetobacter calcoaceticus RUH2202]
          Length = 250

 Score =  260 bits (664), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 111/226 (49%), Positives = 158/226 (69%), Gaps = 2/226 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI  RLGV    N+ W+A   +Y   L +DL++RE+L   LK A ++ ILIER 
Sbjct: 1   MGQKVHPIGIRLGVVKRHNANWYASPKQYAEYLLKDLQVREFLNKKLKNAMISNILIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               ++ + +ARPG++IGKKG DIEK++++L+++      +S+NE+ +P+++A L+A++I
Sbjct: 61  SGAAKVTISTARPGIVIGKKGEDIEKLQRELTSIMGVPAQVSINEIDRPDLDARLVAEAI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLE+RV+FRRAMKRAVQ+ MR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 ASQLEKRVMFRRAMKRAVQNTMRAGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD-SDSTIPA-AEHRVVE 224
            IDY T  AET YG+ G+KV++   + +        PA AE R  +
Sbjct: 181 DIDYATVRAETTYGTIGVKVWIFRGEILGGMKQVMNPAPAEDRPAK 226


>gi|291280142|ref|YP_003496977.1| 30S ribosomal protein S3 [Deferribacter desulfuricans SSM1]
 gi|290754844|dbj|BAI81221.1| 30S ribosomal protein S3 [Deferribacter desulfuricans SSM1]
          Length = 224

 Score =  260 bits (664), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 113/216 (52%), Positives = 158/216 (73%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI FRLG+N  W S WF    EY   L EDLKIR++L+  LKQAG++ I IER 
Sbjct: 1   MGQKVHPIGFRLGINKDWKSVWFFGKKEYREKLMEDLKIRDFLKKRLKQAGLSNIQIERM 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               RII+ ++RPG++IGKKG +IE ++K+L  +T++++ + + EV KPEI+A L+A+++
Sbjct: 61  GSKVRIILNTSRPGIVIGKKGAEIENLKKELRKLTDNDVIIVIREVKKPEIDAQLVAENV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A Q+ERRV FRRAMK+AV  A++ GA G+K+  SGRL GAE++RTE Y++GRVPLQTLRA
Sbjct: 121 AMQIERRVAFRRAMKKAVLQALKGGAQGIKIACSGRLAGAEMARTEWYIKGRVPLQTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIP 216
            IDYG A A+T YG  G+KV++   + V + D    
Sbjct: 181 DIDYGFAEAQTTYGIIGVKVWIFKGEIVENKDKIAA 216


>gi|262203618|ref|YP_003274826.1| 30S ribosomal protein S3 [Gordonia bronchialis DSM 43247]
 gi|262086965|gb|ACY22933.1| ribosomal protein S3 [Gordonia bronchialis DSM 43247]
          Length = 272

 Score =  260 bits (664), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 101/215 (46%), Positives = 143/215 (66%), Gaps = 2/215 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP  FRLG+   W SRW+A   +Y   + ED+ IR+ L   L++AG+AK+ IERT
Sbjct: 1   MGQKINPHGFRLGITTDWKSRWYAD-KQYADYVKEDVAIRKLLSQGLERAGIAKVEIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG++G + ++IR  L  +T  ++ L++ EV   E  A L+AQ +
Sbjct: 60  RDRVRVDIHTARPGIVIGRRGAEADRIRGDLEKLTGKQVQLNILEVKNAESEAQLVAQGV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAM-RFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           A+QL  RV FRRAM++A+QSAM +    G++V  SGRL GAE+SR+E Y EGRVPL TLR
Sbjct: 120 AEQLSNRVAFRRAMRKAIQSAMRQPNVKGIRVQCSGRLGGAEMSRSEFYREGRVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDST 214
           A IDYG   A+T +G  G+KV++   D V      
Sbjct: 180 ADIDYGLYEAKTTFGRIGVKVWIYKGDIVGGRREL 214


>gi|312622051|ref|YP_004023664.1| 30S ribosomal protein S3 [Caldicellulosiruptor kronotskyensis 2002]
 gi|312202518|gb|ADQ45845.1| ribosomal protein S3 [Caldicellulosiruptor kronotskyensis 2002]
          Length = 222

 Score =  260 bits (664), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 98/222 (44%), Positives = 150/222 (67%), Gaps = 1/222 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P  FR+G+   W+SRWFA   ++   + ED KIR +++  L  AG+++I IER 
Sbjct: 1   MGQKVHPKGFRIGIIRDWDSRWFANDKDFQKYVLEDYKIRRHIKEKLYHAGISRIEIERA 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTN-SEIHLSVNEVPKPEINATLIAQS 119
            K  ++I+++A+PG++IG+ G+ +E +RK+L  +T    I L + E+  PE++A L+A++
Sbjct: 61  AKRVKVIIHTAKPGIVIGRAGSGVEALRKELEKLTGGKTISLDIKEIKVPELDAQLVAEN 120

Query: 120 IAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           IA QLE+RV FR+AMK+A+  A+R GA G+K + SGRL GA+++RTE Y EGR+PLQTLR
Sbjct: 121 IAAQLEKRVSFRKAMKQAMARALRSGAKGIKTMVSGRLGGADIARTEWYKEGRIPLQTLR 180

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHR 221
           A IDYG A A T YG  G+K ++   D +    +       +
Sbjct: 181 ADIDYGFAEAHTTYGRIGVKTWIYKGDILPQKAAASEKGGDK 222


>gi|238018629|ref|ZP_04599055.1| hypothetical protein VEIDISOL_00464 [Veillonella dispar ATCC 17748]
 gi|237865100|gb|EEP66390.1| hypothetical protein VEIDISOL_00464 [Veillonella dispar ATCC 17748]
          Length = 221

 Score =  260 bits (664), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 98/219 (44%), Positives = 155/219 (70%), Gaps = 1/219 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   R+G+   W+++W+A   ++ A LHED+KIR +L+  L  AG+++I IERT
Sbjct: 1   MGQKVNPHGLRVGIVKDWDAKWYAD-KDFAANLHEDVKIRNFLKETLFIAGISRIEIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           +K  ++ +++A+PG++IG+ G  IE I+K ++  T+ ++ +++ E+ + +++A L+A++I
Sbjct: 60  NKRIKLTIHTAKPGMVIGRGGAGIEDIKKAMTRFTDKQVDVNIAEIKQADMDAILVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERR+ FRRAMK+AV   MR GA G+K++ SGRL GAE++R+E Y EG +PL TLRA
Sbjct: 120 AGQLERRIGFRRAMKQAVGRTMRLGAKGIKIMVSGRLGGAEIARSESYREGSIPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
            IDYGTA A T YG  GIKV++   + + ++       E
Sbjct: 180 DIDYGTAEAHTTYGCIGIKVWIYKGEVLPEAKQPAKKEE 218


>gi|302336376|ref|YP_003801583.1| SSU ribosomal protein S3P [Olsenella uli DSM 7084]
 gi|301320216|gb|ADK68703.1| SSU ribosomal protein S3P [Olsenella uli DSM 7084]
          Length = 236

 Score =  260 bits (664), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 101/222 (45%), Positives = 150/222 (67%), Gaps = 3/222 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+ P  FRLG+   W SRW+A   +Y   L  DL+IR +L+  L  A ++++ IER 
Sbjct: 1   MGQKVQPTGFRLGITEEWRSRWYADKKDYAKSLGNDLEIRRFLEKRLASAALSRVDIERA 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNM---TNSEIHLSVNEVPKPEINATLIA 117
               ++++Y+ARPG++IGKKG +I+ +R  L  +       I++ V EV +PE++A L+A
Sbjct: 61  GDKVKVVIYTARPGIVIGKKGAEIDALRADLQKLAGVDKGNINVDVIEVKRPELDAQLVA 120

Query: 118 QSIAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQT 177
           +SIA+QLE R+ FRRA+++A+QSA + GA G+++  SGRLNGAE+ R E   EGRVPL T
Sbjct: 121 RSIAEQLEGRIAFRRAVRKAIQSARKAGAKGIRIQCSGRLNGAEMGRREWSREGRVPLHT 180

Query: 178 LRAHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
           LRA I +GTA A T  G+CG+KV++ L +++    +  PA E
Sbjct: 181 LRARIGFGTATARTTMGACGVKVWIYLGEKLPGQPAPNPALE 222


>gi|299820961|ref|ZP_07052850.1| 30S ribosomal protein S3 [Listeria grayi DSM 20601]
 gi|299817982|gb|EFI85217.1| 30S ribosomal protein S3 [Listeria grayi DSM 20601]
          Length = 218

 Score =  260 bits (664), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 92/219 (42%), Positives = 148/219 (67%), Gaps = 1/219 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI  R+G+   W+S+W+A   +Y   LHEDL+IR+++   L  A V+++ IER 
Sbjct: 1   MGQKVHPIGMRIGIIRDWDSKWYAE-KDYADFLHEDLRIRDHITKRLADASVSRVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                I +++A+PG++IGK G+++E +RK L+++T   +H+++ E+ + +++A L+A++I
Sbjct: 60  ANRVNITIHTAKPGMVIGKGGSEVEALRKNLNDLTGKRVHINIVEIKRADLDAKLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE RV FRRA K+A+Q  MR GA G+K   SGRL GA+++R E Y EG VPL TLRA
Sbjct: 120 ARQLEGRVSFRRAQKQAIQRTMRAGAKGIKTQVSGRLGGADIARAEHYSEGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
            IDY    A+T YG  G+KV++   + +    + +   +
Sbjct: 180 DIDYAWEEADTTYGKLGVKVWIYRGEVLPTKKNNVEGGK 218


>gi|169335635|ref|ZP_02862828.1| hypothetical protein ANASTE_02055 [Anaerofustis stercorihominis DSM
           17244]
 gi|169258373|gb|EDS72339.1| hypothetical protein ANASTE_02055 [Anaerofustis stercorihominis DSM
           17244]
          Length = 213

 Score =  260 bits (664), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 100/211 (47%), Positives = 148/211 (70%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   R+GV   W+SRW+A+  ++G  L ED  IR+Y++      G+++I IER 
Sbjct: 1   MGQKVNPHGLRVGVIKDWSSRWYAKDKDFGDTLVEDYNIRKYIKTTQYNTGISRIEIERF 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +  +I +Y+ +PG IIGK G+ IE +RK+L  MT   +++++ EV   + +A L+A++I
Sbjct: 61  GEKIKIFIYTGKPGKIIGKAGSGIEAVRKQLQKMTGKNVYINIIEVKNVDCDAQLVAENI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERR+ FRRAMK+A+  A+R GA+G+K   SGR+NGAE++RTE Y +G VPLQTLRA
Sbjct: 121 AQQLERRISFRRAMKQAIGRALRGGAEGIKTSVSGRVNGAEMARTEQYSDGNVPLQTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDS 211
            IDYG A A+T YG  G+KV+++  + +   
Sbjct: 181 DIDYGFAEADTTYGKIGVKVWINKGEVLPTK 211


>gi|306966729|ref|ZP_07479390.1| ribosomal protein S3 [Mycobacterium tuberculosis SUMu009]
 gi|308355583|gb|EFP44434.1| ribosomal protein S3 [Mycobacterium tuberculosis SUMu009]
          Length = 277

 Score =  259 bits (663), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 101/215 (46%), Positives = 142/215 (66%), Gaps = 2/215 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP  FRLG+   W SRW+A   +Y   + ED+ IR  L   L++AG+A + IERT
Sbjct: 1   MGQKINPHGFRLGITTDWKSRWYAD-KQYAEYVKEDVAIRRLLSSGLERAGIADVEIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG++GT+ ++IR  L  +T  ++ L++ EV  PE  A L+AQ +
Sbjct: 60  RDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTGKQVQLNILEVKNPESQAQLVAQGV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAM-RFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           A+QL  RV FRRAM++A+QSAM +    G++V  SGRL GAE+ R+E Y EGRVPL TLR
Sbjct: 120 AEQLSNRVAFRRAMRKAIQSAMRQPNVKGIRVQCSGRLGGAEMRRSEFYREGRVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDST 214
           A IDYG   A+T +G  G+KV++   D V      
Sbjct: 180 ADIDYGLYEAKTTFGRIGVKVWIYKGDIVGGKREL 214


>gi|268316414|ref|YP_003290133.1| 30S ribosomal protein S3 [Rhodothermus marinus DSM 4252]
 gi|262333948|gb|ACY47745.1| ribosomal protein S3 [Rhodothermus marinus DSM 4252]
          Length = 249

 Score =  259 bits (663), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 110/217 (50%), Positives = 160/217 (73%), Gaps = 1/217 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK +PI FRLGV   W S W+A   +    L ED +IR YLQ  LK+AG+++++IERT
Sbjct: 1   MGQKTHPIGFRLGVIRGWFSSWYAE-KDLPEKLIEDEEIRRYLQARLKRAGLSRVVIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K   + ++++RPG++IG+ G ++EK+R++L  +T  EI ++++E+ +PE++A+L+AQ+I
Sbjct: 60  PKRVILTLHTSRPGVVIGRGGQEVEKLREELQKLTGKEIQINISEIKRPELDASLVAQNI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLE RV FRRAMK+A+ +AMR GA G+++  SGRL GAE+SRTE YLEGRVPL TLRA
Sbjct: 120 AQQLEGRVSFRRAMKQAITAAMRMGAQGIRIKVSGRLGGAEMSRTEQYLEGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPA 217
           +IDY  A A T YG+ G+KV++ L + +   D +  A
Sbjct: 180 NIDYAQATAYTIYGTIGVKVWIFLGEIIGKPDLSPNA 216


>gi|291518039|emb|CBK73260.1| SSU ribosomal protein S3P [Butyrivibrio fibrisolvens 16/4]
          Length = 220

 Score =  259 bits (663), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 96/220 (43%), Positives = 143/220 (65%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   R+GV   W+S+W+A G  +   L ED  IR++L+  L  AGV+KI IER 
Sbjct: 1   MGQKVNPHGLRVGVIKDWDSKWYAEGENFSDYLVEDYNIRKFLKKKLYAAGVSKIEIERA 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               ++ VY+A+PG++IGK G +I+KI+ +L   T+ ++ + + E+ +P+ +A L+A++I
Sbjct: 61  AGRVKVTVYTAKPGVVIGKGGAEIDKIKTELQKQTSDKLVVDIKEIKRPDRDAQLVAENI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLE RV FRRAMK  +  AM+ G  G+K   SGRL GA+++R+E Y EG +PLQTLRA
Sbjct: 121 AGQLENRVSFRRAMKSCMGRAMKTGIKGIKTSCSGRLGGADMARSESYNEGTIPLQTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEH 220
            IDYG A A+T YG  G+KV++   + +      +     
Sbjct: 181 DIDYGFAEADTTYGKVGVKVWIYKGEVLPSKKKNVEGGAE 220


>gi|291613242|ref|YP_003523399.1| ribosomal protein S3 [Sideroxydans lithotrophicus ES-1]
 gi|291583354|gb|ADE11012.1| ribosomal protein S3 [Sideroxydans lithotrophicus ES-1]
          Length = 238

 Score =  259 bits (663), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 119/230 (51%), Positives = 161/230 (70%), Gaps = 4/230 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+PI FRL V   W S+W++    +  LL +D+++R+YL+  L  AGV+KI+IER 
Sbjct: 1   MGQKIHPIGFRLSVQKNWTSKWYSNSKHFSELLLKDIEVRDYLKKKLAGAGVSKIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTN-SEIHLSVNEVPKPEINATLIAQS 119
            KN +I +Y+ARPG++IGKKG DIE +R +L       ++ L++ EV KPE++A LIA S
Sbjct: 61  AKNAKITIYTARPGVVIGKKGEDIESLRNELKKRMGLPDVGLNIEEVRKPEVDAQLIADS 120

Query: 120 IAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           I QQLE+R++FRRAMKRA+Q+AMR GA G+K+++SGRLNG E++RTE Y EGRVPL TLR
Sbjct: 121 ITQQLEKRIMFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGIEIARTEWYREGRVPLHTLR 180

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIP---AAEHRVVEKD 226
           A IDYGT+ A T YG  G+KV+V   D V+          A   + V K 
Sbjct: 181 ADIDYGTSEALTTYGLIGVKVWVYKGDHVAGQQEAAAPVVAEPEKKVRKS 230


>gi|271962638|ref|YP_003336834.1| 30S ribosomal protein S3P [Streptosporangium roseum DSM 43021]
 gi|270505813|gb|ACZ84091.1| SSU ribosomal protein S3P [Streptosporangium roseum DSM 43021]
          Length = 288

 Score =  259 bits (663), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 98/206 (47%), Positives = 146/206 (70%), Gaps = 1/206 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP  FRLG+   + SRW+A    Y + + ED+ IR  L+  +++AG++K+ IERT
Sbjct: 1   MGQKVNPHGFRLGITTDFKSRWYAD-KLYKSYVAEDVAIRRMLKKGMERAGISKVEIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               ++ +++ARPG++IG++G + ++IR  L  +T  ++ L++ EV  PEI+A L+AQ +
Sbjct: 60  TDRVQVDIHTARPGIVIGRRGAEADRIRGDLEKLTKKQVQLNILEVKNPEIDAQLVAQGV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QL  RV FRRAM++A+QSAM+ GA G++V  SGRL GAE+SR+E Y EGRVPL TLRA
Sbjct: 120 AEQLSSRVSFRRAMRKAMQSAMKSGAKGIRVQCSGRLGGAEMSRSEFYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRD 206
            IDYG   A T +G  G+KV++   +
Sbjct: 180 DIDYGLYEARTTFGRIGVKVWIYKGE 205


>gi|116628592|ref|YP_821211.1| 30S ribosomal protein S3 [Streptococcus thermophilus LMD-9]
 gi|122266814|sp|Q03IF7|RS3_STRTD RecName: Full=30S ribosomal protein S3
 gi|116101869|gb|ABJ67015.1| SSU ribosomal protein S3P [Streptococcus thermophilus LMD-9]
 gi|312279253|gb|ADQ63910.1| Methyltransferase small [Streptococcus thermophilus ND03]
          Length = 217

 Score =  259 bits (663), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 94/215 (43%), Positives = 147/215 (68%), Gaps = 1/215 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI  R+G+   W+++W+A   EY   LHEDL IR+++Q  L  A V+ I I R 
Sbjct: 1   MGQKVHPIGLRVGIIRDWDAKWYAE-KEYADYLHEDLAIRKFIQKELADASVSTIEIVRA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                + +++A+PG++IGK G++++ +R +L+ +T  ++H+++ E+ KP+++A L+ ++I
Sbjct: 60  VNKVIVSLHTAKPGMVIGKGGSNVDALRAQLNKLTGKQVHINIVEIKKPDLDAHLVGETI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE+RV FRRA K+A+Q AMR GA G+K   SGRLNGA+++R E Y EG VPL TLRA
Sbjct: 120 ARQLEQRVAFRRAQKQAIQRAMRAGAKGIKTQVSGRLNGADIARAEGYSEGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTI 215
            IDY    A T YG  G+KV++   + +    +T 
Sbjct: 180 DIDYAWEEAHTTYGKLGVKVWIYRGEVLPARKNTK 214


>gi|37912986|gb|AAR05315.1| ribosomal protein S3 [uncultured marine alpha proteobacterium
           HOT2C01]
          Length = 223

 Score =  259 bits (663), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 124/207 (59%), Positives = 155/207 (74%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI  RL +N  W SRW+A   E+G+ L EDLKIR YL+  LK   VAKI IER 
Sbjct: 1   MGQKVNPIGLRLILNKKWQSRWYAGKKEFGSFLQEDLKIRAYLEKKLKNCAVAKIQIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K  ++ +YSARPGLIIGKKG+DIEK++KK+S  T+ E+ +++ E+ KPE+ A LIA  I
Sbjct: 61  AKKAQVTIYSARPGLIIGKKGSDIEKLKKKISEFTSDEVSINLVEIRKPEVEAQLIADGI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLERRV FRRAMKR+VQSAMR GADG++V   GRL G E++RTE Y EGRVPL T RA
Sbjct: 121 AEQLERRVSFRRAMKRSVQSAMRLGADGIRVNCGGRLGGTEIARTEWYREGRVPLHTFRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDE 207
           ++DY  A A+T YGSCGIKV++   D 
Sbjct: 181 NVDYAVATAQTTYGSCGIKVWIYKGDI 207


>gi|319443059|ref|ZP_07992215.1| 30S ribosomal protein S3 [Corynebacterium variabile DSM 44702]
          Length = 249

 Score =  259 bits (663), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 106/223 (47%), Positives = 149/223 (66%), Gaps = 2/223 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P   RLG+   W SRW+A   +Y   L ED+KIRE+L   L +AG+A ++IERT
Sbjct: 1   MGQKIHPHGLRLGITSEWRSRWYAD-KQYADYLAEDIKIREFLSKGLDRAGIADVVIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG++G + ++IR +L  +T  ++ L++ EV   + NA L+AQSI
Sbjct: 60  RDRVRVDIHTARPGIVIGRRGAEADRIRGRLEKLTGKQVQLNILEVKNIDANAQLVAQSI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAM-RFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           A+QL  RV FRRAM++A+QSAM +    G+KV+ SGRL GAE+ RTE Y EGRVPL TLR
Sbjct: 120 AEQLTNRVAFRRAMRKAIQSAMRQPQVKGIKVVCSGRLGGAEMGRTERYHEGRVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRV 222
           A IDYGT  A T +G  G+KV++   D V     ++  A    
Sbjct: 180 AEIDYGTYEARTTFGRIGVKVWIYKGDVVGGRRESLLNARDER 222


>gi|260549834|ref|ZP_05824050.1| ribosomal protein S3 [Acinetobacter sp. RUH2624]
 gi|293610830|ref|ZP_06693130.1| 30S ribosomal protein S3 [Acinetobacter sp. SH024]
 gi|260407084|gb|EEX00561.1| ribosomal protein S3 [Acinetobacter sp. RUH2624]
 gi|292827174|gb|EFF85539.1| 30S ribosomal protein S3 [Acinetobacter sp. SH024]
          Length = 250

 Score =  259 bits (663), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 112/226 (49%), Positives = 158/226 (69%), Gaps = 2/226 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI  RLGV    N+ W+A   +Y   L +DL++RE+L   LK A V+ ILIER 
Sbjct: 1   MGQKVHPIGIRLGVVKRHNANWYANPKQYAEYLLKDLQVREFLTKKLKNAMVSNILIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               ++ + +ARPG++IGKKG DIEK++++L+++      +S+NE+ +P+++A L+A++I
Sbjct: 61  SGAAKVTISTARPGIVIGKKGEDIEKLQRELTSIMGVPAQVSINEIDRPDLDARLVAEAI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLE+RV+FRRAMKRAVQ+ MR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 ASQLEKRVMFRRAMKRAVQNTMRAGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD-SDSTIPA-AEHRVVE 224
            IDY T  AET YG+ G+KV++   + +        PA AE R  +
Sbjct: 181 DIDYATMRAETTYGTIGVKVWIFRGEILGGMKQVMNPAPAEDRPAK 226


>gi|325267183|ref|ZP_08133850.1| 30S ribosomal protein S3 [Kingella denitrificans ATCC 33394]
 gi|324981346|gb|EGC16991.1| 30S ribosomal protein S3 [Kingella denitrificans ATCC 33394]
          Length = 233

 Score =  259 bits (663), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 110/226 (48%), Positives = 156/226 (69%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P+ FRL VN  W+S+WFA+ +E+  +L +D+ +R YL  HL  A V +++IER 
Sbjct: 1   MGQKIHPVGFRLAVNKDWSSKWFAKSTEFATVLKQDIDVRTYLSKHLADASVGRVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ RI +++ARPG++IG+KG  IE +++ L  +    +H+++ E+ KPE++A LIA  I
Sbjct: 61  AKSARITIHTARPGVVIGQKGAGIEVLKRDLEKLLGVAVHVNIEEIRKPELDAQLIADGI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLE+RV FRRAMKRA+Q+AMR GA GVK++ SGRLNGA+++R+E Y EGRVPL TLRA
Sbjct: 121 AQQLEKRVQFRRAMKRAMQNAMRAGAKGVKIMTSGRLNGADIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            +DY T+ A T YG  G+KV+V   +              R   K 
Sbjct: 181 DVDYATSEALTTYGIIGLKVWVYKGEMGQVQAQPAERENRRNHRKG 226


>gi|312144241|ref|YP_003995687.1| ribosomal protein S3 [Halanaerobium sp. 'sapolanicus']
 gi|311904892|gb|ADQ15333.1| ribosomal protein S3 [Halanaerobium sp. 'sapolanicus']
          Length = 213

 Score =  259 bits (663), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 97/213 (45%), Positives = 152/213 (71%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   R+GV   W+++W+A   +Y  LL ED +IR +++  + +AG+++I+IER 
Sbjct: 1   MGQKVNPHGLRVGVIKDWDAKWYADKQDYSKLLKEDQEIRNHVKEKMYEAGISRIVIERA 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               ++ V++ARPG++IG+ G+++E +R ++  +T   + ++V EV  PE+NA L+A++I
Sbjct: 61  ANRLKLDVHTARPGMVIGRGGSEVEALRNEVETLTGRTVQINVVEVEDPEMNAQLVAENI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QL RR+ FRRAMK+A+  AMR GA+G KV +SGRL GAE++R E Y +G VPL TLRA
Sbjct: 121 AAQLVRRISFRRAMKQALNRAMRMGAEGFKVQSSGRLGGAEMARREGYSQGSVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDS 213
            IDYG A A+T YG+ G+KV+++  + + + D 
Sbjct: 181 DIDYGFAEADTTYGTIGVKVWINKGEILPEIDE 213


>gi|294789229|ref|ZP_06754468.1| ribosomal protein S3 [Simonsiella muelleri ATCC 29453]
 gi|294482970|gb|EFG30658.1| ribosomal protein S3 [Simonsiella muelleri ATCC 29453]
          Length = 233

 Score =  259 bits (663), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 112/226 (49%), Positives = 163/226 (72%), Gaps = 1/226 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P+ FRL VN  W+S+WFA+ +E+ A+L +D+ +REYL   L  A V +++IER 
Sbjct: 1   MGQKIHPVGFRLAVNKDWSSKWFAKSTEFAAVLKQDIDVREYLSKRLANASVGRVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ RI +++ARPG++IG+KG DIE +++ L  +    +H+++ E+ KPE++A LIA  I
Sbjct: 61  AKSARITIHTARPGVVIGQKGADIEVLKRDLEKLLGVAVHVNIEEIRKPELDAQLIADGI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLE+RV FRRAMKRA+Q+AMR GA G+K++ SGRLNGA+++R+E Y EGRVPL TLRA
Sbjct: 121 AQQLEKRVQFRRAMKRAMQNAMRAGAKGIKIMTSGRLNGADIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            +DY T+ A T YG  G+KV+V  + E+    +     E+R   + 
Sbjct: 181 DVDYATSEALTTYGIIGLKVWVY-KGEMGQVQAQPEQRENRRNNRK 225


