RPSBLAST alignment for GI: 254780255 and conserved domain: TIGR01009

>gnl|CDD|130082 TIGR01009, rpsC_bact, ribosomal protein S3, bacterial type. TIGRFAMs model TIGR01008 describes S3 of the eukaryotic cytosol and of the archaea. Length = 211
 Score =  296 bits (761), Expect = 2e-81
 Identities = 115/202 (56%), Positives = 152/202 (75%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQK+NPI FRLG+   W SRW+A   EY  LLHEDLKIR Y++  L  AG++ + IER 
Sbjct: 1   MGQKVNPIGFRLGITKDWKSRWYANPKEYAKLLHEDLKIRNYIKKELSNAGISDVEIERP 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
               R+ +++ARPG++IGKKG++IEK+RK L  +T  E+ +++ EV +PE++A L+A +I
Sbjct: 61  ADKIRVTIHTARPGIVIGKKGSEIEKLRKDLQKLTGKEVQINIAEVKRPELDAQLVADNI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           A+QLE RV FRRAMK+A+QSAM+ GA G+KV  SGRL GAE++RTE Y EGRVPL TLRA
Sbjct: 121 ARQLENRVSFRRAMKKAIQSAMKAGAKGIKVQVSGRLGGAEIARTEWYKEGRVPLHTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYV 202
            IDY TA A T YG  G+KV++
Sbjct: 181 DIDYATAEAHTTYGIIGVKVWI 202