RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780255|ref|YP_003064668.1| 30S ribosomal protein S3 [Candidatus Liberibacter asiaticus str. psy62] (227 letters) >gnl|CDD|30441 COG0092, RpsC, Ribosomal protein S3 [Translation, ribosomal structure and biogenesis]. Length = 233 Score = 255 bits (653), Expect = 6e-69 Identities = 118/217 (54%), Positives = 154/217 (70%), Gaps = 1/217 (0%) Query: 12 LGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERTHKNCRIIVYSA 71 LG+ W SRWFA EY LL EDLKIRE+L+ L AG++ + IERT K R+ +++A Sbjct: 1 LGITKDWKSRWFANKKEYAKLLVEDLKIREFLEKELSNAGISGVEIERTPKGTRVTIHAA 60 Query: 72 RPGLIIGKKGTDIEKIRKKLSNMTNSE-IHLSVNEVPKPEINATLIAQSIAQQLERRVVF 130 RPGL+IGKKG++IEK+RK+L + E + +++ EV KPE++A L+A+SIAQQLERRV F Sbjct: 61 RPGLVIGKKGSNIEKLRKELEKLFGKENVQINIEEVKKPELDAQLVAESIAQQLERRVSF 120 Query: 131 RRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRAHIDYGTAVAE 190 RRAMKRA+Q AMR GA G+K+ SGRL GAE++RTE Y EGRVPL TLRA IDYGTA A Sbjct: 121 RRAMKRAIQRAMRAGAKGIKIQVSGRLGGAEIARTEKYREGRVPLHTLRADIDYGTAEAH 180 Query: 191 TAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227 T YG G+KV++ + + D AE ++S Sbjct: 181 TTYGVIGVKVWIYKGEVLPDKVEIKEPAEVEEPAEES 217 >gnl|CDD|176989 CHL00048, rps3, ribosomal protein S3. Length = 214 Score = 233 bits (597), Expect = 3e-62 Identities = 94/209 (44%), Positives = 135/209 (64%), Gaps = 7/209 (3%) Query: 1 MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIRE----YLQCHLKQAGVAKIL 56 MGQKINP+ FRLG +S WFA+ Y L ED KIR+ Y+Q ++K G+A+I Sbjct: 1 MGQKINPLGFRLGTTQKHHSLWFAQPKNYSEGLQEDKKIRDCIKNYVQKNIKYEGIARIE 60 Query: 57 IERTHKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNS---EIHLSVNEVPKPEINA 113 I+R ++I+Y+ P L+I +KG IE+++ L NS ++++++ EV KP Sbjct: 61 IQRKIDLIQVIIYTGFPKLLIERKGRGIEELQINLQKELNSVNRKLNINITEVKKPYGEP 120 Query: 114 TLIAQSIAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRV 173 ++A+ IA QLE RV FR+AMK+A++ A + G+K+ SGRLNGAE++R E EGRV Sbjct: 121 NILAEYIAGQLENRVSFRKAMKKAIELAEKADIKGIKIQISGRLNGAEIARVEWIREGRV 180 Query: 174 PLQTLRAHIDYGTAVAETAYGSCGIKVYV 202 PLQTLRA IDY + A T YG GIK+++ Sbjct: 181 PLQTLRAKIDYCSYPARTIYGVLGIKIWI 209 >gnl|CDD|48410 cd02412, 30S_S3_KH, K homology RNA-binding (KH) domain of the prokaryotic 30S small ribosomal subunit protein S3. S3 is part of the head region of the 30S ribosomal subunit and is believed to interact with mRNA as it threads its way from the latch into the channel. The KH motif is a beta-alpha-alpha-beta-beta unit that folds into an alpha-beta structure with a three stranded beta-sheet interupted by two contiguous helices. In general, KH binds single-stranded RNA or DNA. It is found in a wide variety of proteins including ribosomal proteins, transcription factors and post-transcriptional modifiers of mRNA.. Length = 109 Score = 145 bits (367), Expect = 1e-35 Identities = 52/109 (47%), Positives = 80/109 (73%), Gaps = 1/109 (0%) Query: 2 GQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERTH 61 GQK+NP+ FRLG+ W+SRW+A +Y LLHEDLKIR++++ LK+AG+++I IER Sbjct: 1 GQKVNPLGFRLGITKDWDSRWYADKKDYAELLHEDLKIRKFIKKKLKKAGISRIEIERKA 60 Query: 62 KNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNS-EIHLSVNEVPKP 109 + +++ARPG+IIGKKG IEK+RK+L + + ++ +++ EV KP Sbjct: 61 DRVEVTIHTARPGIIIGKKGAGIEKLRKELQKLLGNKKVRINIVEVKKP 109 >gnl|CDD|143952 pfam00189, Ribosomal_S3_C, Ribosomal protein S3, C-terminal domain. This family contains a central domain pfam00013, hence the amino and carboxyl terminal domains are stored separately. This is a minimal carboxyl-terminal domain. Some are much longer. Length = 85 Score = 120 bits (304), Expect = 3e-28 Identities = 52/85 (61%), Positives = 65/85 (76%), Gaps = 1/85 (1%) Query: 119 SIAQQLERRVVFRRAMKRAVQSAMRF-GADGVKVIASGRLNGAELSRTECYLEGRVPLQT 177 IAQQLERR+ FRRA+K+A++ M+ GA G+K+ SGRLNGAE +RTE Y EGRVPL T Sbjct: 1 RIAQQLERRISFRRAIKQAIRRIMKKAGAKGIKIQISGRLNGAERARTEKYKEGRVPLHT 60 Query: 178 LRAHIDYGTAVAETAYGSCGIKVYV 202 LRA IDY A A+T YG G+KV++ Sbjct: 61 LRADIDYAFAEAKTKYGVIGVKVWI 85 >gnl|CDD|109474 pfam00417, Ribosomal_S3_N, Ribosomal protein S3, N-terminal domain. This family contains a central domain pfam00013, hence the amino and carboxyl-terminal domains are stored separately. Length = 62 Score = 86.9 bits (216), Expect = 4e-18 Identities = 34/60 (56%), Positives = 44/60 (73%) Query: 1 MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60 MGQK+NPI FRLG+ W+S+WFA Y LL+EDLKIR Y+ +LK AG+++I IER Sbjct: 1 MGQKVNPIGFRLGITRNWDSKWFANKKNYAKLLNEDLKIRNYINKNLKPAGISRIEIERK 60 >gnl|CDD|38391 KOG3181, KOG3181, KOG3181, 40S ribosomal protein S3 [Translation, ribosomal structure and biogenesis]. Length = 244 Score = 52.3 bits (125), Expect = 1e-07 Identities = 42/172 (24%), Positives = 79/172 (45%), Gaps = 6/172 (3%) Query: 38 KIREYLQCHLKQAGVAKILIERTHKNCRIIVYSARPGLIIGKKGTDIEKIR---KKLSNM 94 ++ E+L L + G + + + T II+ + R ++G+KG I ++ +K Sbjct: 20 ELNEFLTRELAEDGYSGVEVRVTPTRTEIIIRATRTQNVLGEKGRRIRELTSLVQKRFKF 79 Query: 95 TNSEIHLSVNEVPKPEINATLIAQSIAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIAS 154 + L +V + A A+S+ +L + RRA ++ M GA G +VI S Sbjct: 80 PEGSVELYAEKVANRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFVMESGAKGCEVIVS 139 Query: 155 GRLNGAELSRTECYLEGRV--PLQTLRAHIDYGTAVAETAYGSCGIKVYVSL 204 G+L G +++ +++G + Q ++ +ID G GIKV + L Sbjct: 140 GKLRGQR-AKSMKFVDGLMIHSGQPVKDYIDTAVRHVLLRQGVLGIKVKIML 190 >gnl|CDD|48409 cd02411, archeal_30S_S3_KH, K homology RNA-binding domain (KH) of the archaeal 30S small ribosomal subunit S3 protein. S3 is part of the head region of the 30S ribosomal subunit and is believed to interact with mRNA as it threads its way from the latch into the channel. The KH motif is a beta-alpha-alpha-beta-beta unit that folds into an alpha-beta structure with a three stranded beta-sheet interupted by two contiguous helices. In general, KH binds single-stranded RNA or DNA. It is found in a wide variety of proteins including ribosomal proteins, transcription factors and post-transcriptional modifiers of mRNA.. Length = 85 Score = 49.4 bits (118), Expect = 8e-07 Identities = 24/73 (32%), Positives = 39/73 (53%), Gaps = 1/73 (1%) Query: 37 LKIREYLQCHLKQAGVAKILIERTHKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTN 96 I EYL+ L++AG + I RT +I +Y+ RPG++IG+ G +I ++ + L Sbjct: 13 TMIDEYLEKELERAGYGGMEILRTPLGTQITIYAERPGMVIGRGGKNIRELTEILETKFG 72 Query: 97 SE-IHLSVNEVPK 108 E + V EV Sbjct: 73 LENPQIDVQEVEN 85 >gnl|CDD|48407 cd02409, KH-II, KH-II (K homology RNA-binding domain, type II). KH binds single-stranded RNA or DNA. It is found in a wide variety of proteins including ribosomal proteins (e.g. ribosomal protein S3), transcription factors (e.g. NusA_K), and post-transcriptional modifiers of mRNA (e.g. hnRNP K). There are two different KH domains that belong to different protein folds, but they share a single KH motif. The KH motif is a beta-alpha-alpha-beta-beta unit that folds into an alpha-beta structure with a three stranded beta-sheet interupted by two contiguous helices. In addition to their KH core domain, KH-II proteins have an N-terminal alpha helical extension while KH-I proteins have a C-terminal alpha helical extension.. Length = 68 Score = 49.5 bits (118), Expect = 8e-07 Identities = 25/59 (42%), Positives = 36/59 (61%), Gaps = 2/59 (3%) Query: 40 REYLQCHLKQAGVAKILIERTHKNCRIIVYSAR--PGLIIGKKGTDIEKIRKKLSNMTN 96 RE+L+ L AG++ + IERT II+ AR PGL+IGKKG +I ++K L + Sbjct: 1 REFLKKLLAPAGISGVEIERTPDRIEIIIVVARGQPGLVIGKKGQNIRALQKLLQKLLR 59 >gnl|CDD|36877 KOG1664, KOG1664, KOG1664, Vacuolar H+-ATPase V1 sector, subunit E [Energy production and conversion]. Length = 220 Score = 32.9 bits (75), Expect = 0.065 Identities = 28/117 (23%), Positives = 52/117 (44%), Gaps = 20/117 (17%) Query: 35 EDLKIREYLQCHLKQAGVAKILIERTHKN-CRIIVYSARPGLIIGKKGTDI-EKIRKKLS 92 + LKI +Y + KQ + K + + N R+ V AR +I DI ++ +K+LS Sbjct: 47 QRLKIMQYYEKKEKQVELQKKIAKSNLLNQSRLKVLRARDDII-----DDILDEAKKRLS 101 Query: 93 NMTNSEIHLSVNEVPKPEINATLIAQSIAQQLERRVVFR------RAMKRAVQSAMR 143 ++ + ++ LI Q + Q LE V+ R + ++ A+ A+ Sbjct: 102 KVSK-------DTDRYKKLLKDLIVQGLLQLLEPEVIVRCREKDLKLVEAALPKAIE 151 >gnl|CDD|29006 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like. Members of this group possess KH domains in a tandem arrangement. Most members, similar to the poly(C) binding proteins (PCBPs) and Nova, containing three KH domains, with the first and second domains, which are represented here, in tandem arrangement, followed by a large spacer region, with the third domain near the C-terminal end of the protein. The poly(C) binding proteins (PCBPs) can be divided into two groups, hnRNPs K/J and the alphaCPs, which share a triple KH domain configuration and poly(C) binding specificity. They play roles in mRNA stabilization, translational activation, and translational silencing. Nova-1 and Nova-2 are nuclear RNA-binding proteins that regulate splicing. This group also contains plant proteins that seem to have two tandem repeat arrrangements, like Hen4, a protein that plays a role in AGAMOUS (AG) pre-mRNA processing and important step in plant development. In general, KH binds single-stranded RNA or DNA. It is found in a wide variety of proteins including ribosomal proteins, transcription factors and post-transcriptional modifiers of mRNA.. Length = 65 Score = 32.4 bits (74), Expect = 0.12 Identities = 16/45 (35%), Positives = 30/45 (66%), Gaps = 4/45 (8%) Query: 63 NCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVP 107 R++V S++ G IIGK G+ I++IR++ T ++I +S + +P Sbjct: 1 TLRLLVPSSQAGSIIGKGGSTIKEIREE----TGAKIRVSKSVLP 41 >gnl|CDD|31968 COG1782, COG1782, Predicted metal-dependent RNase, consists of a