RPSBLAST alignment for GI: 254780255 and conserved domain: smart00322

>gnl|CDD|128617 smart00322, KH, K homology RNA-binding domain. Length = 69
 Score = 40.0 bits (94), Expect = 5e-04
 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 3/64 (4%)

Query: 65  RIIVYSARPGLIIGKKGTDIEKIRKKLS---NMTNSEIHLSVNEVPKPEINATLIAQSIA 121
            +++ + + GLIIGK G+ I+KI ++     ++        V E+  P  N    A+ I 
Sbjct: 6   EVLIPADKVGLIIGKGGSTIKKIEEETGVKIDIPEDGSEERVVEITGPPENVEKAAELIL 65

Query: 122 QQLE 125
           + LE
Sbjct: 66  EILE 69