>gi|289209323|ref|YP_003461389.1| ribosomal protein S3 [Thioalkalivibrio sp. K90mix]
 gi|288944954|gb|ADC72653.1| ribosomal protein S3 [Thioalkalivibrio sp. K90mix]
          Length = 226

 Score =  259 bits (663), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 110/212 (51%), Positives = 150/212 (70%), Gaps = 3/212 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG++  W++ W+A G E+G  L+ D+K+RE+LQ  L  A V++I I R 
Sbjct: 1   MGQKVHPTGIRLGISRPWSATWYADGREFGETLNNDIKLREFLQKKLAHASVSRISISRP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSN---MTNSEIHLSVNEVPKPEINATLIA 117
            K   I + +ARPG++IGKKG DIEK+R+ ++    +    + +++ EV KPEI A L+A
Sbjct: 61  AKAAHITIQTARPGIVIGKKGEDIEKLRQDVARETGLEKGTVKINIEEVRKPEIEAQLVA 120

Query: 118 QSIAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQT 177
           + IAQQLERR++FRRAMKRAV +AMR GA G+KV  SGRLNGAE++R+E Y EGRVPL T
Sbjct: 121 EGIAQQLERRIMFRRAMKRAVGNAMRLGAQGIKVHVSGRLNGAEIARSEWYREGRVPLHT 180

Query: 178 LRAHIDYGTAVAETAYGSCGIKVYVSLRDEVS 209
           LRA IDYG A A T YG  G+KV++   +   
Sbjct: 181 LRADIDYGFAEARTTYGIIGVKVWIFKGEVFG 212


>gi|15612703|ref|NP_241006.1| 30S ribosomal protein S3 [Bacillus halodurans C-125]
 gi|7388207|sp|Q9Z9K8|RS3_BACHD RecName: Full=30S ribosomal protein S3
 gi|4512410|dbj|BAA75277.1| rpsC homologue (identity of 87% to B. subtilis ) [Bacillus
           halodurans]
 gi|10172752|dbj|BAB03859.1| 30S ribosomal protein S3 [Bacillus halodurans C-125]
          Length = 219

 Score =  259 bits (663), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 102/217 (47%), Positives = 149/217 (68%), Gaps = 1/217 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP+  R+GV   W S+W+A   +Y  LLHED+KIREY++  LK A V+KI IER 
Sbjct: 1   MGQKVNPVGLRVGVIRDWESKWYAE-KDYADLLHEDIKIREYIENRLKDASVSKIEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                I + +A+PG++IGK G+++E +RK L+ +T   +H+++ EV + +++A L+A++I
Sbjct: 60  ANRVNITISTAKPGMVIGKGGSEVEALRKALNELTGKRVHINIFEVKQADLDAKLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE R+ FRRAMK+A+Q  MR GA G+K   SGRL GA+++R E Y EG VPL TLRA
Sbjct: 120 ARQLENRISFRRAMKQAIQRTMRAGAQGIKTQVSGRLGGADIARAEHYSEGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPA 217
            IDYGTA A+T YG  G+K+++   + +         
Sbjct: 180 DIDYGTAEADTTYGKLGVKIWIYRGEVLPTKGKNKKE 216


>gi|158317785|ref|YP_001510293.1| 30S ribosomal protein S3 [Frankia sp. EAN1pec]
 gi|226697714|sp|A8LC50|RS3_FRASN RecName: Full=30S ribosomal protein S3
 gi|158113190|gb|ABW15387.1| ribosomal protein S3 [Frankia sp. EAN1pec]
          Length = 325

 Score =  259 bits (663), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 101/218 (46%), Positives = 149/218 (68%), Gaps = 1/218 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP  FRLG+   + SRW+A   +Y A + ED+KIR+ +   +++AG++++ IERT
Sbjct: 1   MGQKVNPHGFRLGITSEFTSRWYAD-KQYKAYVGEDVKIRKMMSKGMERAGISRVDIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG++G + ++IR  L  +T  ++ L++ EV  PEI+A L+AQ +
Sbjct: 60  QGRLRVDIHTARPGIVIGRRGAEADRIRGDLEKLTGKQVQLNILEVKNPEIDAQLVAQGV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QL  RV FRRAM++A+QSAM+ GA G++V  SGRL GAE+SR+E Y EGRVPL TLRA
Sbjct: 120 AEQLSSRVSFRRAMRKAMQSAMKSGAKGIRVQCSGRLGGAEMSRSEFYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAA 218
            IDYG   A T +G  G+KV++   D V          
Sbjct: 180 DIDYGFYEARTNFGRIGVKVWIYKGDIVQSRAEREAQE 217


>gi|71065065|ref|YP_263792.1| 30S ribosomal protein S3 [Psychrobacter arcticus 273-4]
 gi|91207834|sp|Q4FUF0|RS3_PSYA2 RecName: Full=30S ribosomal protein S3
 gi|71038050|gb|AAZ18358.1| SSU ribosomal protein S3P [Psychrobacter arcticus 273-4]
          Length = 242

 Score =  259 bits (662), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 106/224 (47%), Positives = 152/224 (67%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI  RLGV    N+ W+A   +Y   L  D+++REYL+  L  A ++KI+IER 
Sbjct: 1   MGQKVHPIGIRLGVVKKHNANWYASPKQYSEYLINDIQVREYLRKKLDSAMISKIMIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               +I + +ARPG++IGKKG DIE+++K+L+ M      +++ E+  P+++A L+A+ I
Sbjct: 61  TGAAKITIATARPGIVIGKKGEDIERLQKELTKMMGVPAQVNIEEITSPDLDAHLVAEGI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ++MR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQNSMRSGAKGIKVELSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVE 224
            IDY +  AET YG+ G+KV++   + +   +S     +     
Sbjct: 181 DIDYSSVRAETTYGTIGVKVWIFRGEILDGMNSVYNPVKEEQTR 224


>gi|110833264|ref|YP_692123.1| 30S ribosomal protein S3 [Alcanivorax borkumensis SK2]
 gi|254427789|ref|ZP_05041496.1| ribosomal protein S3 [Alcanivorax sp. DG881]
 gi|123345807|sp|Q0VSJ7|RS3_ALCBS RecName: Full=30S ribosomal protein S3
 gi|110646375|emb|CAL15851.1| 30S ribosomal protein S3 [Alcanivorax borkumensis SK2]
 gi|196193958|gb|EDX88917.1| ribosomal protein S3 [Alcanivorax sp. DG881]
          Length = 230

 Score =  259 bits (662), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 105/226 (46%), Positives = 153/226 (67%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P+  RLG+    NS W+A    Y   L  DL++REYL   LK A V++I IER 
Sbjct: 1   MGQKVHPVGIRLGIVKEHNSLWYAGPKSYSDCLVTDLQVREYLFKRLKSASVSRIKIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            +N RI + +ARPG++IGKKG D+E++R+ ++      +H+++ EV KP+++A L+  ++
Sbjct: 61  SENVRITIATARPGIVIGKKGEDVERLRRDVAAKMGVPVHINIEEVRKPDLDARLVGDNV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AM+ GA+G+++  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 AGQLERRVMFRRAMKRAVQNAMKSGAEGIRIQLSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            IDY +  AET YG+ G+KV++   + +   +      +     K 
Sbjct: 181 DIDYASVRAETTYGTIGVKVWIFRGEVLGGMEQVQEEQKQSKGAKK 226


>gi|288554731|ref|YP_003426666.1| 30S ribosomal protein S3 [Bacillus pseudofirmus OF4]
 gi|288545891|gb|ADC49774.1| 30S ribosomal protein S3 [Bacillus pseudofirmus OF4]
          Length = 219

 Score =  259 bits (662), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 103/211 (48%), Positives = 148/211 (70%), Gaps = 1/211 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP   R+GV   W S+W+A   +Y  LLHED+KIREY++  LK A V+K+ IER 
Sbjct: 1   MGQKINPTGLRVGVIKDWESKWYAE-KDYADLLHEDIKIREYIEKRLKDASVSKVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                + V +A+PG++IGK G+++E +RK L+ +T   +H+++ EV + +++A L+A++I
Sbjct: 60  ANRVNVTVSTAKPGMVIGKGGSEVEALRKALNELTGKRVHINIFEVKQADLDAKLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE R+ FRRAMK+A+Q  MR GA G+K   SGRL GA+++R E Y EG VPL TLRA
Sbjct: 120 ARQLENRISFRRAMKQAIQRTMRSGAKGIKTQVSGRLGGADIARAEHYSEGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDS 211
            IDYGTA A+T YG  GIK+++   + +   
Sbjct: 180 DIDYGTAEADTTYGKLGIKIWIYRGEVLPTK 210


>gi|258406179|ref|YP_003198921.1| 30S ribosomal protein S3 [Desulfohalobium retbaense DSM 5692]
 gi|257798406|gb|ACV69343.1| ribosomal protein S3 [Desulfohalobium retbaense DSM 5692]
          Length = 213

 Score =  259 bits (662), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 105/211 (49%), Positives = 150/211 (71%), Gaps = 1/211 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P  FRLG N  W SRWF+R  +Y   ++ED +IR Y++  L  AG++ + IER+
Sbjct: 1   MGQKVHPYGFRLGYNKNWLSRWFSR-KDYPQYVYEDRQIRNYVKSKLYHAGLSSLEIERS 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+I+++ARPG++IG+KG +IEK+R  L      +  + VNE+ +PE NA L+A+++
Sbjct: 60  ASKLRLIIHTARPGIVIGRKGVEIEKLRNDLKKKFKRDFSIEVNEIRRPETNAQLVAENV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV FRRAMKR +  A +FGA+G+K+  SGRL GA+++RTE + EGRVPLQTLRA
Sbjct: 120 AMQLERRVAFRRAMKRTISLARKFGAEGIKISCSGRLGGADIARTEWFREGRVPLQTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDS 211
            +DYG AVA T YG  G+KV++   + + D 
Sbjct: 180 DLDYGYAVARTTYGVIGVKVWIFRGEILDDE 210


>gi|323144970|ref|ZP_08079530.1| ribosomal protein S3 [Succinatimonas hippei YIT 12066]
 gi|322415249|gb|EFY06023.1| ribosomal protein S3 [Succinatimonas hippei YIT 12066]
          Length = 269

 Score =  259 bits (662), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 106/221 (47%), Positives = 154/221 (69%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI  RLG+   ++S W+A  + + A +  D  +R+YL   LK   V+KI+I+R 
Sbjct: 1   MGQKVNPIGIRLGITKPYSSVWYASTANFPANIKSDSAVRKYLFEELKNDSVSKIVIDRP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+RKK++ +      ++++EV KP+++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGIVIGKKGEDVEKLRKKIAEIAGVPAQVNISEVRKPDLDAKLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMK+A+Q+AMR GA G+KV  SGRL GAE++R+E   EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKKAIQNAMRVGAKGIKVEVSGRLGGAEIARSEWLREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHR 221
            IDY  + A T YG  G+KV++   + + +   T    E R
Sbjct: 181 DIDYAISEAVTTYGVIGVKVWIFKGEVLGNLPLTQEEPEDR 221


>gi|85374459|ref|YP_458521.1| 30S ribosomal protein S3 [Erythrobacter litoralis HTCC2594]
 gi|123293711|sp|Q2N9B7|RS3_ERYLH RecName: Full=30S ribosomal protein S3
 gi|84787542|gb|ABC63724.1| ribosomal protein S3 [Erythrobacter litoralis HTCC2594]
          Length = 231

 Score =  259 bits (662), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 128/218 (58%), Positives = 162/218 (74%), Gaps = 1/218 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK NPI  RL +N TW+SRW+A G+ Y  LL ED++IR+Y+     QA ++K++IER 
Sbjct: 1   MGQKSNPIGLRLQINRTWDSRWYAEGNAYAKLLAEDIEIRKYILETAAQAAISKVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K CRI +Y+ARPG+IIGKKG DIEK+R+KLS MT SE+ L++ E+ KPEI+A L+AQ I
Sbjct: 61  AKLCRISIYAARPGVIIGKKGADIEKLRQKLSTMTESEVKLNIVEIRKPEIDAKLVAQGI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QL RRV FRRAMKRA+QSAMR GA+G+K++  GRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 ADQLIRRVAFRRAMKRAMQSAMRLGAEGIKIVCGGRLGGAEIARVEQYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAA 218
           +IDY  A A TAYG  GIKV+V  + E+   D T    
Sbjct: 181 NIDYAEAEALTAYGIIGIKVWVF-KGEILGHDPTAQDR 217


>gi|19551752|ref|NP_599754.1| 30S ribosomal protein S3 [Corynebacterium glutamicum ATCC 13032]
 gi|62389407|ref|YP_224809.1| 30S ribosomal protein S3 [Corynebacterium glutamicum ATCC 13032]
 gi|145294665|ref|YP_001137486.1| 30S ribosomal protein S3 [Corynebacterium glutamicum R]
 gi|27734499|sp|Q8NT01|RS3_CORGL RecName: Full=30S ribosomal protein S3
 gi|152060858|sp|A4QBI7|RS3_CORGB RecName: Full=30S ribosomal protein S3
 gi|21323279|dbj|BAB97907.1| Ribosomal protein S3 [Corynebacterium glutamicum ATCC 13032]
 gi|41324741|emb|CAF19223.1| 30S RIBOSOMAL PROTEIN S3 [Corynebacterium glutamicum ATCC 13032]
 gi|140844585|dbj|BAF53584.1| hypothetical protein [Corynebacterium glutamicum R]
          Length = 248

 Score =  259 bits (662), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 109/228 (47%), Positives = 152/228 (66%), Gaps = 3/228 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P   RLG+   W S W+A    Y   + ED+KIRE+L   L +AG+A ++IERT
Sbjct: 1   MGQKIHPHGLRLGITSDWKSHWYAD-KSYADYVAEDIKIREFLSKGLDRAGIADVVIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG++G + ++IR++L  +T  ++ L++ EV   + NA L+AQSI
Sbjct: 60  RDRVRVDIHTARPGIVIGRRGAEADRIRRELEKLTGKQVALNILEVKNVDANAKLVAQSI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAM-RFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           A+QL  RV FRRAM++A+QSAM +    G+KV+ SGRL GAE+SRTE Y EGRVPL TLR
Sbjct: 120 AEQLTNRVAFRRAMRKAIQSAMRQPQVKGIKVVCSGRLGGAEMSRTERYHEGRVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSD-SDSTIPAAEHRVVEKD 226
           A IDYGT  A T +G  G+KV++   D V    +S I A   R    D
Sbjct: 180 AEIDYGTYEAHTTFGRIGVKVWIYKGDVVGGRRESEINAPAERRGRGD 227


>gi|25027084|ref|NP_737138.1| 30S ribosomal protein S3 [Corynebacterium efficiens YS-314]
 gi|259506787|ref|ZP_05749687.1| 30S ribosomal protein S3 [Corynebacterium efficiens YS-314]
 gi|27734492|sp|P59181|RS3_COREF RecName: Full=30S ribosomal protein S3
 gi|23492364|dbj|BAC17338.1| putative 30S ribosomal protein S3 [Corynebacterium efficiens
           YS-314]
 gi|259165658|gb|EEW50212.1| 30S ribosomal protein S3 [Corynebacterium efficiens YS-314]
          Length = 248

 Score =  259 bits (662), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 108/228 (47%), Positives = 152/228 (66%), Gaps = 3/228 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P   RLG+   W S W+A    Y   + ED+KIR++L   L +AG+A ++IERT
Sbjct: 1   MGQKIHPHGLRLGITSDWKSHWYAD-QSYADYVAEDIKIRDFLSKGLDRAGIADVVIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG++G + ++IR++L  +T  ++ L++ EV   + NA L+AQSI
Sbjct: 60  RDRVRVDIHTARPGIVIGRRGAEADRIRRELEKLTGKQVALNILEVKNIDANAQLVAQSI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAM-RFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           A+QL  RV FRRAM++A+QSAM +    G+KV+ SGRL GAE+SRTE Y EGRVPL TLR
Sbjct: 120 AEQLSNRVAFRRAMRKAIQSAMRQPQVKGIKVVCSGRLGGAEMSRTERYHEGRVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSD-SDSTIPAAEHRVVEKD 226
           A IDYGT  A T +G  G+KV++   D V    +S I A   R    D
Sbjct: 180 AEIDYGTYEAHTTFGRIGVKVWIYKGDVVGGRRESEINAPAERRGRGD 227


>gi|91763166|ref|ZP_01265130.1| 30S ribosomal protein S3 [Candidatus Pelagibacter ubique HTCC1002]
 gi|91717579|gb|EAS84230.1| 30S ribosomal protein S3 [Candidatus Pelagibacter ubique HTCC1002]
          Length = 226

 Score =  259 bits (662), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 111/226 (49%), Positives = 156/226 (69%), Gaps = 2/226 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP+ FRLGVN  W+S W+A+  ++G  L ED KIR Y++ ++  +GV+K++IERT
Sbjct: 1   MGQKVNPVGFRLGVNRGWDSVWYAKKKDFGNYLIEDFKIRAYIKKNVVNSGVSKVMIERT 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
              C + +Y++RPG +IGKKG+DI+KI+  LS  TN+E+ L++ EV KPE NA L+A++I
Sbjct: 61  SNKCFVTIYTSRPGFVIGKKGSDIDKIKNNLSKFTNNEVTLNIKEVKKPETNAYLVAENI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQL +R+ +RRAMKRA+QS +R GA G+KV  SGRL G E++RTE   EG +P  TLRA
Sbjct: 121 AQQLVKRISYRRAMKRAMQSCLRLGAKGIKVSISGRLGGNEIARTEWLREGSIPSHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDS--DSTIPAAEHRVVE 224
            IDY  A A T +G  GIK+++   +  +      T   A   V E
Sbjct: 181 DIDYAEAEALTTFGIIGIKIWIYKGEVFAKEFSQETNKIAPKEVKE 226


>gi|205372063|ref|ZP_03224880.1| 30S ribosomal protein S3 [Bacillus coahuilensis m4-4]
          Length = 218

 Score =  259 bits (662), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 98/219 (44%), Positives = 148/219 (67%), Gaps = 1/219 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI  R+G+   W S+W+A G +Y  LLHEDLK+REY+   L  A V+K+ IER 
Sbjct: 1   MGQKVHPIGLRVGIIRDWESKWYA-GKDYADLLHEDLKVREYVAKRLSDASVSKVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                I +++A+PG++IGK GT++E +RK L+ +T   +H+++ E+ + +++A L+A++I
Sbjct: 60  ANRINISIHTAKPGMVIGKGGTEVEALRKALTELTKKRVHINIVEIKRADLDAKLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE RV FRRA K+++Q AMR GA G+K   SGRL GA+++R E Y EG VPL TLRA
Sbjct: 120 ARQLENRVSFRRAQKQSIQRAMRAGAKGIKTQVSGRLGGADIARAESYSEGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
            IDY    A+T YG  G+KV++   + +     +    +
Sbjct: 180 DIDYAHEEADTTYGKLGVKVWIYRGEVLPTKRKSQEGGK 218


>gi|222150451|ref|YP_002559604.1| 30S ribosomal protein S3 [Macrococcus caseolyticus JCSC5402]
 gi|222119573|dbj|BAH16908.1| 30S ribosomal protein S3 [Macrococcus caseolyticus JCSC5402]
          Length = 217

 Score =  259 bits (662), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 101/214 (47%), Positives = 152/214 (71%), Gaps = 1/214 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI  R+G+   W+++WFA   ++  LLHEDLK+R+Y++ +LK A V+++ IER 
Sbjct: 1   MGQKINPIGLRVGIIRDWDAKWFAE-KDFATLLHEDLKVRKYIEENLKDASVSRVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                I +++ +PG++IGK G++IEK+R  L+++T   +H++V EV K +++A L+A++I
Sbjct: 60  ANRVNIAIHTGKPGMVIGKGGSEIEKLRNNLNSLTGKRVHINVVEVKKVDMDARLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE RV FRRA K+A+Q AM+ GA G+K   SGRL GA+++R E Y EG VPL TLRA
Sbjct: 120 ARQLENRVSFRRAQKQAIQRAMKLGAKGIKTQVSGRLGGADIARAEQYSEGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDST 214
            IDY  A A+T YG  G+KV++   + +    S+
Sbjct: 180 DIDYAHAEADTTYGKLGVKVWIYRGEVLPTKKSS 213


>gi|261854956|ref|YP_003262239.1| ribosomal protein S3 [Halothiobacillus neapolitanus c2]
 gi|261835425|gb|ACX95192.1| ribosomal protein S3 [Halothiobacillus neapolitanus c2]
          Length = 224

 Score =  259 bits (661), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 106/212 (50%), Positives = 156/212 (73%), Gaps = 3/212 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P+ FRLG++  W SRW+A    +   L++D++ R +++  LK+A V++I IER 
Sbjct: 1   MGQKVHPVGFRLGISSDWTSRWYADSKLFPVQLNQDVRTRAFIKDKLKEASVSRIQIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTN---SEIHLSVNEVPKPEINATLIA 117
            ++  + +++ARPG++IG+KG DIE++R +++ M     + + LSV E+ KPE++A L+A
Sbjct: 61  ARSASVTIHTARPGIVIGRKGEDIERLRGEIAPMLGVDRNAVKLSVEEIRKPELDAQLVA 120

Query: 118 QSIAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQT 177
           +SIAQQLERR++FRRAMKRAVQ++MR GA G+KV  SGRL GAE++R E Y EGRVPL T
Sbjct: 121 ESIAQQLERRIMFRRAMKRAVQTSMRLGAGGIKVNVSGRLGGAEIARNEWYREGRVPLHT 180

Query: 178 LRAHIDYGTAVAETAYGSCGIKVYVSLRDEVS 209
           LRA IDYG A A+T YG  G+KV++   +   
Sbjct: 181 LRADIDYGFAEAQTTYGVIGVKVWIFKGEVFG 212


>gi|16801836|ref|NP_472104.1| 30S ribosomal protein S3 [Listeria innocua Clip11262]
 gi|16804664|ref|NP_466149.1| 30S ribosomal protein S3 [Listeria monocytogenes EGD-e]
 gi|46908798|ref|YP_015187.1| 30S ribosomal protein S3 [Listeria monocytogenes str. 4b F2365]
 gi|116873992|ref|YP_850773.1| 30S ribosomal protein S3 [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|217966175|ref|YP_002351853.1| ribosomal protein S3 [Listeria monocytogenes HCC23]
 gi|224499299|ref|ZP_03667648.1| 30S ribosomal protein S3 [Listeria monocytogenes Finland 1988]
 gi|224503580|ref|ZP_03671887.1| 30S ribosomal protein S3 [Listeria monocytogenes FSL R2-561]
 gi|226225171|ref|YP_002759278.1| ribosomal protein S3 [Listeria monocytogenes Clip81459]
 gi|254825013|ref|ZP_05230014.1| ribosomal protein S3 [Listeria monocytogenes FSL J1-194]
 gi|254829075|ref|ZP_05233762.1| ribosomal protein S3 [Listeria monocytogenes FSL N3-165]
 gi|254830942|ref|ZP_05235597.1| 30S ribosomal protein S3 [Listeria monocytogenes 10403S]
 gi|254854168|ref|ZP_05243516.1| ribosomal protein S3 [Listeria monocytogenes FSL R2-503]
 gi|254899923|ref|ZP_05259847.1| 30S ribosomal protein S3 [Listeria monocytogenes J0161]
 gi|254912871|ref|ZP_05262883.1| 30S ribosomal protein S3 [Listeria monocytogenes J2818]
 gi|254931104|ref|ZP_05264463.1| ribosomal protein S3 [Listeria monocytogenes HPB2262]
 gi|254937251|ref|ZP_05268948.1| ribosomal protein S3 [Listeria monocytogenes F6900]
 gi|254991848|ref|ZP_05274038.1| 30S ribosomal protein S3 [Listeria monocytogenes FSL J2-064]
 gi|255026653|ref|ZP_05298639.1| 30S ribosomal protein S3 [Listeria monocytogenes FSL J2-003]
 gi|255028281|ref|ZP_05300232.1| 30S ribosomal protein S3 [Listeria monocytogenes LO28]
 gi|255519646|ref|ZP_05386883.1| 30S ribosomal protein S3 [Listeria monocytogenes FSL J1-175]
 gi|284800488|ref|YP_003412353.1| 30S ribosomal protein S3 [Listeria monocytogenes 08-5578]
 gi|284993674|ref|YP_003415442.1| 30S ribosomal protein S3 [Listeria monocytogenes 08-5923]
 gi|289435892|ref|YP_003465764.1| hypothetical protein lse_2531 [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|290891811|ref|ZP_06554808.1| rpsC protein [Listeria monocytogenes FSL J2-071]
 gi|300763623|ref|ZP_07073621.1| ribosomal protein S3 [Listeria monocytogenes FSL N1-017]
 gi|315304945|ref|ZP_07875040.1| ribosomal protein S3 [Listeria ivanovii FSL F6-596]
 gi|54039501|sp|P66549|RS3_LISIN RecName: Full=30S ribosomal protein S3
 gi|54041958|sp|P66548|RS3_LISMO RecName: Full=30S ribosomal protein S3
 gi|61215603|sp|Q71WF2|RS3_LISMF RecName: Full=30S ribosomal protein S3
 gi|123458737|sp|A0ALW2|RS3_LISW6 RecName: Full=30S ribosomal protein S3
 gi|16412114|emb|CAD00704.1| ribosomal protein S3 [Listeria monocytogenes EGD-e]
 gi|16415311|emb|CAC98001.1| ribosomal protein S3 [Listeria innocua Clip11262]
 gi|46882071|gb|AAT05364.1| ribosomal protein S3 [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|116742870|emb|CAK21994.1| ribosomal protein S3 [Listeria welshimeri serovar 6b str. SLCC5334]
 gi|217335445|gb|ACK41239.1| ribosomal protein S3 [Listeria monocytogenes HCC23]
 gi|225877633|emb|CAS06347.1| ribosomal protein S3 [Listeria monocytogenes serotype 4b str. CLIP
           80459]
 gi|258601485|gb|EEW14810.1| ribosomal protein S3 [Listeria monocytogenes FSL N3-165]
 gi|258607560|gb|EEW20168.1| ribosomal protein S3 [Listeria monocytogenes FSL R2-503]
 gi|258609857|gb|EEW22465.1| ribosomal protein S3 [Listeria monocytogenes F6900]
 gi|284056050|gb|ADB66991.1| 30S ribosomal protein S3 [Listeria monocytogenes 08-5578]
 gi|284059141|gb|ADB70080.1| 30S ribosomal protein S3 [Listeria monocytogenes 08-5923]
 gi|289172136|emb|CBH28682.1| rpsC [Listeria seeligeri serovar 1/2b str. SLCC3954]
 gi|290558405|gb|EFD91922.1| rpsC protein [Listeria monocytogenes FSL J2-071]
 gi|293582651|gb|EFF94683.1| ribosomal protein S3 [Listeria monocytogenes HPB2262]
 gi|293590870|gb|EFF99204.1| 30S ribosomal protein S3 [Listeria monocytogenes J2818]
 gi|293594254|gb|EFG02015.1| ribosomal protein S3 [Listeria monocytogenes FSL J1-194]
 gi|300515900|gb|EFK42949.1| ribosomal protein S3 [Listeria monocytogenes FSL N1-017]
 gi|307572215|emb|CAR85394.1| rpsC [Listeria monocytogenes L99]
 gi|313626687|gb|EFR95725.1| ribosomal protein S3 [Listeria ivanovii FSL F6-596]
 gi|313636116|gb|EFS01988.1| ribosomal protein S3 [Listeria seeligeri FSL S4-171]
 gi|328468111|gb|EGF39117.1| 30S ribosomal protein S3 [Listeria monocytogenes 1816]
 gi|328469799|gb|EGF40716.1| 30S ribosomal protein S3 [Listeria monocytogenes 220]
          Length = 218

