RPSBLAST alignment for GI: 254780255 and conserved domain: CHL00048

>gnl|CDD|176989 CHL00048, rps3, ribosomal protein S3. Length = 214
 Score =  233 bits (597), Expect = 3e-62
 Identities = 94/209 (44%), Positives = 135/209 (64%), Gaps = 7/209 (3%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIRE----YLQCHLKQAGVAKIL 56
           MGQKINP+ FRLG     +S WFA+   Y   L ED KIR+    Y+Q ++K  G+A+I 
Sbjct: 1   MGQKINPLGFRLGTTQKHHSLWFAQPKNYSEGLQEDKKIRDCIKNYVQKNIKYEGIARIE 60

Query: 57  IERTHKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNS---EIHLSVNEVPKPEINA 113
           I+R     ++I+Y+  P L+I +KG  IE+++  L    NS   ++++++ EV KP    
Sbjct: 61  IQRKIDLIQVIIYTGFPKLLIERKGRGIEELQINLQKELNSVNRKLNINITEVKKPYGEP 120

Query: 114 TLIAQSIAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRV 173
            ++A+ IA QLE RV FR+AMK+A++ A +    G+K+  SGRLNGAE++R E   EGRV
Sbjct: 121 NILAEYIAGQLENRVSFRKAMKKAIELAEKADIKGIKIQISGRLNGAEIARVEWIREGRV 180

Query: 174 PLQTLRAHIDYGTAVAETAYGSCGIKVYV 202
           PLQTLRA IDY +  A T YG  GIK+++
Sbjct: 181 PLQTLRAKIDYCSYPARTIYGVLGIKIWI 209