RPSBLAST alignment for GI: 254780255 and conserved domain: cd02411

>gnl|CDD|48409 cd02411, archeal_30S_S3_KH, K homology RNA-binding domain (KH) of the archaeal 30S small ribosomal subunit S3 protein. S3 is part of the head region of the 30S ribosomal subunit and is believed to interact with mRNA as it threads its way from the latch into the channel. The KH motif is a beta-alpha-alpha-beta-beta unit that folds into an alpha-beta structure with a three stranded beta-sheet interupted by two contiguous helices. In general, KH binds single-stranded RNA or DNA. It is found in a wide variety of proteins including ribosomal proteins, transcription factors and post-transcriptional modifiers of mRNA.. Length = 85
 Score = 49.4 bits (118), Expect = 8e-07
 Identities = 24/73 (32%), Positives = 39/73 (53%), Gaps = 1/73 (1%)

Query: 37  LKIREYLQCHLKQAGVAKILIERTHKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTN 96
             I EYL+  L++AG   + I RT    +I +Y+ RPG++IG+ G +I ++ + L     
Sbjct: 13  TMIDEYLEKELERAGYGGMEILRTPLGTQITIYAERPGMVIGRGGKNIRELTEILETKFG 72

Query: 97  SE-IHLSVNEVPK 108
            E   + V EV  
Sbjct: 73  LENPQIDVQEVEN 85