 Score =  259 bits (661), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 94/219 (42%), Positives = 147/219 (67%), Gaps = 1/219 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI  R+GV   W+S+W+A   +Y   LHEDL+IR+Y+   L  A V+++ IER 
Sbjct: 1   MGQKVHPIGMRIGVIRDWDSKWYAE-KDYADFLHEDLRIRDYVAKRLSDASVSRVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                I +++A+PG++IGK G+++E +RK L+ +T   +H+++ E+ + +++A L+A++I
Sbjct: 60  ANRVNITIHTAKPGMVIGKGGSEVEALRKNLNELTQKRVHINIVEIKRADLDAKLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE RV FRRA K+A+Q  MR GA G+K   SGRL GA+++R E Y EG VPL TLRA
Sbjct: 120 ARQLEGRVSFRRAQKQAIQRTMRAGAKGIKTQVSGRLGGADIARAEHYSEGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
            IDY    A+T YG  G+KV++   + +    + +   +
Sbjct: 180 DIDYAWEEADTTYGKLGVKVWIYRGEVLPTKKNNVEGGK 218


>gi|302523999|ref|ZP_07276341.1| ribosomal protein S3 [Streptomyces sp. AA4]
 gi|302432894|gb|EFL04710.1| ribosomal protein S3 [Streptomyces sp. AA4]
          Length = 281

 Score =  259 bits (661), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 96/211 (45%), Positives = 142/211 (67%), Gaps = 2/211 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP  FRLG+   W SRW+A   +Y   + ED+KIR+ L   +++AG++K+ IERT
Sbjct: 1   MGQKINPHGFRLGITTDWKSRWYAD-KQYAEYVAEDVKIRKLLSTGMERAGISKVEIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG++G + ++IR  L  +T  ++ L++ EV  PE +A L+AQ +
Sbjct: 60  RDRVRVDIHTARPGIVIGRRGAEADRIRGALEKLTKKQVQLNILEVKNPEADAQLVAQGV 119

Query: 121 AQQLERRVVFRRAMKRAVQ-SAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           A+QL  RV FRRAM++A+Q S       G++V   GRL GAE+SR+E Y +GRVPL TLR
Sbjct: 120 AEQLSNRVAFRRAMRKAIQTSMRSPQVKGIRVQCGGRLGGAEMSRSEHYRDGRVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSD 210
           A IDYG   A+T +G  G+KV++   + V  
Sbjct: 180 ADIDYGFFEAKTTFGRIGVKVWIYKGELVGG 210


>gi|93005320|ref|YP_579757.1| 30S ribosomal protein S3 [Psychrobacter cryohalolentis K5]
 gi|123264740|sp|Q1QDI0|RS3_PSYCK RecName: Full=30S ribosomal protein S3
 gi|92392998|gb|ABE74273.1| SSU ribosomal protein S3P [Psychrobacter cryohalolentis K5]
          Length = 242

 Score =  259 bits (661), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 105/224 (46%), Positives = 152/224 (67%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI  RLGV    N+ W+A   +Y   L  D+++REYL+  L  A ++KI+IER 
Sbjct: 1   MGQKVHPIGIRLGVVKKHNANWYASPKQYSEYLINDIQVREYLRKKLDSAMISKIMIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               +I + +ARPG++IGKKG DIE+++K+L+ +      +++ E+  P+++A L+A+ I
Sbjct: 61  TGAAKITIATARPGIVIGKKGEDIERLQKELTKIMGVPAQVNIEEITSPDLDAHLVAEGI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ++MR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQNSMRSGAKGIKVELSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVE 224
            IDY +  AET YG+ G+KV++   + +   +S     +     
Sbjct: 181 DIDYSSVRAETTYGTIGVKVWIFRGEILDGMNSVYNPVKEEQTR 224


>gi|303230141|ref|ZP_07316910.1| ribosomal protein S3 [Veillonella atypica ACS-134-V-Col7a]
 gi|303231249|ref|ZP_07317987.1| ribosomal protein S3 [Veillonella atypica ACS-049-V-Sch6]
 gi|302514156|gb|EFL56160.1| ribosomal protein S3 [Veillonella atypica ACS-049-V-Sch6]
 gi|302515202|gb|EFL57175.1| ribosomal protein S3 [Veillonella atypica ACS-134-V-Col7a]
          Length = 221

 Score =  259 bits (661), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 98/219 (44%), Positives = 156/219 (71%), Gaps = 1/219 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   R+G+   W+++W+A   ++ A LHED+KIR +L+  L  AG+++I IERT
Sbjct: 1   MGQKVNPHGLRVGIVKDWDAKWYAE-KDFAANLHEDVKIRNFLKETLFIAGISRIEIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           +K  ++ +++A+PG++IG+ G  IE I+K ++  T+ ++ +++ E+ + +++A L+A++I
Sbjct: 60  NKRIKLTIHTAKPGMVIGRGGAGIEDIKKAMTRFTDKQVDVNIAEIKQADMDAVLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERR+ FRRAMK+AV   MR GA G+K++ SGRL GAE++R+E Y EG +PL TLRA
Sbjct: 120 AGQLERRIGFRRAMKQAVGRTMRLGAKGIKIMVSGRLGGAEIARSESYREGSIPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
           +IDYGTA A T YG  GIKV++   + + ++       E
Sbjct: 180 NIDYGTAEAHTTYGCIGIKVWIYKGEVLPEAKQPAKKEE 218


>gi|226305347|ref|YP_002765305.1| 30S ribosomal protein S3 [Rhodococcus erythropolis PR4]
 gi|229489648|ref|ZP_04383511.1| ribosomal protein S3 [Rhodococcus erythropolis SK121]
 gi|259495255|sp|C0ZW31|RS3_RHOE4 RecName: Full=30S ribosomal protein S3
 gi|226184462|dbj|BAH32566.1| 30S ribosomal protein S3 [Rhodococcus erythropolis PR4]
 gi|229323745|gb|EEN89503.1| ribosomal protein S3 [Rhodococcus erythropolis SK121]
          Length = 268

 Score =  259 bits (661), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 100/217 (46%), Positives = 144/217 (66%), Gaps = 2/217 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP  FRLG+   W SRW+A   +Y   + ED+ IR+ L   +++AG+AK+ IERT
Sbjct: 1   MGQKINPHGFRLGITTDWKSRWYAD-KQYAEYVKEDVAIRKLLATGMERAGIAKVEIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG++G + ++IR +L  +T  ++ L++ EV   E  A L+AQ +
Sbjct: 60  RDRVRVDIHTARPGIVIGRRGAEADRIRSELEKLTGKQVQLNILEVKNAEAEAQLVAQGV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAM-RFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           A+QL  RV FRRAM++A+QSAM +    G++V  SGRL GAE+SR+E Y EGRVPL TLR
Sbjct: 120 AEQLSNRVAFRRAMRKAIQSAMRQPNVKGIRVQCSGRLGGAEMSRSEFYREGRVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIP 216
           A IDYG   A+T +G  G+KV++   D V        
Sbjct: 180 ADIDYGLYEAKTTFGRIGVKVWIYKGDIVGGKRELAA 216


>gi|309812338|ref|ZP_07706093.1| ribosomal protein S3 [Dermacoccus sp. Ellin185]
 gi|308433643|gb|EFP57520.1| ribosomal protein S3 [Dermacoccus sp. Ellin185]
          Length = 275

 Score =  259 bits (661), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 104/234 (44%), Positives = 150/234 (64%), Gaps = 8/234 (3%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFAR----GSEYGALLHEDLKIREYLQCHLKQAGVAKIL 56
           MGQKINP  FRLG+     SRWFA     G  Y   + ED+ IR+ L   +++AG+A++ 
Sbjct: 1   MGQKINPNGFRLGITTEHKSRWFADSTKPGQRYSDYVKEDVAIRKLLSEGMERAGIARVD 60

Query: 57  IERTHKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLI 116
           IERT    R+ +++ARPG++IG++G + +++R +L  +T  ++ L++ EV  PE +A L+
Sbjct: 61  IERTRDRVRVDIHTARPGIVIGRRGAEADRLRSRLEKLTGKQVQLNILEVKNPEADAQLV 120

Query: 117 AQSIAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQ 176
           AQ IA+QL  RV FRRAM++ + SA R GA G++V  SGRL GAE+SR+E Y EGRVPL 
Sbjct: 121 AQGIAEQLSARVSFRRAMRKGIMSAQRAGAKGIRVQCSGRLGGAEMSRSEFYREGRVPLH 180

Query: 177 TLRAHIDYGTAVAETAYGSCGIKVYVSLRD----EVSDSDSTIPAAEHRVVEKD 226
           TLRA+IDYG   A T +G  G+KV++   D    E++   +  P    R    D
Sbjct: 181 TLRANIDYGFYEARTTFGRIGVKVWIYKGDLTAKELAREQAAAPQRPARGRRND 234


>gi|84494780|ref|ZP_00993899.1| 30S ribosomal protein S3 [Janibacter sp. HTCC2649]
 gi|84384273|gb|EAQ00153.1| 30S ribosomal protein S3 [Janibacter sp. HTCC2649]
          Length = 272

 Score =  259 bits (661), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 101/228 (44%), Positives = 147/228 (64%), Gaps = 4/228 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFAR----GSEYGALLHEDLKIREYLQCHLKQAGVAKIL 56
           MGQK+NP  FRLG+     SRWFA     G  Y   + ED+ IR+ +   +++AG++K+ 
Sbjct: 1   MGQKVNPHGFRLGITSEHRSRWFADSTKEGQRYRDYVKEDVAIRKLMSEGMERAGISKVE 60

Query: 57  IERTHKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLI 116
           IERT    R+ +++ARPG++IG++G + ++IR +L  +T  ++ L++ EV  PE +A L+
Sbjct: 61  IERTRDRVRVDIHTARPGIVIGRRGAEADRIRGELEKLTGKQVQLNILEVKNPETDAQLV 120

Query: 117 AQSIAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQ 176
           AQ +A+QL  RV FRRAM++++QSA R GA G++V  SGRL GAE+SRTE Y EGRVPL 
Sbjct: 121 AQGVAEQLSARVSFRRAMRKSMQSATRAGAKGIRVQVSGRLGGAEMSRTEFYREGRVPLH 180

Query: 177 TLRAHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVE 224
           TLRA ID G   A T +G  G+KV++   D  +   +   A   R   
Sbjct: 181 TLRAQIDVGFYEARTTFGRIGVKVWIYKGDVTARELAAQQATAPRQGR 228


>gi|226323016|ref|ZP_03798534.1| hypothetical protein COPCOM_00788 [Coprococcus comes ATCC 27758]
 gi|225208583|gb|EEG90937.1| hypothetical protein COPCOM_00788 [Coprococcus comes ATCC 27758]
          Length = 218

 Score =  259 bits (661), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 102/211 (48%), Positives = 147/211 (69%), Gaps = 1/211 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   R+GV   W+S+W+A   ++   L ED KIR++L+  L  AGV+KI IER 
Sbjct: 1   MGQKVNPHGLRVGVIKDWDSKWYAE-KDFADYLVEDHKIRKFLKNKLYSAGVSKIEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               +IIVY+A+PG++IGK G++IEK++ +L  MT+ ++ + + EV +P+ +A L+A++I
Sbjct: 60  SDRVKIIVYTAKPGVVIGKGGSEIEKVKAELQKMTDKKVIVDIKEVKRPDKDAQLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLE R+ FRRAMK  +   M+ GA GVK   SGRL GA+++RTE Y EG +PLQTLRA
Sbjct: 120 AQQLENRISFRRAMKSCMSRTMKSGALGVKTSVSGRLGGADMARTEFYSEGTIPLQTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDS 211
            IDYG A A+T YG  G+KV++   + +   
Sbjct: 180 DIDYGFAEADTTYGKVGVKVWIYKGEVLPTK 210


>gi|149184317|ref|ZP_01862635.1| 30S ribosomal protein S3 [Erythrobacter sp. SD-21]
 gi|148831637|gb|EDL50070.1| 30S ribosomal protein S3 [Erythrobacter sp. SD-21]
          Length = 231

 Score =  259 bits (661), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 128/226 (56%), Positives = 166/226 (73%), Gaps = 4/226 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG K NPI  RL +N TW+SRW+A G +Y  LL ED++IR+Y+     QA ++K++IER 
Sbjct: 1   MGHKSNPIGLRLQINRTWDSRWYAEGRDYAKLLAEDIEIRKYILEKAAQAAISKVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K CRI +Y+ARPG+IIGKKG DIEK+R KLS MT SE+ L++ E+ KPE++A L+AQ I
Sbjct: 61  AKLCRISIYAARPGVIIGKKGADIEKLRAKLSQMTESEVKLNIVEIRKPEVDAKLVAQGI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QL RRV FRRAMKRA+QSAMR GA+G+K++  GRL GAE++R E Y EGRVPL TLRA
Sbjct: 121 ADQLIRRVAFRRAMKRAMQSAMRLGAEGIKIMCGGRLGGAEIARVEQYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
           +IDY  A A TAYG  GIKV+V  + E+   D   P A+ R++ + 
Sbjct: 181 NIDYAEAEALTAYGIIGIKVWVF-KGEILGHD---PTAQDRLMMES 222


>gi|305679831|ref|ZP_07402641.1| ribosomal protein S3 [Corynebacterium matruchotii ATCC 14266]
 gi|305660451|gb|EFM49948.1| ribosomal protein S3 [Corynebacterium matruchotii ATCC 14266]
          Length = 248

 Score =  259 bits (661), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 110/228 (48%), Positives = 154/228 (67%), Gaps = 3/228 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P   RLG+   W S WFA   EY   L ED+KIR+YL  +L +AG+A ++IERT
Sbjct: 1   MGQKIHPHGLRLGITSDWKSHWFAD-KEYADYLAEDIKIRDYLTKNLDRAGIADVVIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               RI +++ARPG++IG++G++ +++R KL  +T  ++ L++ EV   + NA L+AQSI
Sbjct: 60  RDRVRIDIHTARPGIVIGRRGSEADRLRTKLEKLTRKQVALNILEVKNIDANAQLVAQSI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAM-RFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           A+QL  RV FRRAM++A+Q AM +    G+KV+ +GRL GAE+SRTE Y EGRVPL TLR
Sbjct: 120 AEQLTNRVAFRRAMRKAIQGAMRQPQVKGIKVMCAGRLGGAEMSRTERYHEGRVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSD-SDSTIPAAEHRVVEKD 226
           A IDYGT  A T +G  G+KV++   D V +  +S + A   R    D
Sbjct: 180 AEIDYGTYEAHTTFGRIGVKVWIYKGDVVGNRRESELNAPTERRGRGD 227


>gi|68536917|ref|YP_251622.1| 30S ribosomal protein S3 [Corynebacterium jeikeium K411]
 gi|260579261|ref|ZP_05847145.1| 30S ribosomal protein S3 [Corynebacterium jeikeium ATCC 43734]
 gi|91207649|sp|Q4JT53|RS3_CORJK RecName: Full=30S ribosomal protein S3
 gi|68264516|emb|CAI38004.1| 30S ribosomal protein S3 [Corynebacterium jeikeium K411]
 gi|258602613|gb|EEW15906.1| 30S ribosomal protein S3 [Corynebacterium jeikeium ATCC 43734]
          Length = 247

 Score =  259 bits (661), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 105/221 (47%), Positives = 150/221 (67%), Gaps = 2/221 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P   RLG+   W SRW+A   +Y   L ED+KIR++L   L +AG+A ++IERT
Sbjct: 1   MGQKIHPHGLRLGITSEWRSRWYAD-KQYADYLAEDIKIRDFLSEGLDRAGIANVVIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           H   R+ +++ARPG++IG++G++ ++IR +L  +T  ++ L++ EV   + NA L+AQSI
Sbjct: 60  HDRVRVDIHTARPGIVIGRRGSEADRIRGQLEKLTGKQVQLNILEVKNIDANAQLVAQSI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAM-RFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           A+QL  RV FRRAM++A+Q AM +    G+KV+ SGRL GAE+ RTE Y EGRVPL TLR
Sbjct: 120 AEQLTNRVAFRRAMRKAIQGAMRQPQVKGIKVVCSGRLGGAEMGRTERYHEGRVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEH 220
           A IDYGT  A T +G  G+KV++   D V     ++  A  
Sbjct: 180 AEIDYGTYEAHTTFGRIGVKVWIYKGDVVGGRRESLMNARD 220


>gi|156973057|ref|YP_001443964.1| 30S ribosomal protein S3 [Vibrio harveyi ATCC BAA-1116]
 gi|269959697|ref|ZP_06174077.1| 30S ribosomal protein S3 [Vibrio harveyi 1DA3]
 gi|171769917|sp|A7N0I3|RS3_VIBHB RecName: Full=30S ribosomal protein S3
 gi|156524651|gb|ABU69737.1| hypothetical protein VIBHAR_00736 [Vibrio harveyi ATCC BAA-1116]
 gi|269835620|gb|EEZ89699.1| 30S ribosomal protein S3 [Vibrio harveyi 1DA3]
          Length = 232

 Score =  258 bits (660), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 107/224 (47%), Positives = 153/224 (68%), Gaps = 1/224 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WN+ WFA   ++   L  D K+R++L   L++A +++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNATWFANTKDFADNLDGDFKVRQFLTKELQKASLSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  ++ +      +++ EV KPE++A L+  SI
Sbjct: 61  AKSIRVTIHTARPGVVIGKKGEDVEKLRAAVAKIAGVPAQINIAEVRKPELDAQLVGDSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVE 224
            IDY T+ A T YG  GIK ++  + E+        A E +  +
Sbjct: 181 DIDYATSSAHTQYGVIGIKTWIF-KGEILGGMPAANAVEPKGDK 223


>gi|146317737|ref|YP_001197449.1| 30S ribosomal protein S3 [Streptococcus suis 05ZYH33]
 gi|146319927|ref|YP_001199638.1| 30S ribosomal protein S3 [Streptococcus suis 98HAH33]
 gi|223933100|ref|ZP_03625093.1| ribosomal protein S3 [Streptococcus suis 89/1591]
 gi|253750993|ref|YP_003024134.1| 30S ribosomal protein S3 [Streptococcus suis SC84]
 gi|253752893|ref|YP_003026033.1| 30S ribosomal protein S3 [Streptococcus suis P1/7]
 gi|253754718|ref|YP_003027858.1| 30S ribosomal protein S3 [Streptococcus suis BM407]
 gi|302023168|ref|ZP_07248379.1| 30S ribosomal protein S3 [Streptococcus suis 05HAS68]
 gi|330831926|ref|YP_004400751.1| 30S ribosomal protein S3 [Streptococcus suis ST3]
 gi|152060909|sp|A4VYP9|RS3_STRS2 RecName: Full=30S ribosomal protein S3
 gi|152060911|sp|A4VSG0|RS3_STRSY RecName: Full=30S ribosomal protein S3
 gi|145688543|gb|ABP89049.1| ribosomal protein S3 [Streptococcus suis 05ZYH33]
 gi|145690733|gb|ABP91238.1| ribosomal protein S3 [Streptococcus suis 98HAH33]
 gi|223898287|gb|EEF64655.1| ribosomal protein S3 [Streptococcus suis 89/1591]
 gi|251815282|emb|CAZ50848.1| 30S ribosomal protein S3 [Streptococcus suis SC84]
 gi|251817182|emb|CAZ54904.1| 30S ribosomal protein S3 [Streptococcus suis BM407]
 gi|251819138|emb|CAR44234.1| 30S ribosomal protein S3 [Streptococcus suis P1/7]
 gi|292557537|gb|ADE30538.1| ribosomal protein S3 [Streptococcus suis GZ1]
 gi|319757247|gb|ADV69189.1| 30S ribosomal protein S3 [Streptococcus suis JS14]
 gi|329306149|gb|AEB80565.1| 30S ribosomal protein S3 [Streptococcus suis ST3]
          Length = 217

 Score =  258 bits (660), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 93/215 (43%), Positives = 146/215 (67%), Gaps = 1/215 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI  R+G+   W+++W+A   EY   LHEDL IR +++  L  A  + I IER 
Sbjct: 1   MGQKVHPIGMRVGIIRDWDAKWYAE-KEYADYLHEDLAIRNFIKKELADASTSTIEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                + +++A+PG++IGK G++++ +R +L+ +T  ++H+++ E+ +P+++A L+ +SI
Sbjct: 60  VNKVIVSIHTAKPGMVIGKAGSNVDALRAQLNKLTGKQVHINIIEIKQPDLDAHLVGESI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE+RV FRRA K+A+Q AMR GA G+K   SGRLNGA+++R E Y EG VPL TLRA
Sbjct: 120 ARQLEQRVAFRRAQKQAIQRAMRAGAKGIKTQVSGRLNGADIARAEGYSEGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTI 215
            IDY    A T YG  G+KV++   + +    +T 
Sbjct: 180 DIDYAWEEALTTYGKLGVKVWIYRGEVLPARKNTK 214


>gi|154498889|ref|ZP_02037267.1| hypothetical protein BACCAP_02881 [Bacteroides capillosus ATCC
           29799]
 gi|150271729|gb|EDM98955.1| hypothetical protein BACCAP_02881 [Bacteroides capillosus ATCC
           29799]
          Length = 283

 Score =  258 bits (660), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 110/216 (50%), Positives = 147/216 (68%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   R+GV   W+SRW+AR  + G LL ED KIR++L+     AG+ KI IER 
Sbjct: 1   MGQKVNPHGLRVGVIKDWDSRWYARNEKVGDLLVEDKKIRDFLKKTQYGAGIPKIEIERD 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           +   RI ++ ARPG++IGK G  IE +R +L  M    + L++ EV  P+++A LIA++I
Sbjct: 61  NAKVRIYLHCARPGVVIGKGGEAIEALRLQLEKMLGKSVALNIVEVKNPDMDAQLIAENI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLE+R+ FRRAMK A+  AMR GA G+K   SGRL GAE++RTE Y +G +PLQTLRA
Sbjct: 121 AQQLEKRIGFRRAMKNAMGRAMRMGARGIKTQVSGRLGGAEIARTEHYHDGTIPLQTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIP 216
            IDYG A A T YG  G+KV+V   + +S +  T P
Sbjct: 181 DIDYGFAEAATTYGRIGVKVWVYKGEILSQALRTTP 216


>gi|288904279|ref|YP_003429500.1| ribosomal protein S3 [Streptococcus gallolyticus UCN34]
 gi|306830308|ref|ZP_07463479.1| 30S ribosomal protein S3 [Streptococcus gallolyticus subsp.
           gallolyticus TX20005]
 gi|325977258|ref|YP_004286974.1| 30S ribosomal protein S3 [Streptococcus gallolyticus subsp.
           gallolyticus ATCC BAA-2069]
 gi|288731004|emb|CBI12548.1| ribosomal protein S3 [Streptococcus gallolyticus UCN34]
 gi|304427555|gb|EFM30656.1| 30S ribosomal protein S3 [Streptococcus gallolyticus subsp.
           gallolyticus TX20005]
 gi|325177186|emb|CBZ47230.1| 30S ribosomal protein S3 [Streptococcus gallolyticus subsp.
           gallolyticus ATCC BAA-2069]
          Length = 217

 Score =  258 bits (660), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 94/215 (43%), Positives = 149/215 (69%), Gaps = 1/215 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI  R+G+   W+++W+A   EY   LHEDL IR+++Q  L  A V++I IER 
Sbjct: 1   MGQKVHPIGMRVGIIRDWDAKWYAE-KEYADYLHEDLAIRKFIQTELADASVSRIEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                + +++A+PG++IGK G +++ +R KL+ +T  ++H+++ E+ +P+++A L+ ++I
Sbjct: 60  VNKVIVSLHTAKPGMVIGKGGANVDALRAKLNKLTGKQVHINIVEIKQPDLDAHLVGENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE+RV FRRA K+A+Q  MR GA G+K   SGRLNGA+++R+E Y EG VPL TLRA
Sbjct: 120 ARQLEQRVAFRRAQKQAIQRTMRAGAKGIKTQVSGRLNGADIARSEGYSEGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTI 215
            IDY    A+T YG  G+KV++   + +    +T 
Sbjct: 180 DIDYAWEEADTTYGKLGVKVWIYRGEVLPARKNTK 214


>gi|283796553|ref|ZP_06345706.1| ribosomal protein S3 [Clostridium sp. M62/1]
 gi|291075967|gb|EFE13331.1| ribosomal protein S3 [Clostridium sp. M62/1]
 gi|295092553|emb|CBK78660.1| SSU ribosomal protein S3P [Clostridium cf. saccharolyticum K10]
          Length = 218

 Score =  258 bits (660), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 98/209 (46%), Positives = 148/209 (70%), Gaps = 1/209 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   R+GV   W+SRW+A  +++   L ED KIR YL+  L  AGV+KI IER 
Sbjct: 1   MGQKVNPHGLRVGVIKDWDSRWYAE-ADFADNLVEDHKIRTYLKKKLYSAGVSKIEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               ++I+Y+A+PG++IG+ G++IEK++ ++  +T+ ++ + + EV +P+ +A L+A++I
Sbjct: 60  SDRVKVIIYTAKPGVVIGRGGSEIEKVKAEVQKLTDKKLFIDIKEVKRPDRDAQLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLE RV FRRAMK A+  +M+ G  G+K   +GRL GA+++RTE Y EG +PLQTLRA
Sbjct: 120 AQQLENRVSFRRAMKSAMGRSMKAGVKGIKAAVAGRLGGADMARTEFYSEGTIPLQTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVS 209
            IDYG A A+T YG  G+KV++   + + 
Sbjct: 180 DIDYGFAEADTTYGKLGVKVWIYKGEVLP 208