metallo-beta-lactamase domain and an RNA-binding KH domain [General function prediction only]. Length = 637 Score = 31.4 bits (71), Expect = 0.22 Identities = 14/60 (23%), Positives = 30/60 (50%), Gaps = 2/60 (3%) Query: 31 ALLHEDLKIREYLQCHLKQAGVAKILIERTHKNCRIIVYSARPGLIIGKKGTDIEKIRKK 90 L + + L+ ++AG+ I + +I+ + +PGL+IGK G+ + +I + Sbjct: 70 VLKPPEEARKIILEIVPEEAGITDIYFDDD--TGEVIIEAKKPGLVIGKGGSTLREITAE 127 >gnl|CDD|37402 KOG2191, KOG2191, KOG2191, RNA-binding protein NOVA1/PASILLA and related KH domain proteins [RNA processing and modification, General function prediction only]. Length = 402 Score = 30.4 bits (68), Expect = 0.43 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 6/56 (10%) Query: 38 KIREYLQCHLKQAGVAKILIERTH---KNCRIIVYSARPGLIIGKKGTDIEKIRKK 90 KIRE Q A IL +T K +I+V ++ G+IIGK G I+ I+++ Sbjct: 108 KIREKPQ---AVAKPVDILQPQTPDRIKQIKIVVPNSTAGMIIGKGGATIKAIQEQ 160 >gnl|CDD|37401 KOG2190, KOG2190, KOG2190, PolyC-binding proteins alphaCP-1 and related KH domain proteins [RNA processing and modification, General function prediction only]. Length = 485 Score = 30.1 bits (67), Expect = 0.53 Identities = 16/52 (30%), Positives = 31/52 (59%), Gaps = 4/52 (7%) Query: 56 LIERTHKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVP 107 CR++V S++ G +IGK G+ I++IR++ T ++I +S + +P Sbjct: 132 DASGPEVTCRLLVPSSQVGSLIGKGGSLIKEIREE----TGAKIRVSSDMLP 179 Score = 29.3 bits (65), Expect = 0.85 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 4/46 (8%) Query: 65 RIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPE 110 R++ + G IIGKKG ++KIRK+ T S+I ++ + PE Sbjct: 46 RLLCHVKEVGSIIGKKGDIVKKIRKE----TESKIRVNESLPGCPE 87 Score = 28.9 bits (64), Expect = 1.2 Identities = 20/66 (30%), Positives = 28/66 (42%), Gaps = 10/66 (15%) Query: 65 RIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKP------EINATLIAQ 118 R++V S G IIGK G I +IR+ T + I + E +I L Sbjct: 341 RLLVPSDLIGCIIGKGGAKISEIRQ----RTGASISILNKEEVSGVREALVQITGMLRED 396 Query: 119 SIAQQL 124 +AQ L Sbjct: 397 LLAQYL 402 >gnl|CDD|48411 cd02413, 40S_S3_KH, K homology RNA-binding (KH) domain of the eukaryotic 40S small ribosomal subunit protein S3. S3 is part of the head region of the 40S ribosomal subunit and is believed to interact with mRNA as it threads its way from the latch into the channel. The KH motif is a beta-alpha-alpha-beta-beta unit that folds into an alpha-beta structure with a three stranded beta-sheet interupted by two contiguous helices. In general, KH binds single-stranded RNA or DNA. It is found in a wide variety of proteins including ribosomal proteins, transcription factors and post-transcriptional modifiers of mRNA.. Length = 81 Score = 30.1 bits (68), Expect = 0.55 Identities = 12/49 (24%), Positives = 25/49 (51%) Query: 39 IREYLQCHLKQAGVAKILIERTHKNCRIIVYSARPGLIIGKKGTDIEKI 87 + E+L L + G + + + T II+ + R ++G+KG I ++ Sbjct: 7 LNEFLTRELAEDGYSGVEVRVTPTRTEIIIRATRTQNVLGEKGRRIREL 55 >gnl|CDD|29002 cd00105, KH-I, K homology RNA-binding domain, type I. KH binds single-stranded RNA or DNA. It is found in a wide variety of proteins including ribosomal proteins, transcription factors and post-transcriptional modifiers of mRNA. There are two different KH domains that belong to