>gi|55821899|ref|YP_140341.1| 30S ribosomal protein S3 [Streptococcus thermophilus LMG 18311]
 gi|55823815|ref|YP_142256.1| 30S ribosomal protein S3 [Streptococcus thermophilus CNRZ1066]
 gi|81676492|sp|Q5LXR7|RS3_STRT1 RecName: Full=30S ribosomal protein S3
 gi|81676645|sp|Q5M2B9|RS3_STRT2 RecName: Full=30S ribosomal protein S3
 gi|55737884|gb|AAV61526.1| 30S ribosomal protein S3 [Streptococcus thermophilus LMG 18311]
 gi|55739800|gb|AAV63441.1| 30S ribosomal protein S3 [Streptococcus thermophilus CNRZ1066]
          Length = 217

 Score =  258 bits (660), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 94/215 (43%), Positives = 148/215 (68%), Gaps = 1/215 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI  R+G+   W+++W+A   EY   LHEDL IR+++Q  L  A V+ I I R 
Sbjct: 1   MGQKVHPIGLRVGIIRDWDAKWYAE-KEYADYLHEDLAIRKFIQKELADASVSTIEIVRA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                + +++A+PG++IGK G++++ +R +L+ +T  ++H+++ E+ KP+++A L+ ++I
Sbjct: 60  VNKVIVSLHTAKPGMVIGKGGSNVDALRAQLNKLTGKQVHINIVEIKKPDLDAHLVGETI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE+RV FRRA K+A+Q AMR GA G+K   SGRLNGA+++R E Y EG VPL TLRA
Sbjct: 120 ARQLEQRVAFRRAQKQAIQRAMRAGAKGIKTQVSGRLNGADIARAEGYSEGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTI 215
            IDY    A+T YG  G+KV++   + +    +T 
Sbjct: 180 DIDYAWEEADTTYGKLGVKVWIYRGEVLPARKNTK 214


>gi|229821617|ref|YP_002883143.1| ribosomal protein S3 [Beutenbergia cavernae DSM 12333]
 gi|259495237|sp|C5C0I5|RS3_BEUC1 RecName: Full=30S ribosomal protein S3
 gi|229567530|gb|ACQ81381.1| ribosomal protein S3 [Beutenbergia cavernae DSM 12333]
          Length = 258

 Score =  258 bits (660), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 102/231 (44%), Positives = 151/231 (65%), Gaps = 4/231 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFAR----GSEYGALLHEDLKIREYLQCHLKQAGVAKIL 56
           MGQK+NP+ FRLG+     SRWFA     G  Y   + ED++IR+ +   L++AG++K+ 
Sbjct: 1   MGQKVNPLGFRLGITTDHRSRWFADSTKPGQRYRDYVREDVQIRKLMSTGLERAGISKVE 60

Query: 57  IERTHKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLI 116
           IERT    R+ +++ARPG++IG++G + +++R +L  +T  ++ L++ EV  PE++A L+
Sbjct: 61  IERTRDRVRVDLHTARPGIVIGRRGAEADRLRSELEKLTGKQVQLNILEVKNPELDAQLV 120

Query: 117 AQSIAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQ 176
           AQ IA+QL  RV FRRAM++ +QSA R GA GV+V  SGRL GAE+SR+E Y EGRVPL 
Sbjct: 121 AQGIAEQLASRVAFRRAMRKGMQSAQRAGAKGVRVQCSGRLGGAEMSRSEFYREGRVPLH 180

Query: 177 TLRAHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
           TLRA+IDYG   A T +G  G+KV++   D      +   A+        +
Sbjct: 181 TLRANIDYGFFEARTTFGRIGVKVWIYKGDMTEREFAREQASAAPRARGRA 231


>gi|299768672|ref|YP_003730698.1| 30S ribosomal protein S3 [Acinetobacter sp. DR1]
 gi|298698760|gb|ADI89325.1| 30S ribosomal protein S3 [Acinetobacter sp. DR1]
          Length = 250

 Score =  258 bits (660), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 111/226 (49%), Positives = 158/226 (69%), Gaps = 2/226 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI  RLGV    N+ W+A   +Y   L +DL++RE+L   LK A ++ ILIER 
Sbjct: 1   MGQKVHPIGIRLGVVKRHNANWYASPKQYAEYLLKDLQVREFLTKKLKNAMISNILIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               ++ + +ARPG++IGKKG DIEK++++L+++      +S+NE+ +P+++A L+A++I
Sbjct: 61  SGAAKVTISTARPGIVIGKKGEDIEKLQRELTSIMGVPAQVSINEIDRPDLDARLVAEAI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLE+RV+FRRAMKRAVQ+ MR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 ASQLEKRVMFRRAMKRAVQNTMRAGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD-SDSTIPA-AEHRVVE 224
            IDY T  AET YG+ G+KV++   + +        PA AE R  +
Sbjct: 181 DIDYATMRAETTYGTIGVKVWIFRGEILGGMKQVMNPAPAEDRPAK 226


>gi|295394342|ref|ZP_06804567.1| 30S ribosomal protein S3 [Brevibacterium mcbrellneri ATCC 49030]
 gi|294972800|gb|EFG48650.1| 30S ribosomal protein S3 [Brevibacterium mcbrellneri ATCC 49030]
          Length = 264

 Score =  258 bits (660), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 104/225 (46%), Positives = 156/225 (69%), Gaps = 8/225 (3%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSE----YGALLHEDLKIREYLQCHLKQAGVAKIL 56
           MGQKINP  FRLG+     S+WF   ++    Y   + ED++IRE LQ +L++AG++++ 
Sbjct: 1   MGQKINPNGFRLGITTDHKSKWFTDSNKRGQRYADFVGEDVRIREMLQNNLERAGLSRVN 60

Query: 57  IERTHKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLI 116
           IERT    R+ +++ARPG++IG++G + +++R +L  +T  +I L++ EV  PEI+A L+
Sbjct: 61  IERTRDRVRVDIHTARPGIVIGRRGAEADRLRGQLEKLTGKQIQLNILEVKNPEIDAQLV 120

Query: 117 AQSIAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQ 176
           AQ +A+QL  RV FRRAM++A+QSA R GA G++V  SGRL GAE+SR+E Y EGRVPL 
Sbjct: 121 AQGVAEQLASRVAFRRAMRKAIQSAQRAGAKGIRVQCSGRLGGAEMSRSEFYREGRVPLH 180

Query: 177 TLRAHIDYGTAVAETAYGSCGIKVYVSLRD----EVSDSDSTIPA 217
           TLRA+IDYG   A T +G  G+KV++   D    E++  ++  P+
Sbjct: 181 TLRANIDYGFYEAHTTFGRIGVKVWIYKGDLTDKELAAQEAAQPS 225


>gi|325981811|ref|YP_004294213.1| 30S ribosomal protein S3 [Nitrosomonas sp. AL212]
 gi|325531330|gb|ADZ26051.1| ribosomal protein S3 [Nitrosomonas sp. AL212]
          Length = 272

 Score =  258 bits (660), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 119/226 (52%), Positives = 162/226 (71%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP  FRL V+  W SRW+A  S + ++L+ED+K+R +L   LK A V KILIER 
Sbjct: 1   MGQKINPTGFRLSVHKNWLSRWYANSSNFASMLNEDIKVRNFLANRLKNASVGKILIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN RI ++S+RPG++IGKKG DIE +R +L       +H+++ E+ KPEI+A LIA +I
Sbjct: 61  SKNARITIFSSRPGVVIGKKGEDIEVLRSELQKRMGVPVHVNIEEIRKPEIDAQLIADNI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLE+R++FRRAMKRA+Q+AMR GA G+K+++SGRLNG E++RTE Y EGRVPL TLRA
Sbjct: 121 AQQLEKRIMFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGIEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            +DYGT+ A+T YG  GIKV++   + +   D       +   E +
Sbjct: 181 DLDYGTSEAKTTYGIIGIKVWIFKGELLGKDDQVNHLITNTNSENE 226


>gi|317125866|ref|YP_004099978.1| 30S ribosomal protein S3P [Intrasporangium calvum DSM 43043]
 gi|315589954|gb|ADU49251.1| SSU ribosomal protein S3P [Intrasporangium calvum DSM 43043]
          Length = 277

 Score =  258 bits (660), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 105/228 (46%), Positives = 149/228 (65%), Gaps = 4/228 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFAR----GSEYGALLHEDLKIREYLQCHLKQAGVAKIL 56
           MGQK+NP  FRLG+     S WFA     G  Y   + ED+ IR  ++  +++AG+AK+ 
Sbjct: 1   MGQKVNPHGFRLGITTDHRSHWFADSTKVGQRYRDYVKEDVAIRRLMEKGMERAGIAKVE 60

Query: 57  IERTHKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLI 116
           IERT    R+ +++ARPG++IG++G + ++IR +L  +T  ++ L++ EV  PEI++ L+
Sbjct: 61  IERTRDRVRVDIHTARPGIVIGRRGAEADRIRGELEKLTGKQVQLNILEVKNPEIDSQLV 120

Query: 117 AQSIAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQ 176
           AQ IA+QL  RV FRRAM++ +QSA R GA G++V  SGRLNGAE+SRTE Y EGRVPL 
Sbjct: 121 AQGIAEQLSARVSFRRAMRKGMQSAQRAGAKGIRVQVSGRLNGAEMSRTEFYREGRVPLH 180

Query: 177 TLRAHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVE 224
           TLRA IDYG   A T +G  G+KV++   D  +   +   AA  R   
Sbjct: 181 TLRAQIDYGFYEARTTFGRIGVKVWIYKGDMTAKELAAQQAAAPRPSR 228


>gi|327438284|dbj|BAK14649.1| ribosomal protein S3 [Solibacillus silvestris StLB046]
          Length = 218

 Score =  258 bits (660), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 98/219 (44%), Positives = 151/219 (68%), Gaps = 1/219 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI  R+GV   W S+WFA   +Y  LLHED+K+R+Y++  LK A V+K+ IER 
Sbjct: 1   MGQKVHPIGLRVGVIRDWESKWFAE-KDYANLLHEDIKVRKYIETKLKDASVSKVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                I +++A+PG++IGK GT++E +RK L+ +T   +H+++ E+ + +++A L+A++I
Sbjct: 60  ANRVNITIHTAKPGMVIGKGGTEVENLRKHLTEVTGKRVHINIIEIKRADLDAKLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE RV FRRA K+++Q  MR GA G+K   SGRL GA+++R E Y EG VPL TLRA
Sbjct: 120 ARQLENRVSFRRAQKQSIQRTMRAGAKGIKTQVSGRLGGADIARAEHYSEGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
            IDY  A A+T YG  G+KV++   + +    +++   +
Sbjct: 180 DIDYAHAEADTTYGKLGVKVWIYRGEVLPTKKNSVEGGK 218


>gi|160914553|ref|ZP_02076768.1| hypothetical protein EUBDOL_00559 [Eubacterium dolichum DSM 3991]
 gi|158433711|gb|EDP12000.1| hypothetical protein EUBDOL_00559 [Eubacterium dolichum DSM 3991]
          Length = 266

 Score =  258 bits (660), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 105/224 (46%), Positives = 143/224 (63%), Gaps = 2/224 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI  R+GV   W SRW+A   EY  LL ED+KIRE++   LK A V+++ IER+
Sbjct: 1   MGQKVSPIGLRVGVIRDWESRWYAD-KEYADLLLEDVKIREFIFKELKAASVSRVEIERS 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTN-SEIHLSVNEVPKPEINATLIAQS 119
                I++ +ARPG+IIG  G  IE ++KK+  +T    I+L V E+  P+++A L+A+S
Sbjct: 60  KNRVEIMIRTARPGVIIGTNGESIELLKKKIEKLTGGKNIYLKVLEIANPDLDAKLVARS 119

Query: 120 IAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           IA QLE+R  FR A KRA+Q  MR GA G+K   SGRL GA+++RTE Y EG VPL TLR
Sbjct: 120 IADQLEQRASFRTAQKRAIQRTMRAGAKGIKTAVSGRLGGADMARTEGYSEGNVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVV 223
           A IDY    A T YG  G+KV++   + +     T P A    +
Sbjct: 180 ADIDYAWEEAHTTYGRLGVKVWICRGEVLPGQMVTEPEAPKNPM 223


>gi|300933004|ref|ZP_07148260.1| 30S ribosomal protein S3 [Corynebacterium resistens DSM 45100]
          Length = 247

 Score =  258 bits (660), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 104/216 (48%), Positives = 149/216 (68%), Gaps = 2/216 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P   RLG+   W SRW+A   +Y   L ED+KIR++L   L +AG+A ++IERT
Sbjct: 1   MGQKIHPHGLRLGITSEWRSRWYAD-KQYADYLAEDIKIRDFLSKGLDRAGIADVVIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           H   R+ +++ARPG++IG++G++ ++IR +L  +T  ++ L++ EV   + NA L+AQSI
Sbjct: 60  HDRVRVDIHTARPGIVIGRRGSEADRIRGQLEKLTGKQVQLNILEVKNIDANAQLVAQSI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAM-RFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           A+QL  RV FRRAM++A+Q AM +    G+KV+ SGRL GAE+ RTE Y EGRVPL TLR
Sbjct: 120 AEQLTNRVAFRRAMRKAIQGAMRQPQVKGIKVVCSGRLGGAEMGRTERYHEGRVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTI 215
           A IDYGT  A T +G  G+KV++   D V     ++
Sbjct: 180 AEIDYGTYEAHTTFGRIGVKVWIYKGDVVGGRRESL 215


>gi|269219000|ref|ZP_06162854.1| ribosomal protein S3 [Actinomyces sp. oral taxon 848 str. F0332]
 gi|269212111|gb|EEZ78451.1| ribosomal protein S3 [Actinomyces sp. oral taxon 848 str. F0332]
          Length = 265

 Score =  258 bits (660), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 96/211 (45%), Positives = 142/211 (67%), Gaps = 4/211 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSE----YGALLHEDLKIREYLQCHLKQAGVAKIL 56
           MGQK+NP  FRLG+     S+WFA  ++    Y   + ED++IR  ++  L +AG++++ 
Sbjct: 1   MGQKVNPTGFRLGITTDHRSKWFADSNKPGQRYADFVREDIQIRRMIEKTLDRAGISRVN 60

Query: 57  IERTHKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLI 116
           IER  +   + +++ARPG++IG++G + +++R  L  +T   I L++ EV  PE +A L+
Sbjct: 61  IERRAERVVVDIHTARPGIVIGRRGAEADRLRADLEKLTGKAIQLNILEVKNPEADAQLV 120

Query: 117 AQSIAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQ 176
           AQ IA+QL  RV FRRAM++ +QSA R GA G++V  SGRL GAE+SR+E Y EGRVPL 
Sbjct: 121 AQGIAEQLASRVSFRRAMRKGIQSAERAGAKGIRVQCSGRLGGAEMSRSEFYREGRVPLH 180

Query: 177 TLRAHIDYGTAVAETAYGSCGIKVYVSLRDE 207
           TLRA+IDYG   A T +G  G+KV++   D 
Sbjct: 181 TLRANIDYGFYEARTTFGRIGVKVWIYRGDV 211


>gi|293375395|ref|ZP_06621676.1| ribosomal protein S3 [Turicibacter sanguinis PC909]
 gi|325844408|ref|ZP_08168135.1| ribosomal protein S3 [Turicibacter sp. HGF1]
 gi|292645948|gb|EFF63977.1| ribosomal protein S3 [Turicibacter sanguinis PC909]
 gi|325489082|gb|EGC91466.1| ribosomal protein S3 [Turicibacter sp. HGF1]
          Length = 219

 Score =  258 bits (659), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 95/219 (43%), Positives = 145/219 (66%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI  R+GV   W++RW+A   ++  LLHEDLKIR+++    K+A V+++ IER 
Sbjct: 1   MGQKVSPIGLRVGVIRDWDARWYANDKDFATLLHEDLKIRDFINNKFKKASVSRVEIERA 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                IIV++A+PG++IG+ G++ +    +L  MT   + + + E+ +PE++A L+A SI
Sbjct: 61  KNRVNIIVHTAKPGMVIGRGGSEKDAAVAQLEKMTGKRVFIRIVEIKRPEVDAQLVANSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE R  FRR  K A+Q A++FGA G+K   SGRL GA+++R E Y EG VPL TLRA
Sbjct: 121 AEQLENRASFRRVQKVAIQRAIKFGAKGIKTQVSGRLGGADMARAEGYSEGNVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
            IDY TA A+T YG  G+KV++   + +   +  +   +
Sbjct: 181 DIDYATAEADTTYGKLGVKVWIYKGEVLPTKNRQVKEGK 219


>gi|256827408|ref|YP_003151367.1| 30S ribosomal protein S3P [Cryptobacterium curtum DSM 15641]
 gi|256583551|gb|ACU94685.1| SSU ribosomal protein S3P [Cryptobacterium curtum DSM 15641]
          Length = 235

 Score =  258 bits (659), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 106/219 (48%), Positives = 149/219 (68%), Gaps = 1/219 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P  FR+GV   W SRW+A   +Y   L  DL IR +L  +L +A V+K+ IER 
Sbjct: 1   MGQKVSPTGFRIGVIENWRSRWYAD-KDYAKTLENDLAIRRFLDGYLTRAAVSKVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               ++++ +ARPG++IGKKG +I+ +RKKLS + +  I + V E+ +PE++A LIAQS+
Sbjct: 60  GDKIKVVITTARPGVVIGKKGAEIDTLRKKLSQVADGPISVEVIEIKRPELDANLIAQSV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE RV FRRAM++AVQSA + GA G+++  +GRL GAE+SR E Y EGRVPL TLRA
Sbjct: 120 AEQLEGRVAFRRAMRKAVQSARKSGAQGIRIQCAGRLGGAEMSRREWYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
            IDYG   A T  G+ G++V+V   + +       PA E
Sbjct: 180 KIDYGFTTANTQMGAIGVQVWVYHGEVLPGQKLPEPALE 218


>gi|169830024|ref|YP_001700182.1| 30S ribosomal protein S3 [Lysinibacillus sphaericus C3-41]
 gi|226697728|sp|B1HMX4|RS3_LYSSC RecName: Full=30S ribosomal protein S3
 gi|168994512|gb|ACA42052.1| 30S ribosomal protein S3 [Lysinibacillus sphaericus C3-41]
          Length = 217

 Score =  258 bits (659), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 98/213 (46%), Positives = 147/213 (69%), Gaps = 1/213 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI  R+G+   W S+W+A   +Y  LLHED+K+R+Y++  LK A V+K+ IER 
Sbjct: 1   MGQKVHPIGLRVGIIRDWESKWYAE-KDYATLLHEDIKVRKYIETALKDASVSKVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                I +++A+PG +IGK GT++E +RK LS +T   +H+++ E+ + +++A L+A++I
Sbjct: 60  ANRVNITIHTAKPGKVIGKGGTEVENLRKYLSELTGKRVHINIIEIKRADLDARLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE RV FRRA K+A+Q  +R GA G+K   SGRL GA+++R E Y EG VPL TLRA
Sbjct: 120 ARQLENRVSFRRAQKQAIQRTIRAGAKGIKTQVSGRLGGADIARAEHYSEGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDS 213
            IDY  A A+T YG  G+KV++   + +    S
Sbjct: 180 DIDYAHAEADTTYGKLGVKVWIYRGEVLPTKKS 212


>gi|11465774|ref|NP_053918.1| ribosomal protein S3 [Porphyra purpurea]
 gi|1710704|sp|P51308|RR3_PORPU RecName: Full=30S ribosomal protein S3, chloroplastic
 gi|1276774|gb|AAC08194.1| 30S ribosomal protein S3 [Porphyra purpurea]
          Length = 230

 Score =  258 bits (659), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 102/228 (44%), Positives = 141/228 (61%), Gaps = 2/228 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P+ FR+G+     S WFA   +Y  LL ED KIR ++   L  A +AKI I R 
Sbjct: 1   MGQKIHPLGFRIGITQKHRSSWFASSKDYSVLLQEDHKIRSFIHGKLSNASIAKIEINRK 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNM--TNSEIHLSVNEVPKPEINATLIAQ 118
                +++ +ARPG+++GK G  IE +R  L+ +   N +I ++V E+  P+  ATL+A+
Sbjct: 61  ADQVEVLIATARPGIVLGKSGAGIESLRNSLTLILDPNKQIRVNVVEISDPDSEATLVAE 120

Query: 119 SIAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTL 178
            I QQLE+RV FRRA+++AVQ A R    GVK+  SGRLNGAE++R+E   EGRVPLQTL
Sbjct: 121 FITQQLEKRVAFRRAVRQAVQRAQRANTQGVKIQVSGRLNGAEIARSEWVREGRVPLQTL 180

Query: 179 RAHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
           RA IDY    A T YG  G+KV++   + + DS     A     +  D
Sbjct: 181 RADIDYCHRQAHTTYGVLGVKVWLFKGELLPDSKVVELAPSQDQINPD 228


>gi|297623280|ref|YP_003704714.1| 30S ribosomal protein S3 [Truepera radiovictrix DSM 17093]
 gi|297164460|gb|ADI14171.1| ribosomal protein S3 [Truepera radiovictrix DSM 17093]
          Length = 264

 Score =  258 bits (659), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 106/226 (46%), Positives = 145/226 (64%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG KINP+ FRLGVN   +++W+A    Y  LL ED  IR  +   +  +GV++I IER 
Sbjct: 1   MGNKINPVGFRLGVNKEPSAKWYANTKTYAKLLAEDDLIRRTVTADVGHSGVSRIDIERA 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
             N  + +++A+PG++IG+ G  I+++R+KL ++    + ++V EV  P  NA LIAQ I
Sbjct: 61  AHNVNVTIHTAKPGVVIGRGGESIKQLRQKLDHLIGGTVAVNVQEVANPNTNAALIAQRI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLERR  FRRAMK+A+Q  M  GA GVK+  SGRL GAE +R E Y++GRVPLQTLRA
Sbjct: 121 AEQLERRFAFRRAMKQAIQRTMESGAKGVKIRCSGRLGGAEQARPESYMDGRVPLQTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKD 226
            IDYGTA A T YG  G+KV+V   + V D             ++D
Sbjct: 181 DIDYGTARANTTYGVIGVKVWVFHGELVGDKQRRAANLPRPRQDED 226


>gi|237749521|ref|ZP_04580001.1| small subunit ribosomal protein S3 [Oxalobacter formigenes OXCC13]
 gi|229380883|gb|EEO30974.1| small subunit ribosomal protein S3 [Oxalobacter formigenes OXCC13]
          Length = 282

 Score =  258 bits (659), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 116/225 (51%), Positives = 160/225 (71%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL V   W+SRW+A  + +  +L+EDLK R YL+  LK A V +++IER 
Sbjct: 1   MGQKIHPTGFRLAVARNWSSRWYAGNTNFAGMLNEDLKARAYLKKKLKNASVGQVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            KN R  +YS+RPG++IGKKG DIE ++  LS +    +H+++ EV KPEI+A LIA SI
Sbjct: 61  AKNARFTIYSSRPGVVIGKKGEDIEVLKSDLSKIMGVPVHVNIEEVRKPEIHAQLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLE+R++FRRAM+RA+Q+AMR GA G+K+++SGRLNG E++R E Y EGRVPL TLRA
Sbjct: 121 TQQLEKRIMFRRAMRRAMQNAMRLGAVGIKIMSSGRLNGIEIARKEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDYG + A+T YG  G+KV+V   D + + ++    A     +K
Sbjct: 181 DIDYGFSEAQTTYGIIGVKVWVYKGDRLENGEAPKIEAPAEEDKK 225


>gi|30018386|ref|NP_830017.1| 30S ribosomal protein S3 [Bacillus cereus ATCC 14579]
 gi|30260307|ref|NP_842684.1| 30S ribosomal protein S3 [Bacillus anthracis str. Ames]
 gi|42779197|ref|NP_976444.1| 30S ribosomal protein S3 [Bacillus cereus ATCC 10987]
 gi|47525372|ref|YP_016721.1| 30S ribosomal protein S3 [Bacillus anthracis str. 'Ames Ancestor']
 gi|49183150|ref|YP_026402.1| 30S ribosomal protein S3 [Bacillus anthracis str. Sterne]
 gi|49481663|ref|YP_034468.1| 30S ribosomal protein S3 [Bacillus thuringiensis serovar konkukian
           str. 97-27]
 gi|52145104|ref|YP_081727.1| 30S ribosomal protein S3 [Bacillus cereus E33L]
 gi|65317568|ref|ZP_00390527.1| COG0092: Ribosomal protein S3 [Bacillus anthracis str. A2012]
 gi|118475885|ref|YP_893036.1| 30S ribosomal protein S3 [Bacillus thuringiensis str. Al Hakam]
 gi|206972217|ref|ZP_03233164.1| 30S ribosomal protein S3 [Bacillus cereus AH1134]
 gi|217957691|ref|YP_002336235.1| 30S ribosomal protein S3 [Bacillus cereus AH187]
 gi|218232828|ref|YP_002364965.1| 30S ribosomal protein S3 [Bacillus cereus B4264]
 gi|218895251|ref|YP_002443662.1| ribosomal protein S3 [Bacillus cereus G9842]
 gi|218901320|ref|YP_002449154.1| ribosomal protein S3 [Bacillus cereus AH820]
 gi|222093886|ref|YP_002527936.1| 30S ribosomal protein s3 [Bacillus cereus Q1]
 gi|225862168|ref|YP_002747546.1| 30S ribosomal protein S3 [Bacillus cereus 03BB102]
 gi|227812789|ref|YP_002812798.1| 30S ribosomal protein S3 [Bacillus anthracis str. CDC 684]
 gi|228898869|ref|ZP_04063151.1| 30S ribosomal protein S3 [Bacillus thuringiensis IBL 4222]
 gi|228905913|ref|ZP_04069810.1| 30S ribosomal protein S3 [Bacillus thuringiensis IBL 200]
 gi|228912855|ref|ZP_04076502.1| 30S ribosomal protein S3 [Bacillus thuringiensis serovar pulsiensis
           BGSC 4CC1]
 gi|228919066|ref|ZP_04082445.1| 30S ribosomal protein S3 [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228925369|ref|ZP_04088465.1| 30S ribosomal protein S3 [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228931618|ref|ZP_04094524.1| 30S ribosomal protein S3 [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228937419|ref|ZP_04100065.1| 30S ribosomal protein S3 [Bacillus thuringiensis serovar berliner
           ATCC 10792]
 gi|228943922|ref|ZP_04106307.1| 30S ribosomal protein S3 [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|228950664|ref|ZP_04112798.1| 30S ribosomal protein S3 [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
 gi|228956557|ref|ZP_04118353.1| 30S ribosomal protein S3 [Bacillus thuringiensis serovar pakistani
           str. T13001]
 gi|228963216|ref|ZP_04124385.1| 30S ribosomal protein S3 [Bacillus thuringiensis serovar sotto str.
           T04001]
 gi|228970305|ref|ZP_04130964.1| 30S ribosomal protein S3 [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228976875|ref|ZP_04137287.1| 30S ribosomal protein S3 [Bacillus thuringiensis Bt407]
 gi|228983371|ref|ZP_04143584.1| 30S ribosomal protein S3 [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|229041021|ref|ZP_04189784.1| 30S ribosomal protein S3 [Bacillus cereus AH676]
 gi|229067881|ref|ZP_04201198.1| 30S ribosomal protein S3 [Bacillus cereus F65185]
 gi|229077416|ref|ZP_04210068.1| 30S ribosomal protein S3 [Bacillus cereus Rock4-2]
 gi|229089247|ref|ZP_04220528.1| 30S ribosomal protein S3 [Bacillus cereus Rock3-42]
 gi|229107802|ref|ZP_04237438.1| 30S ribosomal protein S3 [Bacillus cereus Rock1-15]
 gi|229119778|ref|ZP_04249039.1| 30S ribosomal protein S3 [Bacillus cereus 95/8201]
 gi|229125633|ref|ZP_04254665.1| 30S ribosomal protein S3 [Bacillus cereus BDRD-Cer4]
 gi|229136962|ref|ZP_04265589.1| 30S ribosomal protein S3 [Bacillus cereus BDRD-ST26]
 gi|229142922|ref|ZP_04271363.1| 30S ribosomal protein S3 [Bacillus cereus BDRD-ST24]
 gi|229148525|ref|ZP_04276781.1| 30S ribosomal protein S3 [Bacillus cereus m1550]
 gi|229153894|ref|ZP_04282024.1| 30S ribosomal protein S3 [Bacillus cereus ATCC 4342]
 gi|229159289|ref|ZP_04287313.1| 30S ribosomal protein S3 [Bacillus cereus R309803]
 gi|229176716|ref|ZP_04304120.1| 30S ribosomal protein S3 [Bacillus cereus 172560W]
 gi|229182510|ref|ZP_04309761.1| 30S ribosomal protein S3 [Bacillus cereus BGSC 6E1]
 gi|229188401|ref|ZP_04315449.1| 30S ribosomal protein S3 [Bacillus cereus ATCC 10876]
 gi|229194506|ref|ZP_04321309.1| 30S ribosomal protein S3 [Bacillus cereus m1293]
 gi|229604556|ref|YP_002864767.1| 30S ribosomal protein S3 [Bacillus anthracis str. A0248]
 gi|296500949|ref|YP_003662649.1| 30S ribosomal protein S3 [Bacillus thuringiensis BMB171]
 gi|300119571|ref|ZP_07057115.1| 30S ribosomal protein S3 [Bacillus cereus SJ1]
 gi|301051853|ref|YP_003790064.1| 30S ribosomal protein S3 [Bacillus anthracis CI]
 gi|34098359|sp|Q81J36|RS3_BACCR RecName: Full=30S ribosomal protein S3
 gi|34098360|sp|Q81VS4|RS3_BACAN RecName: Full=30S ribosomal protein S3
 gi|61215459|sp|Q63H84|RS3_BACCZ RecName: Full=30S ribosomal protein S3
 gi|61215553|sp|Q6HPQ2|RS3_BACHK RecName: Full=30S ribosomal protein S3
 gi|61215627|sp|Q73F90|RS3_BACC1 RecName: Full=30S ribosomal protein S3
 gi|152060846|sp|A0R8I6|RS3_BACAH RecName: Full=30S ribosomal protein S3
 gi|29893926|gb|AAP07218.1| SSU ribosomal protein S3P [Bacillus cereus ATCC 14579]
 gi|30253628|gb|AAP24170.1| 30S ribosomal protein S3 [Bacillus anthracis str. Ames]
 gi|42735112|gb|AAS39052.1| ribosomal protein S3 [Bacillus cereus ATCC 10987]
 gi|47500520|gb|AAT29196.1| ribosomal protein S3 [Bacillus anthracis str. 'Ames Ancestor']
 gi|49177077|gb|AAT52453.1| ribosomal protein S3 [Bacillus anthracis str. Sterne]
 gi|49333219|gb|AAT63865.1| ribosomal protein S3 (30S ribosomal protein S3) [Bacillus
           thuringiensis serovar konkukian str. 97-27]
 gi|51978573|gb|AAU20123.1| ribosomal protein S3 (30S ribosomal protein S3) [Bacillus cereus
           E33L]
 gi|118415110|gb|ABK83529.1| SSU ribosomal protein S3P [Bacillus thuringiensis str. Al Hakam]
 gi|206732791|gb|EDZ49966.1| 30S ribosomal protein S3 [Bacillus cereus AH1134]
 gi|217065283|gb|ACJ79533.1| ribosomal protein S3 [Bacillus cereus AH187]
 gi|218160785|gb|ACK60777.1| ribosomal protein S3 [Bacillus cereus B4264]
 gi|218538933|gb|ACK91331.1| ribosomal protein S3 [Bacillus cereus AH820]
 gi|218541179|gb|ACK93573.1| ribosomal protein S3 [Bacillus cereus G9842]
 gi|221237934|gb|ACM10644.1| ribosomal protein S3 (30S ribosomal protein S3) [Bacillus cereus
           Q1]
 gi|225789320|gb|ACO29537.1| 30S ribosomal protein S3 [Bacillus cereus 03BB102]
 gi|227002828|gb|ACP12571.1| 30S ribosomal protein S3 [Bacillus anthracis str. CDC 684]
 gi|228588972|gb|EEK46987.1| 30S ribosomal protein S3 [Bacillus cereus m1293]
 gi|228595075|gb|EEK52846.1| 30S ribosomal protein S3 [Bacillus cereus ATCC 10876]
 gi|228600965|gb|EEK58534.1| 30S ribosomal protein S3 [Bacillus cereus BGSC 6E1]
 gi|228606759|gb|EEK64176.1| 30S ribosomal protein S3 [Bacillus cereus 172560W]
 gi|228624181|gb|EEK80983.1| 30S ribosomal protein S3 [Bacillus cereus R309803]
 gi|228629575|gb|EEK86272.1| 30S ribosomal protein S3 [Bacillus cereus ATCC 4342]
 gi|228634941|gb|EEK91514.1| 30S ribosomal protein S3 [Bacillus cereus m1550]
 gi|228640543|gb|EEK96932.1| 30S ribosomal protein S3 [Bacillus cereus BDRD-ST24]
 gi|228646500|gb|EEL02707.1| 30S ribosomal protein S3 [Bacillus cereus BDRD-ST26]
 gi|228657825|gb|EEL13631.1| 30S ribosomal protein S3 [Bacillus cereus BDRD-Cer4]
 gi|228663679|gb|EEL19258.1| 30S ribosomal protein S3 [Bacillus cereus 95/8201]
 gi|228675651|gb|EEL30859.1| 30S ribosomal protein S3 [Bacillus cereus Rock1-15]
 gi|228694086|gb|EEL47768.1| 30S ribosomal protein S3 [Bacillus cereus Rock3-42]
 gi|228705892|gb|EEL58226.1| 30S ribosomal protein S3 [Bacillus cereus Rock4-2]
 gi|228715240|gb|EEL67099.1| 30S ribosomal protein S3 [Bacillus cereus F65185]
 gi|228727318|gb|EEL78512.1| 30S ribosomal protein S3 [Bacillus cereus AH676]
 gi|228776361|gb|EEM24714.1| 30S ribosomal protein S3 [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|228782845|gb|EEM31011.1| 30S ribosomal protein S3 [Bacillus thuringiensis Bt407]
 gi|228789414|gb|EEM37334.1| 30S ribosomal protein S3 [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228796474|gb|EEM43913.1| 30S ribosomal protein S3 [Bacillus thuringiensis serovar sotto str.
           T04001]
 gi|228803122|gb|EEM49944.1| 30S ribosomal protein S3 [Bacillus thuringiensis serovar pakistani
           str. T13001]
 gi|228809015|gb|EEM55500.1| 30S ribosomal protein S3 [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
 gi|228815755|gb|EEM61991.1| 30S ribosomal protein S3 [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|228822252|gb|EEM68234.1| 30S ribosomal protein S3 [Bacillus thuringiensis serovar berliner
           ATCC 10792]
 gi|228828046|gb|EEM73774.1| 30S ribosomal protein S3 [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228834291|gb|EEM79832.1| 30S ribosomal protein S3 [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228840591|gb|EEM85853.1| 30S ribosomal protein S3 [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228846791|gb|EEM91796.1| 30S ribosomal protein S3 [Bacillus thuringiensis serovar pulsiensis
           BGSC 4CC1]
 gi|228853728|gb|EEM98488.1| 30S ribosomal protein S3 [Bacillus thuringiensis IBL 200]
 gi|228860769|gb|EEN05147.1| 30S ribosomal protein S3 [Bacillus thuringiensis IBL 4222]
 gi|229268964|gb|ACQ50601.1| 30S ribosomal protein S3 [Bacillus anthracis str. A0248]
 gi|296322001|gb|ADH04929.1| 30S ribosomal protein S3 [Bacillus thuringiensis BMB171]
 gi|298723043|gb|EFI63941.1| 30S ribosomal protein S3 [Bacillus cereus SJ1]
 gi|300374022|gb|ADK02926.1| 30S ribosomal protein S3 [Bacillus cereus biovar anthracis str. CI]
 gi|324324107|gb|ADY19367.1| 30S ribosomal protein S3 [Bacillus thuringiensis serovar finitimus
           YBT-020]
 gi|326937911|gb|AEA13807.1| 30S ribosomal protein S3 [Bacillus thuringiensis serovar chinensis
           CT-43]
          Length = 219

 Score =  258 bits (659), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 102/220 (46%), Positives = 144/220 (65%), Gaps = 1/220 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI  R+GV   W SRWFA   +Y  LLHED+KIREY+   LK + VAK+ IER 
Sbjct: 1   MGQKVNPIGLRVGVIRDWESRWFAE-KDYATLLHEDIKIREYINVRLKDSAVAKVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                + +++A+PG++IGK GT++E +RK L+ +T   +H+++ EV + ++NA L+ ++I
Sbjct: 60  ANRVNVTIHTAKPGMVIGKGGTEVEALRKALNQLTGKRVHINILEVKRADLNAKLVGENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE RV FRRA K+ +Q AMR GA G+K   SGRL GA+++R E Y EG VPL TLRA
Sbjct: 120 ARQLENRVSFRRAQKQVIQRAMRAGAKGIKTQVSGRLGGADIARAESYSEGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEH 220
            IDY    A+T YG  G+KV++   + +            
Sbjct: 180 DIDYAAVEADTTYGKLGVKVWIYRGEVLPTKKKASEEGGK 219


>gi|71083798|ref|YP_266518.1| 30S ribosomal protein S3 [Candidatus Pelagibacter ubique HTCC1062]
 gi|91207827|sp|Q4FLM4|RS3_PELUB RecName: Full=30S ribosomal protein S3
 gi|71062911|gb|AAZ21914.1| 30S ribosomal protein S3 [Candidatus Pelagibacter ubique HTCC1062]
          Length = 226

 Score =  258 bits (659), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 110/226 (48%), Positives = 155/226 (68%), Gaps = 2/226 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP+ FRLGVN  W+S W+A+  ++G  L ED KIR Y++ ++  +GV+K++IERT
Sbjct: 1   MGQKVNPVGFRLGVNRGWDSVWYAKKKDFGNYLIEDFKIRAYIKKNVVNSGVSKVMIERT 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
              C + +Y++RPG +IGKKG+DI+KI+  LS  TN+E+ L++ EV KPE NA L+A++I
Sbjct: 61  SNKCFVTIYTSRPGFVIGKKGSDIDKIKNNLSKFTNNEVTLNIKEVKKPETNAYLVAENI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQL +R+ +RRAMKRA+QS +R GA G+KV  SGRL G E++RTE   EG +P  TLRA
Sbjct: 121 AQQLVKRISYRRAMKRAMQSCLRLGAKGIKVSISGRLGGNEIARTEWLREGSIPSHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDS--DSTIPAAEHRVVE 224
            IDY  A A T +G  GIK+++   +  +      T       V E
Sbjct: 181 DIDYAEAEALTTFGIIGIKIWIYKGEVFAKEFSQETNKIVPKEVKE 226


>gi|171778382|ref|ZP_02919561.1| hypothetical protein STRINF_00412 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
 gi|171282913|gb|EDT48337.1| hypothetical protein STRINF_00412 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
          Length = 217

 Score =  258 bits (659), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 94/215 (43%), Positives = 148/215 (68%), Gaps = 1/215 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI  R+G+   W+++W+A   EY   LHEDL IR+++Q  L  A V++I IER 
Sbjct: 1   MGQKVHPIGMRVGIIRDWDAKWYAE-KEYADYLHEDLAIRKFIQTELADASVSRIEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                + +++A+PG++IGK G +++ +R KL+ +T  ++H+++ E+ +P+++A L+ ++I
Sbjct: 60  VNKVIVSLHTAKPGMVIGKGGANVDALRAKLNKLTGKQVHINIVEIKQPDLDAHLVGENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE+RV FRRA K+A+Q  MR GA G+K   SGRLNGA+++R E Y EG VPL TLRA
Sbjct: 120 ARQLEQRVAFRRAQKQAIQRTMRAGAKGIKTQVSGRLNGADIARAEGYSEGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTI 215
            IDY    A+T YG  G+KV++   + +    +T 
Sbjct: 180 DIDYAWEEADTTYGKLGVKVWIYRGEVLPARKNTK 214


>gi|71282222|ref|YP_267616.1| 30S ribosomal protein S3 [Colwellia psychrerythraea 34H]
 gi|91207648|sp|Q487Z9|RS3_COLP3 RecName: Full=30S ribosomal protein S3
 gi|71147962|gb|AAZ28435.1| ribosomal protein S3 [Colwellia psychrerythraea 34H]
          Length = 231

 Score =  258 bits (659), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 110/224 (49%), Positives = 155/224 (69%), Gaps = 2/224 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   RLG+   + S WFA   ++ + L  D K+RE+L+  LK+A ++K++IER 
Sbjct: 1   MGQKVNPTGIRLGITKPFASTWFASNKDFASNLDGDHKVREFLKEKLKRASLSKVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  +S +      +++ EV KPE++A L+A SI
Sbjct: 61  AKSIRVTIHTARPGVVIGKKGEDVEKLRLAVSKIAGVPAQINIAEVRKPEMDAQLVADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GA+++R E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQNAMRLGAKGIKVQVSGRLGGADIARAEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEV--SDSDSTIPAAEHRV 222
            IDY  A   T YG  GIKV++   + +      + +PAA+ + 
Sbjct: 181 DIDYAIARGNTTYGVIGIKVWIFKGEIIGNMPLQAEVPAAKPKR 224


>gi|94987408|ref|YP_595341.1| 30S ribosomal protein S3 [Lawsonia intracellularis PHE/MN1-00]
 gi|123262113|sp|Q1MPQ7|RS3_LAWIP RecName: Full=30S ribosomal protein S3
 gi|94731657|emb|CAJ55020.1| ribosomal protein S3 [Lawsonia intracellularis PHE/MN1-00]
          Length = 213

 Score =  258 bits (659), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 107/208 (51%), Positives = 146/208 (70%), Gaps = 1/208 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P  FRLG N  W SRWF+   +Y   ++ED KIR Y++  L  AG++K+ IER 
Sbjct: 1   MGQKVHPYGFRLGYNKNWQSRWFS-KKDYANFIYEDYKIRSYIKKLLYSAGISKMEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                +++ +ARPG++IG+KG +IEK+R +L      E  L V EV +PE++A L+A++I
Sbjct: 60  GGKICLMLSTARPGIVIGRKGVEIEKLRLELRKNFGQEFSLEVTEVRRPEVDAQLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV FRRAMKR V  A +FGA+G+K+  SGRL GAE++RTE Y +GRVPLQTLRA
Sbjct: 120 AMQLERRVAFRRAMKRTVSMARKFGAEGIKITCSGRLAGAEIARTEWYRDGRVPLQTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEV 208
            IDYG A A T YG  G+KV++   + +
Sbjct: 180 DIDYGFAEAHTTYGIIGVKVWIYKGEVL 207


>gi|85858152|ref|YP_460354.1| 30S ribosomal protein S3 [Syntrophus aciditrophicus SB]
 gi|123752424|sp|Q2LQ95|RS3_SYNAS RecName: Full=30S ribosomal protein S3
 gi|85721243|gb|ABC76186.1| SSU ribosomal protein S3P [Syntrophus aciditrophicus SB]
          Length = 216

 Score =  258 bits (659), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 118/216 (54%), Positives = 157/216 (72%), Gaps = 1/216 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI  RLG+N  WNSRW+A    Y ++L+EDLKIR YL+  L  AG++ I IER 
Sbjct: 1   MGQKVNPIGLRLGINKNWNSRWYAD-KSYRSMLYEDLKIRGYLKKKLYHAGISHIDIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               ++ +Y+ARPG+IIGKKG +IEK++K+L N+++SEI +++ EV KPEI+A L+A++I
Sbjct: 60  VNKAKVNIYAARPGIIIGKKGAEIEKLKKELENVSSSEIIINILEVRKPEIDAQLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV FRRAMK+ V +A++FGA G++V  SGRL GAE+SRTE Y EGRVPL TLRA
Sbjct: 120 ATQLERRVAFRRAMKKCVLTALKFGAKGIRVSCSGRLGGAEMSRTEWYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIP 216
            ID G   A+TAYG  GIKV +   + +        
Sbjct: 180 DIDSGFTEAKTAYGQIGIKVLIFHGEVLPGRKELEK 215


>gi|111023102|ref|YP_706074.1| 30S ribosomal protein S3 [Rhodococcus jostii RHA1]
 gi|226365601|ref|YP_002783384.1| 30S ribosomal protein S3 [Rhodococcus opacus B4]
 gi|122955192|sp|Q0S3H0|RS3_RHOSR RecName: Full=30S ribosomal protein S3
 gi|254764542|sp|C1B018|RS3_RHOOB RecName: Full=30S ribosomal protein S3
 gi|110822632|gb|ABG97916.1| 30S ribosomal protein S3 [Rhodococcus jostii RHA1]
 gi|226244091|dbj|BAH54439.1| 30S ribosomal protein S3 [Rhodococcus opacus B4]
          Length = 268

 Score =  258 bits (659), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 100/217 (46%), Positives = 144/217 (66%), Gaps = 2/217 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP  FRLG+   W SRW+A   +Y   + ED+ IR+ L   +++AG+AK+ IERT
Sbjct: 1   MGQKINPHGFRLGITTDWKSRWYAD-KQYAEYVKEDVAIRKLLATGMERAGIAKVEIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG++G + ++IR +L  +T  ++ L++ EV   E  A L+AQ +
Sbjct: 60  RDRVRVDIHTARPGIVIGRRGAEADRIRSELEKLTGKQVQLNILEVKNAEAEAQLVAQGV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAM-RFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           A+QL  RV FRRAM++A+QSAM +    G++V  SGRL GAE+SR+E Y EGRVPL TLR
Sbjct: 120 AEQLSNRVAFRRAMRKAIQSAMRQPNVKGIRVQCSGRLGGAEMSRSEFYREGRVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIP 216
           A IDYG   A+T +G  G+KV++   D V        
Sbjct: 180 ADIDYGLYEAKTTFGRIGVKVWIYKGDIVGGKRELAA 216


>gi|329118604|ref|ZP_08247308.1| 30S ribosomal protein S3 [Neisseria bacilliformis ATCC BAA-1200]
 gi|327465339|gb|EGF11620.1| 30S ribosomal protein S3 [Neisseria bacilliformis ATCC BAA-1200]
          Length = 231

 Score =  258 bits (659), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 113/227 (49%), Positives = 163/227 (71%), Gaps = 3/227 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P  FRL VN  W+S+WFA+  ++  +L +D+ +REYL+  L  A V ++LIER 
Sbjct: 1   MGQKIHPTGFRLAVNKNWSSKWFAKTGDFSNVLKQDIDVREYLRKRLANASVGRVLIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ RI +YSARPG++IG+KG DIE +++ L N+    +H+++ E+ KPE++A +IA  I
Sbjct: 61  AKSARITIYSARPGIVIGRKGEDIEVLKQDLQNLLGVPVHVNIEEIRKPELDAQIIADGI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLE+RV FRRAMKRA+Q+AMR GA GVK++ SGRLNGA+++R+E Y EGRVPL TLRA
Sbjct: 121 AQQLEKRVQFRRAMKRAMQNAMRVGAKGVKIMTSGRLNGADIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
           ++DY T+ A T YG  G+KV+V   +    ++S    +E     + +
Sbjct: 181 NVDYATSEAHTTYGVIGLKVWVYTGE---GNESIQSKSEQENKRRKA 224


>gi|148544690|ref|YP_001272060.1| 30S ribosomal protein S3 [Lactobacillus reuteri DSM 20016]
 gi|184154043|ref|YP_001842384.1| 30S ribosomal protein S3 [Lactobacillus reuteri JCM 1112]
 gi|194466947|ref|ZP_03072934.1| ribosomal protein S3 [Lactobacillus reuteri 100-23]
 gi|227363813|ref|ZP_03847920.1| 30S ribosomal protein S3 [Lactobacillus reuteri MM2-3]
 gi|227543617|ref|ZP_03973666.1| 30S ribosomal protein S3 [Lactobacillus reuteri CF48-3A]
 gi|300909354|ref|ZP_07126815.1| 30S ribosomal protein S3 [Lactobacillus reuteri SD2112]
 gi|325683024|ref|ZP_08162540.1| 30S ribosomal protein S3 [Lactobacillus reuteri MM4-1A]
 gi|172048239|sp|A5VLJ9|RS3_LACRD RecName: Full=30S ribosomal protein S3
 gi|148531724|gb|ABQ83723.1| SSU ribosomal protein S3P [Lactobacillus reuteri DSM 20016]
 gi|183225387|dbj|BAG25904.1| 30S ribosomal protein S3 [Lactobacillus reuteri JCM 1112]
 gi|194453983|gb|EDX42880.1| ribosomal protein S3 [Lactobacillus reuteri 100-23]
 gi|227071170|gb|EEI09486.1| 30S ribosomal protein S3 [Lactobacillus reuteri MM2-3]
 gi|227186457|gb|EEI66528.1| 30S ribosomal protein S3 [Lactobacillus reuteri CF48-3A]
 gi|300893219|gb|EFK86578.1| 30S ribosomal protein S3 [Lactobacillus reuteri SD2112]
 gi|324977374|gb|EGC14325.1| 30S ribosomal protein S3 [Lactobacillus reuteri MM4-1A]
          Length = 221

 Score =  258 bits (659), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 93/219 (42%), Positives = 147/219 (67%), Gaps = 1/219 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP  FR+GV   W ++W+A   ++   L+EDL+IR+Y++  L  A V+ + IER 
Sbjct: 1   MGQKINPNGFRVGVIRDWTAKWYAD-KDFADYLNEDLRIRKYIEKRLADASVSTVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                + +++A+PG++IGK G+++E +RK+L+ +T   +H+++ E+ KP+++A L+ +SI
Sbjct: 60  ANRVNVSIHTAKPGMVIGKGGSEVEALRKELNKLTGKRVHINIVEIKKPDLDAHLVGESI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE R+ FRRAM+ A+Q AMR GA G+K   +GRLNGA++SR E Y +G VPL TLRA
Sbjct: 120 ARQLEARIAFRRAMRGAMQRAMRAGAKGIKTQVAGRLNGADMSRIESYSDGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
            IDY    A T YG  G+K ++   + +    ++    +
Sbjct: 180 DIDYSWDEANTTYGVLGVKTWIYRGEVLPTKKNSNNDEQ 218


>gi|320548049|ref|ZP_08042329.1| 30S ribosomal protein S3 [Streptococcus equinus ATCC 9812]
 gi|320447291|gb|EFW88054.1| 30S ribosomal protein S3 [Streptococcus equinus ATCC 9812]
          Length = 217

 Score =  258 bits (659), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 95/215 (44%), Positives = 149/215 (69%), Gaps = 1/215 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI  R+G+   W+++W+A   EY   LHEDL IR+++Q  L  A V++I IER 
Sbjct: 1   MGQKVHPIGMRVGIIRDWDAKWYAE-KEYADYLHEDLAIRKFIQTELADASVSRIEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                + +++A+PG++IGK G +++ +R KL+ +T  ++H+++ E+ +P+++A L+ ++I
Sbjct: 60  VNKVIVSLHTAKPGMVIGKGGANVDALRVKLNKLTGKQVHINIVEIKQPDLDAHLVGENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE+RV FRRA K+A+Q AMR GA G+K   SGRLNGA+++R E Y EG VPL TLRA
Sbjct: 120 ARQLEQRVAFRRAQKQAIQRAMRAGAKGIKTQVSGRLNGADIARAEGYSEGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTI 215
            IDY    A+T YG  G+KV++   + +    +T 
Sbjct: 180 DIDYAWEEADTTYGKLGVKVWIYRGEVLPARKNTK 214


>gi|326803039|ref|YP_004320857.1| ribosomal protein S3 [Aerococcus urinae ACS-120-V-Col10a]
 gi|326650398|gb|AEA00581.1| ribosomal protein S3 [Aerococcus urinae ACS-120-V-Col10a]
          Length = 216

 Score =  258 bits (659), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 100/217 (46%), Positives = 150/217 (69%), Gaps = 1/217 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP   R+GV   W++RWF    +Y   LHEDL +R+Y++  LK A ++++ IER 
Sbjct: 1   MGQKINPTGLRIGVIKDWDARWF-EEKDYANTLHEDLAVRDYIEDALKDASISQVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                I V++A+PG++IGK G+++EK+RK L+ +T   +H++V EV +P+++A L+ ++I
Sbjct: 60  ANKVNINVHTAKPGMVIGKGGSEVEKLRKDLNQLTGKRVHINVIEVKQPDLSAELVGENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLE R+ FRRAMK+A+Q  M+ GA G+KV  SGRLNGA+++RTE   EG VPL TLRA
Sbjct: 120 AQQLENRIAFRRAMKQAIQRTMKAGAQGIKVQVSGRLNGADMARTEALDEGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPA 217
            IDY    A+T YG  G+KV++   + +  +++    
Sbjct: 180 DIDYAWVEADTTYGKIGVKVWICRGEVLPTTNNQEEE 216


>gi|302669967|ref|YP_003829927.1| ribosomal protein S3 RpsC [Butyrivibrio proteoclasticus B316]
 gi|302394440|gb|ADL33345.1| ribosomal protein S3 RpsC [Butyrivibrio proteoclasticus B316]
          Length = 223