different protein folds, but they share a single KH motif. The KH motif is folded into a beta alpha alpha beta unit. In addition to the core, type II KH domains (e.g. ribosomal protein S3) include N-terminal extension and type I KH domains (e.g. hnRNP K) contain C-terminal extension.. Length = 64 Score = 29.8 bits (67), Expect = 0.62 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 4/46 (8%) Query: 65 RIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPE 110 R++V S+ G IIGK G+ I++IR++ T ++I + + E Sbjct: 3 RVLVPSSLVGRIIGKGGSTIKEIREE----TGAKIKIPDSGSGSEE 44 >gnl|CDD|31353 COG1159, Era, GTPase [General function prediction only]. Length = 298 Score = 29.8 bits (67), Expect = 0.62 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 16/54 (29%) Query: 53 AKILIER-THKNCRIIVYSARPGLIIGKKGTDIEKI----RKKLSNMTNSEIHL 101 A I +ER + K G+IIGK G I+KI RK + + +++L Sbjct: 231 ATIYVERESQK-----------GIIIGKNGAMIKKIGTAARKDIEKLLGCKVYL 273 >gnl|CDD|30042 cd01299, Met_dep_hydrolase_A, Metallo-dependent hydrolases, subgroup A is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site. The vast majority of the members have a conserved metal binding site, involving four histidines and one aspartic acid residue. In the common reaction mechanism, the metal ion (or ions) deprotonate a water molecule for a nucleophilic attack on the substrate. The function of this subgroup is unknown.. Length = 342 Score = 29.1 bits (65), Expect = 1.1 Identities = 22/70 (31%), Positives = 38/70 (54%), Gaps = 8/70 (11%) Query: 134 MKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRAHID----YGTAVA 189 ++ AV+ +R GAD +K++A+G + LS + + + + LRA +D G VA Sbjct: 122 VRAAVREQLRRGADQIKIMATGGV----LSPGDPPPDTQFSEEELRAIVDEAHKAGLYVA 177 Query: 190 ETAYGSCGIK 199 AYG+ I+ Sbjct: 178 AHAYGAEAIR 187 >gnl|CDD|48406 cd02134, NusA_KH, NusA_K homology RNA-binding domain (KH). NusA is an essential multifunctional transcription elongation factor that is universally conserved among prokaryotes and archaea. NusA anti-termination function plays an important role in the expression of ribosomal rrn operons. During transcription of many other genes, NusA-induced RNAP pausing provides a mechanism for synchronizing transcription and translation . The N-terminal RNAP-binding domain (NTD) is connected through a flexible hinge helix to three globular domains, S1, KH1 and KH2. The KH motif is a beta-alpha-alpha-beta-beta unit that folds into an alpha-beta structure with a three stranded beta-sheet interupted by two contiguous helices.. Length = 61 Score = 28.2 bits (63), Expect = 1.8 Identities = 13/54 (24%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 39 IREYLQCHLKQAGVAKILIERTHKNCRIIVYSARP-GLIIGKKGTDIEKIRKKL 91 E+++ L A V + + + +V GL IGK G ++ K L Sbjct: 1 PAEFIRNALSPAKVTSVTVLDDEEKRARVVVPDDQLGLAIGKGGQNVRLASKLL 54 >gnl|CDD|111443 pfam02543, CmcH_NodU, Carbamoyltransferase. This family consists of NodU from Rhizobium and CmcH from Nocardia lactamdurans. NodU a Rhizobium nodulation protein involved in the synthesis of nodulation factors has 6-O-carbamoyltransferase-like activity. CmcH is involved in cephamycin (antibiotic) biosynthesis and has 3-hydroxymethylcephem carbamoyltransferase