 Score =  258 bits (659), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 99/219 (45%), Positives = 146/219 (66%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   R+GV   W+S+W+A  +++   L ED  IR++L+  L  AGV+KI IER 
Sbjct: 1   MGQKVNPHGLRVGVIADWDSKWYAESADFANNLVEDYNIRKFLKKKLYAAGVSKIEIERA 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               ++IVY+A+PG++IGK G +IE  +K+LS +T+ ++ + + E+ KP+ +A L+A++I
Sbjct: 61  SDRVKVIVYTAKPGVVIGKGGAEIEVTKKELSKLTDKKVLVDIKEIKKPDKDAQLVAENI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLE RV FRRAMK  +   M+  A G+K   SGRL GA+++R+E Y EG +PLQTLRA
Sbjct: 121 AQQLENRVSFRRAMKSCMSRTMKTDALGIKACCSGRLGGADIARSEFYSEGTIPLQTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
            IDYG A A+T YG  G+KV++   + +          E
Sbjct: 181 DIDYGFAEADTTYGKVGVKVWIYKGEVLPTKAGENSDKE 219


>gi|46199624|ref|YP_005291.1| 30S ribosomal protein S3 [Thermus thermophilus HB27]
 gi|55981655|ref|YP_144952.1| 30S ribosomal protein S3 [Thermus thermophilus HB8]
 gi|24212666|sp|P80372|RS3_THET8 RecName: Full=30S ribosomal protein S3
 gi|50401227|sp|P62663|RS3_THET2 RecName: Full=30S ribosomal protein S3
 gi|10835587|pdb|1FJG|C Chain C, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit In Complex With The Antibiotics Streptomycin,
           Spectinomycin, And Paromomycin
 gi|13096396|pdb|1HR0|C Chain C, Crystal Structure Of Initiation Factor If1 Bound To The
           30s Ribosomal Subunit
 gi|13399794|pdb|1HNW|C Chain C, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit In Complex With Tetracycline
 gi|13399816|pdb|1HNX|C Chain C, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit In Complex With Pactamycin
 gi|13399838|pdb|1HNZ|C Chain C, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit In Complex With Hygromycin B
 gi|14278012|pdb|1GIX|F Chain F, Crystal Structure Of The Ribosome At 5.5 A Resolution.
           This File, 1gix, Contains The 30s Ribosome Subunit,
           Three Trna, And Mrna Molecules. 50s Ribosome Subunit Is
           In The File 1giy
 gi|14278058|pdb|1IBK|C Chain C, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit In Complex With The Antibiotic Paromomycin
 gi|14278079|pdb|1IBL|C Chain C, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit In Complex With A Messenger Rna Fragment And
           Cognate Transfer Rna Anticodon Stem-Loop Bound At The A
           Site And With The Antibiotic Paromomycin
 gi|14278103|pdb|1IBM|C Chain C, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit In Complex With A Messenger Rna Fragment And
           Cognate Transfer Rna Anticodon Stem-Loop Bound At The A
           Site
 gi|15826122|pdb|1JGO|F Chain F, The Path Of Messenger Rna Through The Ribosome. This File,
           1jgo, Contains The 30s Ribosome Subunit, Three Trna, And
           Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy
 gi|15826147|pdb|1JGP|F Chain F, The Path Of Messenger Rna Through The Ribosome. This File,
           1jgp, Contains The 30s Ribosome Subunit, Three Trna, And
           Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy
 gi|15826172|pdb|1JGQ|F Chain F, The Path Of Messenger Rna Through The Ribosome. This File,
           1jgq, Contains The 30s Ribosome Subunit, Three Trna, And
           Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy
 gi|20663888|pdb|1J5E|C Chain C, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit
 gi|27065878|pdb|1N32|C Chain C, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit Bound To Codon And Near-Cognate Transfer Rna
           Anticodon Stem-Loop Mismatched At The First Codon
           Position At The A Site With Paromomycin
 gi|27065905|pdb|1N33|C Chain C, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit Bound To Codon And Near-Cognate Transfer Rna
           Anticodon Stem-Loop Mismatched At The Second Codon
           Position At The A Site With Paromomycin
 gi|27065932|pdb|1N34|C Chain C, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit In The Presence Of Codon And
           Crystallographically Disordered Near-Cognate Transfer
           Rna Anticodon Stem-Loop Mismatched At The First Codon
           Position
 gi|27065958|pdb|1N36|C Chain C, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit In The Presence Of Crystallographically
           Disordered Codon And Near-Cognate Transfer Rna Anticodon
           Stem-Loop Mismatched At The Second Codon Position
 gi|28373701|pdb|1ML5|F Chain F, Structure Of The E. Coli Ribosomal Termination Complex
           With Release Factor 2
 gi|58177402|pdb|1XMO|C Chain C, Crystal Structure Of Mnm5u34t6a37-Trnalysuuu Complexed
           With Aag-Mrna In The Decoding Center
 gi|58177425|pdb|1XMQ|C Chain C, Crystal Structure Of T6a37-Asllysuuu Aaa-Mrna Bound To The
           Decoding Center
 gi|58177466|pdb|1XNQ|C Chain C, Structure Of An Inosine-Adenine Wobble Base Pair Complex
           In The Context Of The Decoding Center
 gi|58177489|pdb|1XNR|C Chain C, Crystal Structure Of An Inosine-Cytosine Wobble Base Pair
           In The Context Of The Decoding Center
 gi|66361056|pdb|1YL4|F Chain F, Crystal Structure Of 70s Ribosome With Thrs Operator And
           Trnas. 30s Subunit. The Coordinates For The 50s Subunit
           Are In The Pdb Entry 1yl3
 gi|88192238|pdb|2B64|C Chain C, 30s Ribosomal Subunit, Trnas, Mrna And Release Factor Rf1
           From A Crystal Structure Of The Whole Ribosomal Complex.
           This File Contains The 30s Subunit, Trnas, Mrna And
           Release Factor Rf1 From A Crystal Structure Of The Whole
           Ribosomal Complex". The Entire Crystal Structure
           Contains One 70s Ribosome, Trnas, Mrna And Release
           Factor Rf1 And Is Described In Remark 400.
 gi|88192301|pdb|2B9M|C Chain C, 30s Ribosomal Subunit, Trnas, Mrna And Release Factor Rf2
           From A Crystal Structure Of The Whole Ribosomal Complex.
           This File Contains The 30s Ribosomal Subunit, Trnas,
           Mrna And Release Factor Rf2 From A Crystal Structure Of
           The Whole Ribosomal Complex". The Entire Crystal
           Structure Contains One 70s Ribosome, Trnas, Mrna And
           Release Factor Rf2 And Is Described In Remark 400.
 gi|88192357|pdb|2B9O|C Chain C, 30s Ribosomal Subunit, Trnas And Mrna From A Crystal
           Structure Of The Whole Ribosomal Complex With A Stop
           Codon In The A-Site. This File Contains The 30s Subunit,
           Trnas And Mrna From A Crystal Structure Of The Whole
           Ribosomal Complex With A Stop Codon In The A-Site And Is
           Described In Remark 400.
 gi|110591325|pdb|2F4V|C Chain C, 30s Ribosome + Designer Antibiotic
 gi|116667656|pdb|2HHH|C Chain C, Crystal Structure Of Kasugamycin Bound To The 30s
           Ribosomal Subunit
 gi|116668199|pdb|2J00|C Chain C, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Mrna, Trna And Paromomycin (Part 1 Of 4).
           This File Contains The 30s Subunit, Mrna, A-, P- And
           E-Site Trnas And Paromomycin For Molecule I.
 gi|116668260|pdb|2J02|C Chain C, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Mrna, Trna And Paromomycin (Part 3 Of 4)
           This File Contains The 30s Subunit, Mrna, A-, P- And
           E-Site Trnas And Paromomycin For Molecule Ii.
 gi|119389714|pdb|2HGI|F Chain F, Crystal Structure Of The 70s Thermus Thermophilus Ribosome
           Showing How The 16s 3'-End Mimicks Mrna E And P Codons.
           This Entry 2hgi Contains 30s Ribosomal Subunit. The 50s
           Ribosomal Subunit Can Be Found In Pdb Entry 2hgj.
 gi|119389771|pdb|2HGP|F Chain F, Crystal Structure Of The 70s Thermus Thermophilus Ribosome
           With Translocated And Rotated Shine-Dalgarno Duplex.
           This Entry 2hgp Contains 30s Ribosomal Subunit. The 50s
           Ribosomal Subunit Can Be Found In Pdb Entry 2hgq.
 gi|119389827|pdb|2HGR|F Chain F, 70s T.Th. Ribosome Functional Complex With Mrna And E- And
           P-Site Trnas At 4.5a. This Entry 2hgr Contains 30s
           Ribosomal Subunit. The 50s Ribosomal Subunit Can Be
           Found In Pdb Entry 2hgu.
 gi|149242710|pdb|2OW8|DD Chain d, Crystal Structure Of A 70s Ribosome-Trna Complex Reveals
           Functional Interactions And Rearrangements. This File,
           2ow8, Contains The 30s Ribosome Subunit, Two Trna, And
           Mrna Molecules. 50s Ribosome Subunit Is In The File
           1vsa.
 gi|149243620|pdb|2UU9|C Chain C, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit Complexed With A Valine-Asl With Cmo5u In
           Position 34 Bound To An Mrna With A Gug-Codon In The
           A-Site And Paromomycin.
 gi|149243647|pdb|2UUA|C Chain C, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit Complexed With A Valine-Asl With Cmo5u In
           Position 34 Bound To An Mrna With A Guc-Codon In The
           A-Site And Paromomycin.
 gi|149243674|pdb|2UUB|C Chain C, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit Complexed With A Valine-Asl With Cmo5u In
           Position 34 Bound To An Mrna With A Guu-Codon In The
           A-Site And Paromomycin.
 gi|149243701|pdb|2UUC|C Chain C, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit Complexed With A Valine-Asl With Cmo5u In
           Position 34 Bound To An Mrna With A Gua-Codon In The
           A-Site And Paromomycin.
 gi|149243840|pdb|2UXC|C Chain C, Crystal Structure Of An Extended Trna Anticodon Stem Loop
           In Complex With Its Cognate Mrna Ucgu In The Context Of
           The Thermus Thermophilus 30s Subunit.
 gi|157836410|pdb|2UXB|C Chain C, Crystal Structure Of An Extended Trna Anticodon Stem Loop
           In Complex With Its Cognate Mrna Gggu In The Context Of
           The Thermus Thermophilus 30s Subunit.
 gi|157836487|pdb|2V46|C Chain C, Structure Of The Ribosome Recycling Factor Bound To The
           Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe And
           Trna-Fmet (Part 1 Of 4). This File Contains The 30s
           Subunit, Mrna, P-Site Asl, E-Site Trna And Rrf For
           Molecule 1.
 gi|157836543|pdb|2V48|C Chain C, Structure Of The Ribosome Recycling Factor Bound To The
           Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe And
           Trna-Fmet (Part 3 Of 4). This File Contains The 30s
           Subunit, Mrna, P-Site Asl, E-Site Trna And Rrf For
           Molecule 2.
 gi|158430902|pdb|2UXD|C Chain C, Crystal Structure Of An Extended Trna Anticodon Stem Loop
           In Complex With Its Cognate Mrna Cggg In The Context Of
           The Thermus Thermophilus 30s Subunit.
 gi|160285941|pdb|2QNH|DD Chain d, Interactions And Dynamics Of The Shine-Dalgarno Helix In
           The 70s Ribosome. This File, 2qnh, Contains The 30s
           Ribosome Subunit, Two Trna, And Mrna Molecules. 50s
           Ribosome Subunit Is In The File 1vsp.
 gi|186972851|pdb|2VQE|C Chain C, Modified Uridines With C5-Methylene Substituents At The
           First Position Of The Trna Anticodon Stabilize U-G
           Wobble Pairing During Decoding
 gi|186972874|pdb|2VQF|C Chain C, Modified Uridines With C5-Methylene Substituents At The
           First Position Of The Trna Anticodon Stabilize U-G
           Wobble Pairing During Decoding
 gi|209156498|pdb|3D5A|C Chain C, Structural Basis For Translation Termination On The 70s
           Ribosome. This File Contains The 30s Subunit, Release
           Factor 1 (Rf1), Two Trna, And Mrna Molecules Of One 70s
           Ribosome. The Entire Crystal Structure Contains Two 70s
           Ribosomes As Described In Remark 400.
 gi|209156554|pdb|3D5C|C Chain C, Structural Basis For Translation Termination On The 70s
           Ribosome. This File Contains The 30s Subunit, Release
           Factor 1 (Rf1), Two Trna, And Mrna Molecules Of The
           Second 70s Ribosome. The Entire Crystal Structure
           Contains Two 70s Ribosomes As Described In Remark 400.
 gi|211938821|pdb|2JL5|C Chain C, Insights Into Translational Termination From The Structure
           Of Rf2 Bound To The Ribosome (Part 1 Of 4). This File
           Contains The 30s Subunit.
 gi|211938879|pdb|2JL7|C Chain C, Insights Into Translational Termination From The Structure
           Of Rf2 Bound To The Ribosome (Part 3 Of 4). This File
           Contains The 30s Subunit.
 gi|218766775|pdb|3F1E|C Chain C, Crystal Structure Of A Translation Termination Complex
           Formed With Release Factor Rf2. This File Contains The
           30s Subunit, Rf2, Two Trna, And Mrna Molecules Of One
           70s Ribosome. The Entire Crystal Structure Contains Two
           70s Ribosomes As Described In Remark 400.
 gi|218766831|pdb|3F1G|C Chain C, Crystal Structure Of A Translation Termination Complex
           Formed With Release Factor Rf2. This File Contains The
           30s Subunit, Rf2, Two Trna, And Mrna Molecules Of The
           Second 70s Ribosome. The Entire Crystal Structure
           Contains Two 70s Ribosomes As Described In Remark 400.
 gi|226887376|pdb|2WDG|C Chain C, Structure Of The Thermus Thermophilus 70s Ribosome In
           Complex With Mrna, Paromomycin, Acylated A-Site Trna,
           Deacylated P-Site Trna, And E-Site Trna.  This File
           Contains The 30s Subunit A-,P-, And E-Site Trnas And
           Paromomycin For Molecule I.
 gi|226887401|pdb|2WDH|C Chain C, Structure Of The Thermus Thermophilus 70s Ribosome In
           Complex With Mrna, Paromomycin, Acylated A-Site Trna,
           Deacylated P-Site Trna, And E-Site Trna.  This File
           Contains The 30s Subunit A-,P-, And E-Site Trnas And
           Paromomycin For Molecule Ii.
 gi|226887490|pdb|2WDK|C Chain C, Structure Of The Thermus Thermophilus 70s Ribosome In
           Complex With Mrna, Paromomycin, Acylated A- And P-Site
           Trnas, And E-Site Trna.  This File Contains The 30s
           Subunit A-,P-, And E-Site Trnas And Paromomycin For
           Molecule I.
 gi|226887547|pdb|2WDM|C Chain C, Structure Of The Thermus Thermophilus 70s Ribosome In
           Complex With Mrna, Paromomycin, Acylated A- And P-Site
           Trnas, And E-Site Trna.  This File Contains The 30s
           Subunit A-,P-, And E-Site Trnas And Paromomycin For
           Molecule Ii.
 gi|237823531|pdb|2WH1|C Chain C, Insights Into Translational Termination From The Structure
           Of Rf2 Bound To The Ribosome
 gi|237823590|pdb|2WH3|C Chain C, Insights Into Translational Termination From The Structure
           Of Rf2 Bound To The Ribosome). This File Contains The
           30s Subunit.
 gi|260099988|pdb|3HUW|C Chain C, Structure Of Ef-P Bound To The 70s Ribosome; This File
           Contains The 30s Subunit, Mrna, P-Site Trna And Ef-P For
           Molecule I.
 gi|260100044|pdb|3HUY|C Chain C, Structure Of Ef-P Bound To The 70s Ribosome; This File
           Contains The 30s Subunit, Mrna, P-Site Trna And Ef-P For
           Molecule Ii.
 gi|261824486|pdb|2WRI|C Chain C, The Structure Of The Ribosome With Elongation Factor G
           Trapped In The Post-Translocational State (Part 1 Of 4).
 gi|261824548|pdb|2WRK|C Chain C, The Structure Of The Ribosome With Elongation Factor G
           Trapped In The Post-Translocational State (Part 3 Of 4).
 gi|261824610|pdb|2WRN|C Chain C, The Crystal Structure Of The 70s Ribosome Bound To Ef-Tu
           And Trna (Part 1 Of 4).
 gi|261824669|pdb|2WRQ|C Chain C, The Crystal Structure Of The 70s Ribosome Bound To Ef-Tu
           And Trna (Part 3 Of 4).
 gi|281307169|pdb|3KIQ|CC Chain c, Structure Of Rele Nuclease Bound To The 70s Ribosome
           (Precleavage State; Part 1 Of 4)
 gi|281307227|pdb|3KIS|CC Chain c, Structure Of Rele Nuclease Bound To The 70s Ribosome
           (Precleavage State; Part 3 Of 4)
 gi|281307285|pdb|3KIU|CC Chain c, Structure Of Rele Nuclease Bound To The 70s Ribosome
           (Postcleavage State; Part 1 Of 4)
 gi|281307343|pdb|3KIX|CC Chain c, Structure Of Rele Nuclease Bound To The 70s Ribosome
           (Postcleavage State; Part 3 Of 4)
 gi|288965606|pdb|3KNH|C Chain C, The Structures Of Viomycin Bound To The 70s Ribosome. This
           File Contains The 30s Subunit For Molecule I
 gi|289526684|pdb|3KNJ|C Chain C, The Structures Of Viomycin Bound To The 70s Ribosome. This
           File Contains The 30s Subunit For Molecule Ii'
 gi|289526709|pdb|3KNL|C Chain C, The Structures Of Capreomycin Bound To The 70s Ribosome.
           This File Contains The 30s Subunit For Molecule I
 gi|289526734|pdb|3KNN|C Chain C, The Structures Of Capreomycin Bound To The 70s Ribosome.
           This File Contains The 30s Subunit For Molecule Ii
 gi|294979506|pdb|3I8G|F Chain F, Elongation Complex Of The 70s Ribosome With Three Trnas
           And Entry 3i8g Contains 30s Ribosomal Subnit.The 50s
           Ribosomal Can Be Found In Pdb Entry 3i8f. Molecule B In
           The Same Asym Unit Is Deposited As 3i8g (30s) And 3i8f
           (50s).
 gi|294979531|pdb|3I8H|F Chain F, Elongation Complex Of The 70s Ribosome With Three Trnas
           And Entry 3i8h Contains 30s Ribosomal Subnit. The 50s
           Ribosomal Can Be Found In Pdb Entry 3i8i. Molecule A In
           The Same Asym Unit Is Deposited As 3i8f (50s) And 3i8g
           (30s).
 gi|294979590|pdb|3I9B|F Chain F, Initiation Complex Of 70s Ribosome With Two Trnas And
           Mrna. 3i9b Contains 30s Ribosomal Subunit Of Molecule B.
           The 50s Subunit Can Be Found In Pdb Entry 3i9c. Molecule
           A In The S Asymmetric Unit Is Deposited As 3i9d (30s)
           And 3i9e (50s)
 gi|294979644|pdb|3I9D|F Chain F, Initiation Complex Of 70s Ribosome With Two Trnas And
           Mrna. 3i9d Contains 30s Ribosomal Subunit Of Molecule A.
           The 50s Subunit Can Be Found In Pdb Entry 3i9e. Molecule
           B In The S Asymmetric Unit Is Deposited As 3i9b (30s)
           And 3i9c (50s)
 gi|295982077|pdb|2X9R|C Chain C, Structure Of The 70s Ribosome Bound To Release Factor 2
           And A Substrate Analog Provides Insights Into Catalysis
           Of Peptide Release
 gi|295982136|pdb|2X9T|C Chain C, Structure Of The 70s Ribosome Bound To Release Factor 2
           And A Substrate Analog Provides Insights Into Catalysis
           Of Peptide Release
 gi|307567964|pdb|2XFZ|C Chain C, Structure Of Cytotoxic Domain Of Colicin E3 Bound To The
           70s Ribosome (Part 1 Of 4)
 gi|307568022|pdb|2XG1|C Chain C, Structure Of Cytotoxic Domain Of Colicin E3 Bound To The
           70s Ribosome (Part 3 Of 4)
 gi|307776614|pdb|3OTO|C Chain C, Crystal Structure Of The 30s Ribosomal Subunit From A Ksga
           Mutant Of Thermus Thermophilus (Hb8)
 gi|309320237|pdb|3OGE|C Chain C, Structure Of The Thermus Thermophilus Ribosome Complexed
           With Chloramphenicol. This File Contains The 30s Subunit
           Of One 70s Ribosome. The Entire Crystal Structure
           Contains Two 70s Ribosomes.
 gi|309320258|pdb|3OGY|C Chain C, Structure Of The Thermus Thermophilus Ribosome Complexed
           With Chloramphenicol. This File Contains The 30s Subunit
           Of One 70s Ribosome. The Entire Crystal Structure
           Contains Two 70s Ribosomes.
 gi|309320339|pdb|3OHC|C Chain C, Structure Of The Thermus Thermophilus Ribosome Complexed
           With Erythromycin. This File Contains The 30s Subunit Of
           One 70s Ribosome. The Entire Crystal Structure Contains
           Two 70s Ribosomes.
 gi|309320360|pdb|3OHD|C Chain C, Structure Of The Thermus Thermophilus Ribosome Complexed
           With Erythromycin. This File Contains The 30s Subunit Of
           One 70s Ribosome. The Entire Crystal Structure Contains
           Two 70s Ribosomes.
 gi|309320441|pdb|3OHY|C Chain C, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Azithromycin. This File Contains The 30s
           Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 gi|309320492|pdb|3OI0|C Chain C, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Azithromycin. This File Contains The 30s
           Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 gi|309320543|pdb|3OI2|C Chain C, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Telithromycin. This File Contains The 30s
           Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 gi|309320594|pdb|3OI4|C Chain C, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Telithromycin. This File Contains The 30s
           Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 gi|312207675|pdb|2XQD|C Chain C, The Structure Of Ef-Tu And Aminoacyl-Trna Bound To The 70s
           Ribosome With A Gtp Analog
 gi|313754001|pdb|2XSY|C Chain C, Trna Tranlocation On The 70s Ribosome: The Pre-
           Translocational Translocation Intermediate Ti(Pre)
 gi|313754116|pdb|2XUY|C Chain C, Trna Tranlocation On The 70s Ribosome: The Post-
           Translocational Translocation Intermediate Ti(Post)
 gi|325533404|pdb|2Y0U|C Chain C, The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bound To A
           Near-Cognate Codon On The 70s Ribosome
 gi|325533463|pdb|2Y0W|C Chain C, The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bound To A
           Near-Cognate Codon On The 70s Ribosome
 gi|325533522|pdb|2Y0Y|C Chain C, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound To
           A Near-Cognate Codon On The 70s Ribosome
 gi|325533581|pdb|2Y10|C Chain C, The Crystal Structure Of Ef-Tu And Trp-Trna-Trp Bound To A
           Cognate Codon On The 70s Ribosome.
 gi|325533640|pdb|2Y12|C Chain C, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound To
           A Near-Cognate Codon On The 70s Ribosome
 gi|325533699|pdb|2Y14|C Chain C, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound To
           A Cognate Codon On The 70s Ribosome.
 gi|325533758|pdb|2Y16|C Chain C, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound To
           A Cognate Codon On The 70s Ribosome.
 gi|325533817|pdb|2Y18|C Chain C, The Crystal Structure Of Ef-Tu And Trp-Trna-Trp Bound To A
           Cognate Codon On The 70s Ribosome.
 gi|13446666|emb|CAC35062.1| ribosomal protein S3 [Thermus thermophilus HB27]
 gi|46197250|gb|AAS81664.1| SSU ribosomal protein S3P [Thermus thermophilus HB27]
 gi|55773068|dbj|BAD71509.1| 30S ribosomal protein S3 [Thermus thermophilus HB8]
          Length = 239

 Score =  258 bits (659), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 101/215 (46%), Positives = 140/215 (65%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG KI+PI FRLG+   W SRW+A   +Y  LL ED +IR  L+  L  AG+A++ IER 
Sbjct: 1   MGNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERA 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
             N  + V+ A+PG++IG+ G  I  +R++L+ +T   + L+V EV  P ++A L+AQ +
Sbjct: 61  ADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRV 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+Q+ERR   RRA+K+AVQ  M  GA G KVI SGR+ GAE +RTE   +GRVPL TLRA
Sbjct: 121 AEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTI 215
           +IDYG A+A T YG  G+K Y+ L + +       
Sbjct: 181 NIDYGFALARTTYGVLGVKAYIFLGEVIGGQKPKA 215


>gi|188584842|ref|YP_001916387.1| SSU ribosomal protein S3P [Natranaerobius thermophilus JW/NM-WN-LF]
 gi|226697735|sp|B2A4E5|RS3_NATTJ RecName: Full=30S ribosomal protein S3
 gi|179349529|gb|ACB83799.1| SSU ribosomal protein S3P [Natranaerobius thermophilus JW/NM-WN-LF]
          Length = 229

 Score =  258 bits (658), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 110/212 (51%), Positives = 149/212 (70%), Gaps = 1/212 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPI  R+GV   W S W+A    Y  L+HED+KIREY++  L  A V+ I I+R 
Sbjct: 1   MGQKINPIGLRIGVIKDWQSNWYAD-KNYTELVHEDIKIREYIENKLFNADVSAIQIDRA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               ++ +++A+PG++IGK G+ +EK+R  + N+T  ++H++V EV  PE++A L A+SI
Sbjct: 60  ANRIKVTLHTAKPGMVIGKGGSGVEKLRSDIENLTGKKVHINVMEVKTPELDAHLAAKSI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A  LERRV FRRAMK+AV  AMR GA G+KV+ SGRL GAE+SRTE Y EG VPLQTLRA
Sbjct: 120 AIALERRVAFRRAMKQAVGRAMRQGAKGIKVMCSGRLGGAEMSRTEWYTEGNVPLQTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSD 212
            IDYG   A TAYG  G+K +++  + + + D
Sbjct: 180 DIDYGMVEANTAYGQIGVKCWINKGEVLPEVD 211


>gi|304413151|ref|ZP_07394624.1| 30S ribosomal subunit protein S3 [Candidatus Regiella insecticola
           LSR1]
 gi|304283994|gb|EFL92387.1| 30S ribosomal subunit protein S3 [Candidatus Regiella insecticola
           LSR1]
          Length = 246

 Score =  258 bits (658), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 106/210 (50%), Positives = 150/210 (71%), Gaps = 1/210 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFA-RGSEYGALLHEDLKIREYLQCHLKQAGVAKILIER 59
           MGQK+NP  FRLG+   W+S W+A    E+   L  D KIR+ L   L +A V++I+IER
Sbjct: 1   MGQKVNPNGFRLGIVKDWDSTWYAVNDKEFADNLAGDKKIRQVLMEKLDKASVSRIVIER 60

Query: 60  THKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQS 119
             K+ R+ +++ARPG++IGKKG D+EK+RKK++++      +++ E+ KP++ A L+A S
Sbjct: 61  PAKSIRVTIHTARPGIVIGKKGEDVEKLRKKVTDIAAVPSQINIKEIRKPDLEAKLVADS 120

Query: 120 IAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           +A QLERRV+FRRAMKRAVQ+AMR GA G+++  SGRL GAE++RTE Y EGRVPL TLR
Sbjct: 121 VASQLERRVMFRRAMKRAVQNAMRAGAKGIRINVSGRLGGAEIARTEWYREGRVPLHTLR 180

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVS 209
           A IDY  + A T YG  G+KV++   + + 
Sbjct: 181 ADIDYSLSEAHTTYGVIGVKVWIFKGEILG 210


>gi|227497187|ref|ZP_03927435.1| possible ribosomal protein S3 [Actinomyces urogenitalis DSM 15434]
 gi|226833318|gb|EEH65701.1| possible ribosomal protein S3 [Actinomyces urogenitalis DSM 15434]
          Length = 269

 Score =  258 bits (658), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 103/223 (46%), Positives = 154/223 (69%), Gaps = 5/223 (2%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFAR----GSEYGALLHEDLKIREYLQCHLKQAGVAKIL 56
           MGQK+NP  FRLG+     SRWFA     G  Y   + ED+KIR  ++  +++AG++K+ 
Sbjct: 1   MGQKVNPTGFRLGITTDHRSRWFADSTKPGQRYRDFVEEDVKIRRLMEDGMERAGISKVD 60

Query: 57  IERTHKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLI 116
           IERT    R+ +++ARPG++IG++G + E++R +L  +T  ++ L++ EV  P+++A L+
Sbjct: 61  IERTRDRVRVDLHTARPGIVIGRRGAEAERLRGQLEKLTGKQVQLNILEVKSPDLDAQLV 120

Query: 117 AQSIAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQ 176
           AQ IA+QL  RV FRRAM++ +QSAMR GA G++V  SGRL GAE+SR+E Y EGRVPL 
Sbjct: 121 AQGIAEQLASRVSFRRAMRKGMQSAMRAGAKGIRVQCSGRLGGAEMSRSEFYREGRVPLH 180

Query: 177 TLRAHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
           TLRA+IDYG   A+T +G  G+KV++   D +++ +     AE
Sbjct: 181 TLRANIDYGFYEAKTTFGRLGVKVWIYKGD-MTEREFARQQAE 222


>gi|166031653|ref|ZP_02234482.1| hypothetical protein DORFOR_01353 [Dorea formicigenerans ATCC
           27755]
 gi|166028630|gb|EDR47387.1| hypothetical protein DORFOR_01353 [Dorea formicigenerans ATCC
           27755]
          Length = 217

 Score =  258 bits (658), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 97/211 (45%), Positives = 143/211 (67%), Gaps = 1/211 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   R+GV   W+S+W+A   ++   L ED +IR YL+  L  AGV+KI IER 
Sbjct: 1   MGQKVNPHGLRVGVIKDWDSKWYAE-KDFADYLVEDHEIRTYLKKRLYSAGVSKIEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               +I +Y+A+PG++IGK G +IEK++ +L+  T+ ++ + + E+ +P+ +A L+A++I
Sbjct: 60  SDRVKITIYTAKPGVVIGKGGAEIEKVKGELAQFTDKKLVVDIKEIKRPDKDAQLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLE R+ FRRAMK  +   M+ GA GVK   SGRL GA+++RTE Y EG +PLQTLRA
Sbjct: 120 ALQLENRISFRRAMKSCMSRTMKSGALGVKTSVSGRLGGADMARTEFYSEGTIPLQTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDS 211
            IDYG A A T YG  G+KV++   + + + 
Sbjct: 180 DIDYGFAEANTTYGKVGVKVWIYKGEVLPER 210


>gi|262377306|ref|ZP_06070530.1| ribosomal protein S3 [Acinetobacter lwoffii SH145]
 gi|262307759|gb|EEY88898.1| ribosomal protein S3 [Acinetobacter lwoffii SH145]
          Length = 250

 Score =  258 bits (658), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 111/228 (48%), Positives = 159/228 (69%), Gaps = 2/228 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI  RLGV    N+ W+A   +Y   L +DL++RE+L   LK A ++ ILIER 
Sbjct: 1   MGQKVHPIGIRLGVVKRHNANWYANPKQYAEYLLKDLQVREFLIKKLKNAMISNILIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               ++ + +ARPG++IGKKG DIEK++++L+++      +S+NE+ +P+++A L+A++I
Sbjct: 61  TGAAKVTISTARPGIVIGKKGEDIEKLQRELTSIMGVPAQVSINEIDRPDLDARLVAEAI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLE+RV+FRRAMKRAVQ+ MR GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 ASQLEKRVMFRRAMKRAVQNTMRAGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSD-SDSTIPA-AEHRVVEKD 226
            IDY T  AET YG+ G+KV++   + +        PA AE R  ++ 
Sbjct: 181 DIDYATMRAETTYGTIGVKVWIFRGEILGGMKQVMNPAPAEERPAKRG 228


>gi|187734808|ref|YP_001876920.1| ribosomal protein S3 [Akkermansia muciniphila ATCC BAA-835]
 gi|226697659|sp|B2UMT3|RS3_AKKM8 RecName: Full=30S ribosomal protein S3
 gi|187424860|gb|ACD04139.1| ribosomal protein S3 [Akkermansia muciniphila ATCC BAA-835]
          Length = 229

 Score =  258 bits (658), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 114/222 (51%), Positives = 157/222 (70%), Gaps = 2/222 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI FRL VN  W S+W+A G +Y   LHEDL +R+Y++  L  A V+ I+IER 
Sbjct: 1   MGQKVNPIGFRLAVNKDWRSKWYATGQDYATKLHEDLVMRKYIKEQLMSAAVSSIVIERA 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTN--SEIHLSVNEVPKPEINATLIAQ 118
             + RI V++ARPGL+IG+KG +IEKIR+ L  +    +++++ + E+  PE +A LIA+
Sbjct: 61  WNSVRITVHTARPGLVIGRKGEEIEKIRQYLQGLCGASTQVNIDIVEIRSPETDAQLIAE 120

Query: 119 SIAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTL 178
           ++A QLERRV FRRAMKRAVQ AM  GADG+++  +GRL GA+++R E Y EG+VPLQTL
Sbjct: 121 NVAVQLERRVSFRRAMKRAVQVAMERGADGIRIRCAGRLGGADIARAEWYREGKVPLQTL 180

Query: 179 RAHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEH 220
           R  IDYG A A T YG  G+K +V+ RDEV    ++ P+   
Sbjct: 181 RTPIDYGFAEARTLYGIIGVKCWVNKRDEVVSQQNSRPSGPR 222


>gi|220928213|ref|YP_002505122.1| ribosomal protein S3 [Clostridium cellulolyticum H10]
 gi|219998541|gb|ACL75142.1| ribosomal protein S3 [Clostridium cellulolyticum H10]
          Length = 222

 Score =  258 bits (658), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 94/218 (43%), Positives = 146/218 (66%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   R+G+   W+++W+A    + + L ED+KIR +++  L  +G+++I I+R 
Sbjct: 1   MGQKVNPHGLRIGIIKDWDTKWYANDKSFSSYLVEDVKIRNFIKKKLYISGISRIEIDRA 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               +I V +A+PGL+IGK G  IE++RK++  MT   + +++ E+  PE++A L+A++I
Sbjct: 61  ANKVKINVNTAKPGLVIGKGGQGIEELRKEIEKMTGKSVLINITEIKVPEMDAQLVAENI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLE+R+ FRRAMK+A+   M+ GA G+K   SGRL GAE++RTE Y +G +PLQTLRA
Sbjct: 121 ASQLEKRISFRRAMKQAMSRTMKLGAKGIKTACSGRLGGAEIARTEHYHDGTIPLQTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAA 218
            IDYG A A+T YG  G+KV++   + +        A 
Sbjct: 181 DIDYGFAEADTTYGKIGVKVWIYKGEVLPAVKRDRKAE 218


>gi|323357366|ref|YP_004223762.1| ribosomal protein S3 [Microbacterium testaceum StLB037]
 gi|323273737|dbj|BAJ73882.1| ribosomal protein S3 [Microbacterium testaceum StLB037]
          Length = 252

 Score =  258 bits (658), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 106/226 (46%), Positives = 147/226 (65%), Gaps = 8/226 (3%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFAR----GSEYGALLHEDLKIREYLQCHLKQAGVAKIL 56
           MGQK+NP  FRLG+     SRWF+     G  Y   L ED+KIR  L   L +AGV+ I 
Sbjct: 1   MGQKVNPYGFRLGITTDHVSRWFSDSTKAGQRYADYLAEDIKIRRLLTTSLDRAGVSNIE 60

Query: 57  IERTHKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLI 116
           IERT    R+ +++ARPG++IG++G + E+IR  L  +T  +I L++ EV  PE +A L+
Sbjct: 61  IERTRDRVRVDIHTARPGIVIGRRGAEAERIRADLEKLTGKQIQLNILEVKNPEADAQLV 120

Query: 117 AQSIAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQ 176
           AQ +A+QL  RV FRRAM++ +Q A R GA GV++  SGRL GAE+SR+E Y EGRVPL 
Sbjct: 121 AQGVAEQLTARVAFRRAMRKGLQGAQRAGAKGVRIQVSGRLGGAEMSRSEFYREGRVPLH 180

Query: 177 TLRAHIDYGTAVAETAYGSCGIKVYVSLRD----EVSDSDSTIPAA 218
           TLRA+IDYG   A+T +G  G+KV++   D    E++   +  P +
Sbjct: 181 TLRANIDYGFYEAKTTFGRIGVKVWIYKGDLTNKELAREQANAPKS 226


>gi|28897037|ref|NP_796642.1| 30S ribosomal protein S3 [Vibrio parahaemolyticus RIMD 2210633]
 gi|260363909|ref|ZP_05776655.1| ribosomal protein S3 [Vibrio parahaemolyticus K5030]
 gi|260877955|ref|ZP_05890310.1| ribosomal protein S3 [Vibrio parahaemolyticus AN-5034]
 gi|260896467|ref|ZP_05904963.1| ribosomal protein S3 [Vibrio parahaemolyticus Peru-466]
 gi|262392510|ref|YP_003284364.1| 30S ribosomal protein S3p [Vibrio sp. Ex25]
 gi|269964728|ref|ZP_06178966.1| 30S ribosomal protein S3 [Vibrio alginolyticus 40B]
 gi|31340380|sp|Q87T07|RS3_VIBPA RecName: Full=30S ribosomal protein S3
 gi|28805245|dbj|BAC58526.1| ribosomal protein S3 [Vibrio parahaemolyticus RIMD 2210633]
 gi|262336104|gb|ACY49899.1| SSU ribosomal protein S3p (S3e) [Vibrio sp. Ex25]
 gi|269830627|gb|EEZ84848.1| 30S ribosomal protein S3 [Vibrio alginolyticus 40B]
 gi|308087268|gb|EFO36963.1| ribosomal protein S3 [Vibrio parahaemolyticus Peru-466]
 gi|308090018|gb|EFO39713.1| ribosomal protein S3 [Vibrio parahaemolyticus AN-5034]
 gi|308111810|gb|EFO49350.1| ribosomal protein S3 [Vibrio parahaemolyticus K5030]
 gi|328471840|gb|EGF42717.1| 30S ribosomal protein S3 [Vibrio parahaemolyticus 10329]
          Length = 232

 Score =  258 bits (658), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 108/224 (48%), Positives = 153/224 (68%), Gaps = 1/224 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WN+ WFA   ++   L  D K+R++L   LK+A +++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNATWFANTKDFADNLDGDFKVRQFLTSELKKASLSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  ++ +      +++ EV KPE++A L+  SI
Sbjct: 61  AKSIRVTIHTARPGVVIGKKGEDVEKLRAAVAKIAGVPAQINIAEVRKPELDAQLVGDSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVE 224
            IDY T+ A T YG  GIK ++  + E+        A E +  +
Sbjct: 181 DIDYATSSAHTQYGVIGIKTWIF-KGEILGGMPAANAVEPKGDK 223


>gi|228989325|ref|ZP_04149316.1| 30S ribosomal protein S3 [Bacillus pseudomycoides DSM 12442]
 gi|228995507|ref|ZP_04155175.1| 30S ribosomal protein S3 [Bacillus mycoides Rock3-17]
 gi|229003132|ref|ZP_04160978.1| 30S ribosomal protein S3 [Bacillus mycoides Rock1-4]
 gi|229015518|ref|ZP_04172516.1| 30S ribosomal protein S3 [Bacillus cereus AH1273]
 gi|229021727|ref|ZP_04178309.1| 30S ribosomal protein S3 [Bacillus cereus AH1272]
 gi|229027964|ref|ZP_04184117.1| 30S ribosomal protein S3 [Bacillus cereus AH1271]
 gi|229074177|ref|ZP_04207223.1| 30S ribosomal protein S3 [Bacillus cereus Rock4-18]
 gi|229083436|ref|ZP_04215784.1| 30S ribosomal protein S3 [Bacillus cereus Rock3-44]
 gi|229094838|ref|ZP_04225843.1| 30S ribosomal protein S3 [Bacillus cereus Rock3-29]
 gi|229100915|ref|ZP_04231719.1| 30S ribosomal protein S3 [Bacillus cereus Rock3-28]
 gi|229113792|ref|ZP_04243227.1| 30S ribosomal protein S3 [Bacillus cereus Rock1-3]
 gi|229170967|ref|ZP_04298568.1| 30S ribosomal protein S3 [Bacillus cereus MM3]
 gi|228612507|gb|EEK69728.1| 30S ribosomal protein S3 [Bacillus cereus MM3]
 gi|228669663|gb|EEL25070.1| 30S ribosomal protein S3 [Bacillus cereus Rock1-3]
 gi|228682494|gb|EEL36567.1| 30S ribosomal protein S3 [Bacillus cereus Rock3-28]
 gi|228688581|gb|EEL42454.1| 30S ribosomal protein S3 [Bacillus cereus Rock3-29]
 gi|228699869|gb|EEL52506.1| 30S ribosomal protein S3 [Bacillus cereus Rock3-44]
 gi|228708947|gb|EEL61074.1| 30S ribosomal protein S3 [Bacillus cereus Rock4-18]
 gi|228733352|gb|EEL84181.1| 30S ribosomal protein S3 [Bacillus cereus AH1271]
 gi|228739595|gb|EEL90009.1| 30S ribosomal protein S3 [Bacillus cereus AH1272]
 gi|228745805|gb|EEL95809.1| 30S ribosomal protein S3 [Bacillus cereus AH1273]
 gi|228758095|gb|EEM07294.1| 30S ribosomal protein S3 [Bacillus mycoides Rock1-4]
 gi|228764236|gb|EEM13115.1| 30S ribosomal protein S3 [Bacillus mycoides Rock3-17]
 gi|228770403|gb|EEM18976.1| 30S ribosomal protein S3 [Bacillus pseudomycoides DSM 12442]
          Length = 219

 Score =  258 bits (658), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 102/220 (46%), Positives = 144/220 (65%), Gaps = 1/220 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI  R+GV   W SRWFA   +Y  LLHED+KIREY+   LK + VAK+ IER 
Sbjct: 1   MGQKVNPIGLRVGVIRDWESRWFAE-KDYATLLHEDIKIREYITVRLKDSAVAKVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                + +++A+PG++IGK GT++E +RK L+ +T   +H+++ EV + ++NA L+ ++I
Sbjct: 60  ANRVNVTIHTAKPGMVIGKGGTEVEALRKALNQLTGKRVHINILEVKRADLNAKLVGENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE RV FRRA K+ +Q AMR GA G+K   SGRL GA+++R E Y EG VPL TLRA
Sbjct: 120 ARQLENRVSFRRAQKQVIQRAMRAGAKGIKTQVSGRLGGADIARAESYSEGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEH 220
            IDY    A+T YG  G+KV++   + +            
Sbjct: 180 DIDYAAVEADTTYGKLGVKVWIYRGEVLPTKKKASEEGGK 219


>gi|163938124|ref|YP_001643008.1| 30S ribosomal protein S3 [Bacillus weihenstephanensis KBAB4]
 gi|229009625|ref|ZP_04166851.1| 30S ribosomal protein S3 [Bacillus mycoides DSM 2048]
 gi|229053962|ref|ZP_04195396.1| 30S ribosomal protein S3 [Bacillus cereus AH603]
 gi|229131124|ref|ZP_04260036.1| 30S ribosomal protein S3 [Bacillus cereus BDRD-ST196]
 gi|229165104|ref|ZP_04292899.1| 30S ribosomal protein S3 [Bacillus cereus AH621]
 gi|163860321|gb|ABY41380.1| ribosomal protein S3 [Bacillus weihenstephanensis KBAB4]
 gi|228618367|gb|EEK75397.1| 30S ribosomal protein S3 [Bacillus cereus AH621]
 gi|228652337|gb|EEL08262.1| 30S ribosomal protein S3 [Bacillus cereus BDRD-ST196]
 gi|228721380|gb|EEL72901.1| 30S ribosomal protein S3 [Bacillus cereus AH603]
 gi|228751647|gb|EEM01447.1| 30S ribosomal protein S3 [Bacillus mycoides DSM 2048]
          Length = 219

 Score =  258 bits (658), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 101/220 (45%), Positives = 144/220 (65%), Gaps = 1/220 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI  R+G+   W SRWFA   +Y  LLHED+KIREY+   LK + VAK+ IER 
Sbjct: 1   MGQKVNPIGLRVGIIRDWESRWFAE-KDYATLLHEDIKIREYITVRLKDSAVAKVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                + +++A+PG++IGK GT++E +RK L+ +T   +H+++ EV + ++NA L+ ++I
Sbjct: 60  ANRVNVTIHTAKPGMVIGKGGTEVEALRKALNQLTGKRVHINILEVKRADLNAKLVGENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE RV FRRA K+ +Q AMR GA G+K   SGRL GA+++R E Y EG VPL TLRA
Sbjct: 120 ARQLENRVSFRRAQKQVIQRAMRAGAKGIKTQVSGRLGGADIARAESYSEGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEH 220
            IDY    A+T YG  G+KV++   + +            
Sbjct: 180 DIDYAAVEADTTYGKLGVKVWIYRGEVLPTKKKASEEGGK 219


>gi|254517476|ref|ZP_05129532.1| ribosomal protein S3 [Clostridium sp. 7_2_43FAA]
 gi|226911225|gb|EEH96426.1| ribosomal protein S3 [Clostridium sp. 7_2_43FAA]
          Length = 222

 Score =  258 bits (658), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 103/219 (47%), Positives = 145/219 (66%), Gaps = 1/219 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   R+GV   W+++W+A    +   L ED KIRE+++  L  AG++KI IER 
Sbjct: 1   MGQKVHPHGLRVGVIKDWDAKWYASKKNFADNLIEDNKIREFVKKELFSAGISKIEIERA 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNM-TNSEIHLSVNEVPKPEINATLIAQS 119
            K  ++ +Y+A+PG+IIGK G  IE ++ KL+ +  N  + +++ EV   E NA L+A++
Sbjct: 61  AKRVKLNIYTAKPGVIIGKGGAGIEALKAKLAKVTDNKNLLINIVEVKNAEANAQLMAEN 120

Query: 120 IAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           IA QLE+RV FRRAMK+++Q AMR GA GVK   SGRL GAE++RTE Y EG +PLQTLR
Sbjct: 121 IAAQLEKRVSFRRAMKQSIQRAMRLGAKGVKTACSGRLGGAEIARTEQYHEGTIPLQTLR 180

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAA 218
           A IDYG A A+T YG  G+KV+V   + +          
Sbjct: 181 ADIDYGFAEADTTYGKIGVKVWVYNGEVLPTKKVEKKEE 219


>gi|258513646|ref|YP_003189868.1| 30S ribosomal protein S3 [Desulfotomaculum acetoxidans DSM 771]
 gi|257777351|gb|ACV61245.1| ribosomal protein S3 [Desulfotomaculum acetoxidans DSM 771]
          Length = 220

 Score =  258 bits (658), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 94/214 (43%), Positives = 149/214 (69%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   R+G+   W ++WFA    +  LL ED+ IR++++  L  AGV++I IER 
Sbjct: 1   MGQKVNPKGLRIGIIKDWEAKWFADKKNFSGLLLEDVNIRKHIKKKLYPAGVSRIQIERA 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               +I +++A+PG++IG+ GT++E +RK+L  +T  ++++++ E+  PEI + L+A++I
Sbjct: 61  ANRVKISIHTAKPGIVIGRGGTEVESLRKQLEKLTGKQVNINIVEIKVPEIESQLVAENI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQ +E+R+ FRRAMK+ V  AM+ GA G+++  SGRL GAE++R E Y EG+VPL TLRA
Sbjct: 121 AQAIEKRIAFRRAMKQNVSRAMKMGAKGIRIACSGRLGGAEIARAEWYSEGKVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDST 214
            IDYG A A+T YG  GIKV++   + + ++   
Sbjct: 181 DIDYGFAEADTTYGKIGIKVWIYKGEVLPEAKKA 214


>gi|326792601|ref|YP_004310422.1| ribosomal protein S3 [Clostridium lentocellum DSM 5427]
 gi|326543365|gb|ADZ85224.1| ribosomal protein S3 [Clostridium lentocellum DSM 5427]
          Length = 219

 Score =  258 bits (658), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 96/211 (45%), Positives = 146/211 (69%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   R+GV   W++RW+A   ++   L ED KIR++++  L  AG+ K+ IER 
Sbjct: 1   MGQKVNPHGLRVGVIKEWDARWYADKKDFANNLVEDDKIRKFIKKKLYAAGIDKVEIERM 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K  R+ V++++PG++IGK G  I+ +RK++  +T +++ +++ EV +PE  A L+A++I
Sbjct: 61  SKRVRVHVHTSKPGIVIGKGGASIDLLRKEVEKLTANKVAINIVEVKRPEACAQLVAENI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLE RV FRRAMK+A+  A + GA G+KV  SGRL GAE++RTE Y +G +PLQTLRA
Sbjct: 121 ALQLENRVSFRRAMKQAMGKAFKSGAKGIKVSCSGRLGGAEMARTEQYSDGNIPLQTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDS 211
            I+YG A A+T YG  G+KV++   + +   
Sbjct: 181 DIEYGFAEADTTYGKIGVKVWIYKGEVLPTK 211


>gi|260886882|ref|ZP_05898145.1| ribosomal protein S3 [Selenomonas sputigena ATCC 35185]
 gi|330839320|ref|YP_004413900.1| ribosomal protein S3 [Selenomonas sputigena ATCC 35185]
 gi|260863481|gb|EEX77981.1| ribosomal protein S3 [Selenomonas sputigena ATCC 35185]
 gi|329747084|gb|AEC00441.1| ribosomal protein S3 [Selenomonas sputigena ATCC 35185]
          Length = 223

 Score =  258 bits (658), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 100/220 (45%), Positives = 155/220 (70%), Gaps = 1/220 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   R+G+   W+++W+A   ++   LHED+KIR+YL+  L  AGV+KI  ER+
Sbjct: 1   MGQKVNPNGIRIGIVKDWDAKWYAD-KDFADNLHEDIKIRKYLKDSLGAAGVSKIETERS 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               ++ +++A+PG++IG+ G+ IE+I++ L   T   + ++++E+ +P+++ATL+A++I
Sbjct: 60  KNRLKLTIHTAKPGMVIGRGGSGIEQIKEGLKGKTEKTVDINISEIRQPDLDATLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERR+ FRRAMK++V   MR GA G+KV  SGRL GAE++R+E Y EG +PL TLRA
Sbjct: 120 AQQLERRIAFRRAMKQSVGRTMRLGAKGIKVKVSGRLGGAEIARSEAYREGSIPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEH 220
            IDYGTA A T YG  G+KV++   + + +   +  AA  
Sbjct: 180 DIDYGTAEARTTYGRIGVKVWIFKGEILPEKKQSKRAAAE 219


>gi|325663056|ref|ZP_08151506.1| 30S ribosomal protein S3 [Lachnospiraceae bacterium 4_1_37FAA]
 gi|331086663|ref|ZP_08335740.1| 30S ribosomal protein S3 [Lachnospiraceae bacterium 9_1_43BFAA]
 gi|325470510|gb|EGC73740.1| 30S ribosomal protein S3 [Lachnospiraceae bacterium 4_1_37FAA]
 gi|330409829|gb|EGG89264.1| 30S ribosomal protein S3 [Lachnospiraceae bacterium 9_1_43BFAA]
          Length = 218

 Score =  257 bits (657), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 98/212 (46%), Positives = 144/212 (67%), Gaps = 1/212 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   R+GV   W+S+W+A    +   L ED KIR +L+  L  AGV+KI IER 
Sbjct: 1   MGQKVNPHGLRVGVIKDWDSKWYAEDK-FADYLVEDHKIRTFLKKKLYSAGVSKIEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               +II+Y+A+PG++IGK G +IEK++ +L+  T+ ++ + + E+ +P+ +A L+A++I
Sbjct: 60  SDRVKIIIYTAKPGVVIGKGGAEIEKVKAELAKFTDKKLVVDIKEIKRPDKDAQLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLE R+ FRRAMK  +   M+ GA GVK   SGRL GA+++RTE Y EG +PLQTLRA
Sbjct: 120 ALQLENRISFRRAMKSCMSRTMKAGALGVKTSVSGRLGGADMARTEFYSEGTIPLQTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSD 212
            IDYG A A+T YG  G+KV++   + +   +
Sbjct: 180 DIDYGFAEADTTYGKVGVKVWIYKGEVLPTKE 211


>gi|152060912|sp|A0LIJ6|RS3_SYNFM RecName: Full=30S ribosomal protein S3
          Length = 208

 Score =  257 bits (657), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 109/209 (52%), Positives = 154/209 (73%), Gaps = 1/209 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P  FRLG+  +W+SRWFA   +Y  L+HED KIR+Y++  L  AG+AK+ IER 
Sbjct: 1   MGQKVHPTGFRLGILKSWDSRWFA-TKDYAKLVHEDRKIRDYIKARLYHAGIAKVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               +I +++ARPG++IGKKG +IE +R+ L      EI + + EV +PE++ATL+ ++I
Sbjct: 60  ANKVKIRIFTARPGIVIGKKGAEIETLRRDLERKFKREILIDIQEVRRPELDATLVGENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           + QL RRV FRRAMKRAV +A++FGA GV+V ++GRL GAE++R E Y EGRVPL TLRA
Sbjct: 120 SLQLVRRVAFRRAMKRAVSAALKFGAKGVRVASAGRLGGAEMARREWYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVS 209
            IDYGTA+A T YG+ G+KV++   + + 
Sbjct: 180 DIDYGTAIARTTYGAIGVKVWIFKGEVLP 208


>gi|303233154|ref|ZP_07319827.1| ribosomal protein S3 [Atopobium vaginae PB189-T1-4]
 gi|302480739|gb|EFL43826.1| ribosomal protein S3 [Atopobium vaginae PB189-T1-4]
          Length = 236

 Score =  257 bits (657), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 95/222 (42%), Positives = 145/222 (65%), Gaps = 3/222 (1%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+ P  FRLG+   W SRW+A    Y   +  DL+IR+YL+  L +A ++++ IER 
Sbjct: 1   MGQKVQPTGFRLGITEQWRSRWYANKGNYAKNIGGDLEIRKYLKKRLAKAALSRVEIERA 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDI---EKIRKKLSNMTNSEIHLSVNEVPKPEINATLIA 117
               ++ + ++RPG++IGKKG +I       ++++ +    +H+ V E+ +P+++A L A
Sbjct: 61  GDKVKVSILTSRPGIVIGKKGGEIDDLRNDVQRIAGLPKGSVHVEVVEIKQPDLDAQLTA 120

Query: 118 QSIAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQT 177
             IA+QLE RV FRRA+++AVQ+A + GA G+++  SGRLNGAE+ R E   EGRVPL T
Sbjct: 121 DRIAEQLEGRVAFRRAVRKAVQAATKAGAKGIRIQCSGRLNGAEMGRVEWSREGRVPLHT 180

Query: 178 LRAHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
           LRA ID+ TA A T  G+ GIKV++ L +++    +  PA E
Sbjct: 181 LRAKIDFATATASTTMGAVGIKVWIYLGEKLPGQPAPNPALE 222


>gi|161486819|ref|NP_722318.2| 30S ribosomal protein S3 [Streptococcus mutans UA159]
 gi|27734496|sp|P59186|RS3_STRMU RecName: Full=30S ribosomal protein S3
          Length = 217

 Score =  257 bits (657), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 93/215 (43%), Positives = 147/215 (68%), Gaps = 1/215 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI  R+G+   W+++W+A   EY   LHEDL IR+++Q  L  A V+ I IER 
Sbjct: 1   MGQKVHPIGMRVGIIRDWDAKWYAE-KEYADYLHEDLAIRKFIQKELADAAVSTIEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                + +++A+PG++IGK G +++ +R +L+ +T  ++H+++ E+  P+++A L+ ++I
Sbjct: 60  VNKVNVSLHTAKPGMVIGKGGANVDALRAQLNKLTGKQVHINIVEIKSPDLDAHLVGENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE+RV FRRA K+A+Q  MR GA G+K   SGRLNGA+++R+E Y EG VPL TLRA
Sbjct: 120 ARQLEQRVAFRRAQKQAIQRTMRAGAKGIKTQVSGRLNGADIARSEGYSEGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTI 215
            IDY    A+T YG  G+KV++   + +    +T 
Sbjct: 180 DIDYAWEEADTTYGKLGVKVWIYRGEILPARKNTK 214


>gi|261250411|ref|ZP_05942986.1| SSU ribosomal protein S3p (S3e) [Vibrio orientalis CIP 102891]
 gi|260938980|gb|EEX94967.1| SSU ribosomal protein S3p (S3e) [Vibrio orientalis CIP 102891]
          Length = 232

 Score =  257 bits (657), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 108/224 (48%), Positives = 153/224 (68%), Gaps = 1/224 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P   RLG+   WN+ WFA   ++   L  D K+R++L   LK+A +++I+IER 
Sbjct: 1   MGQKVHPNGIRLGIVKPWNATWFANTKDFADNLDGDFKVRQFLTSELKKASLSRIVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ R+ +++ARPG++IGKKG D+EK+R  ++ +      +++ EV KPE++A L+  SI
Sbjct: 61  AKSIRVTIHTARPGVVIGKKGEDVEKLRTAVAKIAGVPAQINIAEVRKPELDAQLVGDSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++R+E Y EGRVPL TLRA
Sbjct: 121 ASQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARSEWYREGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVE 224
            IDY T+ A T YG  GIK ++  + E+        A E +  +
Sbjct: 181 DIDYATSSAHTQYGVIGIKTWIF-KGEILGGMPAANAVEPKGDK 223


>gi|259502537|ref|ZP_05745439.1| 30S ribosomal protein S3 [Lactobacillus antri DSM 16041]
 gi|259169489|gb|EEW53984.1| 30S ribosomal protein S3 [Lactobacillus antri DSM 16041]
          Length = 221

 Score =  257 bits (657), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 93/219 (42%), Positives = 146/219 (66%), Gaps = 1/219 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP  FR+GV   W ++W+A   ++   L+EDL+IR+Y++  L  A V+ + IER 
Sbjct: 1   MGQKINPNGFRVGVIRDWTAKWYAD-KDFANYLNEDLRIRKYIEKRLADASVSTVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                + +++A+PG++IGK G+++E +RK+L+ +T   +H+++ E+ KP+++A L+ +SI
Sbjct: 60  ANRVNVSIHTAKPGMVIGKGGSEVEALRKELNKLTGKRVHINIVEIKKPDLDAHLVGESI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE R+ FRRAM+ A+Q AMR GA G+K   +GRLNGA++SR E Y +G VPL TLRA
Sbjct: 120 ARQLEARIAFRRAMRGAMQRAMRAGAKGIKTQVAGRLNGADMSRVESYSDGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
            IDY    A T YG  G+K ++   + +    +     +
Sbjct: 180 DIDYSWDEANTTYGVLGVKTWIYRGEVLPAKKNENDDEQ 218


>gi|225376415|ref|ZP_03753636.1| hypothetical protein ROSEINA2194_02057 [Roseburia inulinivorans DSM
           16841]
 gi|225211791|gb|EEG94145.1| hypothetical protein ROSEINA2194_02057 [Roseburia inulinivorans DSM
           16841]
          Length = 218

 Score =  257 bits (657), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 99/211 (46%), Positives = 144/211 (68%), Gaps = 1/211 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP   R+GV   W+S+W+A  +++  LL ED  IR YL+  L  AGV+KI IER 
Sbjct: 1   MGQKVNPHGLRVGVIKDWDSKWYAE-ADFADLLVEDYNIRTYLKKKLYAAGVSKIEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               ++I+Y+A+PG++IGK G +IEKI+ ++   T+ ++ + + EV +P+ +A L+A++I
Sbjct: 60  SDRVKVIIYTAKPGVVIGKGGAEIEKIKAEVQKFTSKKLVVDIKEVKRPDRDAQLVAENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLE RV FRRAMK  +   M+ GA G+K   SGRL GA+++RTE Y EG +PLQTLRA
Sbjct: 120 ALQLENRVSFRRAMKSCMSRTMKSGAKGIKTSCSGRLGGADMARTEFYSEGTIPLQTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDS 211
            IDYG A A+T YG  G+KV++   + +   
Sbjct: 180 DIDYGFAEADTTYGKVGVKVWIYKGEVLPTK 210


>gi|171462885|ref|YP_001796998.1| ribosomal protein S3 [Polynucleobacter necessarius subsp.
           necessarius STIR1]
 gi|171192423|gb|ACB43384.1| ribosomal protein S3 [Polynucleobacter necessarius subsp.
           necessarius STIR1]
          Length = 271

 Score =  257 bits (657), Expect = 8e-67,   Method: Composition-based stats.
 Identities = 117/225 (52%), Positives = 159/225 (70%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP  FRL V   W SRW+A  +++  +L ED+ +R YL+  LK A V+K++IER 
Sbjct: 1   MGQKINPTGFRLAVTKNWTSRWYANNTDFAKMLKEDVDVRSYLKKKLKNASVSKVVIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K+ RI +YS+RPG++IGKKG DIE +R++L       +H ++ E+ KPE++A LIA SI
Sbjct: 61  AKSARITIYSSRPGVVIGKKGEDIEVLRRELQKRMGVPVHANIEEIRKPEVDAQLIADSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            QQLE+R++FRRAMKRA+Q AMR GA G+K+++SGRLNGAE++R E Y EGRVPL TL+A
Sbjct: 121 TQQLEKRIMFRRAMKRAMQKAMRLGAQGIKIMSSGRLNGAEIARREWYREGRVPLHTLKA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
            IDY T+ AET YG  G+KV+V   D +        AA+    +K
Sbjct: 181 DIDYATSEAETTYGIIGVKVWVYKGDALGRGAEAQVAAQVAEEKK 225


>gi|86739301|ref|YP_479701.1| 30S ribosomal protein S3 [Frankia sp. CcI3]
 gi|123737801|sp|Q2JFH0|RS3_FRASC RecName: Full=30S ribosomal protein S3
 gi|86566163|gb|ABD09972.1| SSU ribosomal protein S3P [Frankia sp. CcI3]
          Length = 315

 Score =  257 bits (657), Expect = 8e-67,   Method: Composition-based stats.
 Identities = 99/218 (45%), Positives = 149/218 (68%), Gaps = 1/218 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NP  FRLG+   + SRW+A   +Y A + ED+KIR+ +   +++AG++++ IERT
Sbjct: 1   MGQKVNPHGFRLGITSEFTSRWYAD-KQYKAYVGEDVKIRKMMSRGMERAGISRVDIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG++G + ++IR  L  +T  ++ L++ EV  PE++A L+AQ +
Sbjct: 60  QGRLRVDIHTARPGIVIGRRGAEADRIRGDLEKLTGKQVQLNILEVKNPEVDAQLVAQGV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QL  RV FRRAM++A+Q+AM+ GA G++V  SGRL GAE+SR+E Y EGRVPL TLRA
Sbjct: 120 AEQLSSRVSFRRAMRKAMQTAMKGGAKGIRVQCSGRLGGAEMSRSEFYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAA 218
            IDYG   A T +G  G+KV++   D V          
Sbjct: 180 DIDYGFYEARTNFGRIGVKVWIYKGDIVQSRAEREAQE 217


>gi|254431944|ref|ZP_05045647.1| ribosomal protein S3 [Cyanobium sp. PCC 7001]
 gi|197626397|gb|EDY38956.1| ribosomal protein S3 [Cyanobium sp. PCC 7001]
          Length = 242

 Score =  257 bits (657), Expect = 8e-67,   Method: Composition-based stats.
 Identities = 98/231 (42%), Positives = 141/231 (61%), Gaps = 5/231 (2%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MG KI+P   RLG+     SRW+A    Y  LL ED +IR+++      AG++ +LI R 
Sbjct: 1   MGHKIHPTGLRLGITQDHRSRWYAPSKTYPTLLQEDDRIRKFIHKKYGAAGISDVLIARK 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIR---KKLSNMTNSEIHLSVNEVPKPEINATLIA 117
                + + +ARPG+++G++G+ IE +R   +K     N ++ ++V EV + + +A L+A
Sbjct: 61  ADQLEVELKTARPGVLVGRQGSGIEDLRNGIQKTVGDANRQVRINVVEVERVDADAFLLA 120

Query: 118 QSIAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQT 177
           + IAQQLE+RV FRR ++ AVQ A R G  G+K+  SGRLNGAE++RTE   EGRVPL T
Sbjct: 121 EYIAQQLEKRVAFRRVIRMAVQRAQRAGVLGLKIQVSGRLNGAEIARTEWTREGRVPLHT 180

Query: 178 LRAHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIP--AAEHRVVEKD 226
           LRA IDY T +A T YG  GIKV+V   + +      +P  AA  R   + 
Sbjct: 181 LRADIDYATKLASTTYGVLGIKVWVFKGEVLPGQKEQLPVGAAPRRRTSRQ 231


>gi|300782614|ref|YP_003762905.1| 30S ribosomal protein S3 [Amycolatopsis mediterranei U32]
 gi|299792128|gb|ADJ42503.1| small subunit ribosomal protein S3 [Amycolatopsis mediterranei U32]
          Length = 279

 Score =  257 bits (657), Expect = 8e-67,   Method: Composition-based stats.
 Identities = 99/228 (43%), Positives = 149/228 (65%), Gaps = 6/228 (2%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP  FRLG+   W SRW+A   +Y   + ED+KIR+ L   +++AG++K+ IERT
Sbjct: 1   MGQKINPHGFRLGITTDWKSRWYAD-KQYAEYVAEDVKIRKLLATGMERAGISKVEIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG++G + ++IR  L  +T  ++ L++ EV  PE +A L+AQ++
Sbjct: 60  RDRVRVDIHTARPGIVIGRRGAEADRIRGALEKLTKKQVQLNILEVKNPEADAQLVAQAV 119

Query: 121 AQQLERRVVFRRAMKRAVQ-SAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           A+QL  RV FRRAM++A+Q S       G++V   GRL GAE+SR+E Y +GRVPL TLR
Sbjct: 120 AEQLSNRVAFRRAMRKAIQTSMRSPQVKGIRVQCGGRLGGAEMSRSEHYRDGRVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
           A IDYG   A+T +G  G+KV++   + V      + A E R   + +
Sbjct: 180 ADIDYGFFEAKTTFGRIGVKVWIYKGELVGG----LKAREARDAAERA 223


>gi|320094574|ref|ZP_08026340.1| 30S ribosomal protein S3 [Actinomyces sp. oral taxon 178 str.
           F0338]
 gi|319978489|gb|EFW10066.1| 30S ribosomal protein S3 [Actinomyces sp. oral taxon 178 str.
           F0338]
          Length = 270

 Score =  257 bits (657), Expect = 8e-67,   Method: Composition-based stats.
 Identities = 102/224 (45%), Positives = 152/224 (67%), Gaps = 5/224 (2%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFAR----GSEYGALLHEDLKIREYLQCHLKQAGVAKIL 56
           MGQK+NP  FRLG+     SRWF+     G  Y   + ED+ IR+ L  +L++AG+AK+ 
Sbjct: 1   MGQKVNPTGFRLGITTDHRSRWFSDSTTKGQRYSDYVAEDVAIRKALTDNLERAGIAKVD 60

Query: 57  IERTHKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLI 116
           IERT    R+ +++ARPG++IG++G + +++R+ L  +T  ++ L++ EV  P+++A L+
Sbjct: 61  IERTRDRVRVDLHTARPGIVIGRRGAEADRLRQSLEKLTGKQVQLNILEVKNPDLDAQLV 120

Query: 117 AQSIAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQ 176
           AQ IA+QL  RV FRRAM++ +QSA R GA G++V  SGRL GAE+SR+E Y EGRVPL 
Sbjct: 121 AQGIAEQLAARVSFRRAMRKGIQSAQRAGAKGIRVQVSGRLGGAEMSRSEFYREGRVPLH 180

Query: 177 TLRAHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEH 220
           TLRA+IDYG   A T +G  G+KV++   D +++ +     AE 
Sbjct: 181 TLRANIDYGFHEARTTFGRIGVKVWIYKGD-ITEREFARQQAEQ 223


>gi|328958722|ref|YP_004376108.1| 30S ribosomal protein S3 [Carnobacterium sp. 17-4]
 gi|328675046|gb|AEB31092.1| 30S ribosomal protein S3 [Carnobacterium sp. 17-4]
          Length = 218

 Score =  257 bits (657), Expect = 8e-67,   Method: Composition-based stats.
 Identities = 97/219 (44%), Positives = 149/219 (68%), Gaps = 1/219 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINP   R+G+   W+S+W+A   ++   LHED+ IREY+   L +A V+K+ IER 
Sbjct: 1   MGQKINPTGLRVGIIRDWDSKWYAE-KDFANFLHEDIAIREYIAKKLSEASVSKVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                + V++A+PG++IGK G++++ +RKKL+++T   +H+++ E+ +P+++A L+A+ I
Sbjct: 60  ANRVNVSVHTAKPGMVIGKGGSEVDALRKKLNDLTGKRVHINIVEIKRPDLDAKLVAEGI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A QLE RV FRRA K+A+Q  MR GA G+K + SGRLNGA+++R+E + EG VPL TLRA
Sbjct: 120 ASQLESRVAFRRAQKQAIQRTMRSGAKGIKTMVSGRLNGADIARSETHSEGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
            IDY    A T YG  GIKV++   + +    +T    +
Sbjct: 180 DIDYAWEEAATTYGKLGIKVWIYRGEVLPAKKNTEKGGK 218


>gi|239787569|emb|CAX84037.1| 30S ribosomal protein S3 [uncultured bacterium]
          Length = 214

 Score =  257 bits (657), Expect = 8e-67,   Method: Composition-based stats.
 Identities = 114/216 (52%), Positives = 159/216 (73%), Gaps = 2/216 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++P  FRLG+  TW++RW+A    + +LL ED+K+RE+++  L+ A V+KI+IER 
Sbjct: 1   MGQKVHPTGFRLGITKTWDTRWYAD-KAFASLLLEDIKLREWIKKRLEHASVSKIIIERP 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
            K  RI +++ARPG+IIGKKG DIEK++  ++ + N+E+ +++ EV KPE  A LIA+++
Sbjct: 60  AKKARINIHTARPGIIIGKKGADIEKLKNDIAKVANTEVAINIVEVRKPEAEAQLIAENV 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQL RRV FRRAMKRAV SAMR GA G+++  +GRL G E++RTE Y EGRVPL TLRA
Sbjct: 120 AQQLVRRVAFRRAMKRAVTSAMRLGAMGIRINCAGRLGGGEIARTEWYREGRVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIP 216
            I+YG A A T YG  G+KV+V  + E+ D +   P
Sbjct: 180 DIEYGFADANTTYGVIGVKVWVF-KGEIIDREIRRP 214


>gi|312866522|ref|ZP_07726739.1| ribosomal protein S3 [Streptococcus downei F0415]
 gi|311097953|gb|EFQ56180.1| ribosomal protein S3 [Streptococcus downei F0415]
          Length = 217

 Score =  257 bits (657), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 93/215 (43%), Positives = 145/215 (67%), Gaps = 1/215 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI  R+GV   W+++W+A   EY   LHEDL IR+++   L  A V+ + IER 
Sbjct: 1   MGQKVHPIGMRVGVIRDWDAKWYAE-KEYADYLHEDLAIRKFISKELADASVSTVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                + +++A+PG++IGK G +++ +R KL+ +T  ++H+++ E+  P+++A L+ ++I
Sbjct: 60  VNKVIVSLHTAKPGMVIGKGGANVDALRAKLNKLTGKQVHINIVEIKAPDLDAHLVGENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE+RV FRRA K+A+Q  MR GA G+K   SGRLNGA+++R E Y EG VPL TLRA
Sbjct: 120 ARQLEQRVAFRRAQKQAIQRTMRAGAKGIKTQVSGRLNGADIARAEGYSEGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTI 215
            IDY    A+T YG  G+KV++   + +    +T 
Sbjct: 180 DIDYAWEEADTTYGKLGVKVWIYRGEVLPARKNTK 214


>gi|306832553|ref|ZP_07465693.1| 30S ribosomal protein S3 [Streptococcus bovis ATCC 700338]
 gi|304425311|gb|EFM28437.1| 30S ribosomal protein S3 [Streptococcus bovis ATCC 700338]
          Length = 217

 Score =  257 bits (657), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 93/215 (43%), Positives = 148/215 (68%), Gaps = 1/215 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI  R+G+   W+++W+A   EY   LHEDL IR+++Q  L  A V++I IER 
Sbjct: 1   MGQKVHPIGMRVGIIRDWDAKWYAE-KEYADYLHEDLAIRKFIQTELADASVSRIEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                + +++A+PG++IGK G +++ +R KL+ +T  ++H+++ E+ +P+++A L+ ++I
Sbjct: 60  VNKVIVSLHTAKPGMVIGKGGANVDALRAKLNKLTGKQVHINIVEIKQPDLDAHLVGENI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
            +QLE+RV FRRA K+A+Q  MR GA G+K   SGRLNGA+++R+E Y EG VPL TLRA
Sbjct: 120 VRQLEQRVAFRRAQKQAIQRTMRAGAKGIKTQVSGRLNGADIARSEGYSEGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTI 215
            IDY    A+T YG  G+KV++   + +    +T 
Sbjct: 180 DIDYAWEEADTTYGKLGVKVWIYRGEVLPARKNTK 214


>gi|257866535|ref|ZP_05646188.1| ribosomal protein S3 [Enterococcus casseliflavus EC30]
 gi|257872950|ref|ZP_05652603.1| ribosomal protein S3 [Enterococcus casseliflavus EC10]
 gi|257876139|ref|ZP_05655792.1| ribosomal protein S3 [Enterococcus casseliflavus EC20]
 gi|325567370|ref|ZP_08144037.1| 30S ribosomal protein S3 [Enterococcus casseliflavus ATCC 12755]
 gi|257800493|gb|EEV29521.1| ribosomal protein S3 [Enterococcus casseliflavus EC30]
 gi|257807114|gb|EEV35936.1| ribosomal protein S3 [Enterococcus casseliflavus EC10]
 gi|257810305|gb|EEV39125.1| ribosomal protein S3 [Enterococcus casseliflavus EC20]
 gi|325158803|gb|EGC70949.1| 30S ribosomal protein S3 [Enterococcus casseliflavus ATCC 12755]
          Length = 218

 Score =  257 bits (657), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 96/219 (43%), Positives = 149/219 (68%), Gaps = 1/219 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI  R+G+   W+++W+A   EY   LHEDLKIR+++   L  A V+ + IER 
Sbjct: 1   MGQKVHPIGMRVGIIRDWDAKWYAE-KEYAEFLHEDLKIRKFIASKLADAAVSTVEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                I +++A+PG++IGK G+++E +RK+L+++T   +H+++ E+ KP+++A L+ + I
Sbjct: 60  ANRVNISIHTAKPGMVIGKGGSEVENLRKELNSLTGKRVHINIVEIKKPDLDAKLVGEGI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE RV FRRA K+A+Q  MR GA G+K   SGRLNGA+++R+E Y EG VPL TLRA
Sbjct: 120 ARQLENRVAFRRAQKQAIQRTMRSGAKGIKTQVSGRLNGADIARSEGYSEGTVPLHTLRA 179

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAE 219
            IDY    A+T YG  G+KV++   + +    +T    +
Sbjct: 180 DIDYAWEEADTTYGKLGVKVWIYRGEVLPTKKNTEKGGK 218


>gi|237786389|ref|YP_002907094.1| 30S ribosomal protein S3 [Corynebacterium kroppenstedtii DSM 44385]
 gi|259495239|sp|C4LL46|RS3_CORK4 RecName: Full=30S ribosomal protein S3
 gi|237759301|gb|ACR18551.1| 30S ribosomal protein S3 [Corynebacterium kroppenstedtii DSM 44385]
          Length = 249

 Score =  257 bits (657), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 103/216 (47%), Positives = 148/216 (68%), Gaps = 2/216 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKI+P   RLG+   W SRW+A   +Y   L ED+KIR++L   L++AG+A ++IERT
Sbjct: 1   MGQKIHPYGLRLGITSEWRSRWYAD-KQYADYLAEDIKIRDFLSKGLERAGIADVVIERT 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IG++G + ++IR KL  +T  ++ L++ EV   + +A L+AQSI
Sbjct: 60  RDRVRVDIHTARPGIVIGRRGAEADRIRGKLEKLTGKQVQLNILEVKNVDASAQLVAQSI 119

Query: 121 AQQLERRVVFRRAMKRAVQSAM-RFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           A+QL  RV FRRAM++A+Q AM +    G+KV+ SGRL GAE+ RTE Y EGRVPL TLR
Sbjct: 120 AEQLSNRVAFRRAMRKAIQGAMRQPQVKGIKVVCSGRLGGAEMGRTERYHEGRVPLHTLR 179

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTI 215
           A IDYGT  A T +G  G+KV++   D V     ++
Sbjct: 180 AEIDYGTFEAHTTFGRIGVKVWIYKGDVVGGRRESL 215


>gi|210623194|ref|ZP_03293633.1| hypothetical protein CLOHIR_01583 [Clostridium hiranonis DSM 13275]
 gi|210153731|gb|EEA84737.1| hypothetical protein CLOHIR_01583 [Clostridium hiranonis DSM 13275]
          Length = 263

 Score =  257 bits (656), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 102/223 (45%), Positives = 147/223 (65%), Gaps = 1/223 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFAR-GSEYGALLHEDLKIREYLQCHLKQAGVAKILIER 59
           MGQK+NP   R+GV   W+SRWF   G E+G+ + ED  IR++L+  L  AGVAKI IER
Sbjct: 1   MGQKVNPHGLRVGVIKDWDSRWFTNNGKEFGSFILEDHNIRKFLKKKLYSAGVAKIEIER 60

Query: 60  THKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQS 119
           +    ++ ++ A+PG++IG+ GT+IE ++ +L  +T   + +++ EV   + +A L+A++
Sbjct: 61  SANKVKLDLHVAKPGVVIGRAGTEIEALKAELEKLTGKTVIVNIVEVKNVDRDAQLVAEN 120

Query: 120 IAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLR 179
           IA  +ERRV FRRAMK+ +Q AM+ GA G+KV ASGRL GAE++RTE Y EG VPLQTLR
Sbjct: 121 IAAAIERRVAFRRAMKQGIQRAMKSGAKGIKVAASGRLGGAEMARTEGYSEGNVPLQTLR 180

Query: 180 AHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRV 222
           + IDYG A A+T YG  GIKV++   + +              
Sbjct: 181 SDIDYGFAEADTTYGKIGIKVWICNGEVLPTKHVPGADPRPER 223


>gi|296875398|ref|ZP_06899472.1| 30S ribosomal protein S3 [Streptococcus parasanguinis ATCC 15912]
 gi|312866953|ref|ZP_07727164.1| ribosomal protein S3 [Streptococcus parasanguinis F0405]
 gi|322390666|ref|ZP_08064180.1| 30S ribosomal protein S3 [Streptococcus parasanguinis ATCC 903]
 gi|296433591|gb|EFH19364.1| 30S ribosomal protein S3 [Streptococcus parasanguinis ATCC 15912]
 gi|311097435|gb|EFQ55668.1| ribosomal protein S3 [Streptococcus parasanguinis F0405]
 gi|321142639|gb|EFX38103.1| 30S ribosomal protein S3 [Streptococcus parasanguinis ATCC 903]
          Length = 217

 Score =  257 bits (656), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 93/215 (43%), Positives = 144/215 (66%), Gaps = 1/215 (0%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK++PI  R+G+   W+++W+A   EY   LHEDL IR+++Q  L  A V+ I IER 
Sbjct: 1   MGQKVHPIGMRVGIIRDWDAKWYAE-KEYADYLHEDLAIRKFIQKELADAAVSTIEIERA 59

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
                + +++A+PG++IGK G +++ +R  L