activity, EC:2.1.3.7 catalysing the reaction: Carbamoyl phosphate + 3-hydroxymethylceph-3-EM-4-carboxylate <=> phosphate + 3-carbamoyloxymethylcephem. Length = 360 Score = 27.7 bits (62), Expect = 2.8 Identities = 8/23 (34%), Positives = 10/23 (43%), Gaps = 2/23 (8%) Query: 6 NPILFRLGV--NCTWNSRWFARG 26 + GV N WNS+ RG Sbjct: 165 RNLCIAGGVALNVKWNSKLRRRG 187 >gnl|CDD|32040 COG1855, COG1855, ATPase (PilT family) [General function prediction only]. Length = 604 Score = 27.5 bits (61), Expect = 3.0 Identities = 16/68 (23%), Positives = 29/68 (42%), Gaps = 3/68 (4%) Query: 25 RGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERTHKNCRIIVYSARPGLIIGKKGTDI 84 E AL + +I ++ +L G ++ + + + V +IGK G I Sbjct: 452 EEEESPALKLAEEEIEREIKRYLP--GDVEVEVVGDGR-AVVKVPEKYIPKVIGKGGKRI 508 Query: 85 EKIRKKLS 92 ++I KKL Sbjct: 509 KEIEKKLG 516 >gnl|CDD|48408 cd02410, archeal_CPSF_KH, The archaeal cleavage and polyadenylation specificity factor (CPSF) contains an N-terminal K homology RNA-binding domain (KH). The archeal CPSFs are predicted to be metal-dependent RNases belonging to the beta-CASP family, a subgroup enzymes within the metallo-beta-lactamase fold. The KH motif is a beta-alpha-alpha-beta-beta unit that folds into an alpha-beta structure with a three stranded beta-sheet interupted by two contiguous helices. In general, KH domains are known to bind single-stranded RNA or DNA and are found in a wide variety of proteins including ribosomal proteins, transcription factors and post-transcriptional modifiers of mRNA.. Length = 145 Score = 27.5 bits (61), Expect = 3.2 Identities = 12/43 (27%), Positives = 26/43 (60%), Gaps = 2/43 (4%) Query: 48 KQAGVAKILIERTHKNCRIIVYSARPGLIIGKKGTDIEKIRKK 90 ++AG+ I + +I+ + +PGL+IGK G+ + +I ++ Sbjct: 64 EEAGITDIYFDDD--TGEVIIEAEKPGLVIGKGGSTLREITRE 104 >gnl|CDD|36249 KOG1031, KOG1031, KOG1031, Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only]. Length = 1169 Score = 27.4 bits (60), Expect = 3.7 Identities = 12/32 (37%), Positives = 16/32 (50%) Query: 9 LFRLGVNCTWNSRWFARGSEYGALLHEDLKIR 40 +F +N WNS WF + L E L+IR Sbjct: 42 VFLKSLNPQWNSDWFKFEVDDADLQDEPLQIR 73 >gnl|CDD|153302 cd07618, BAR_Rich1, The Bin/Amphiphysin/Rvs (BAR) domain of RhoGAP interacting with CIP4 homologs protein 1. BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. RhoGAP interacting with CIP4 homologs protein 1 (Rich1) is also called Neuron-associated developmentally-regulated protein (Nadrin) or Rho GTPase activating protein 17 (ARHGAP17). It is a Cdc42- and Rac-specific GAP that binds to polarity proteins through the scaffold protein angiomotin and plays a role in maintaining the integrity of tight junctions. It may be a component of a sorting mechanism in the recycling of tight junction transmembrane proteins. Rich1 contains an N-terminal BAR domain followed by a Rho GAP domain and a C-terminal proline-rich domain. It interacts with the BAR domain proteins endophilin and amphiphysin through its proline-rich region. The BAR domain of Rich1 forms oligomers and can bind membranes and induce membrane tubulation. Length = 246 Score = 26.9 bits (59), Expect = 5.2 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 3/40 (7%) Query: 55 ILIERTHKNCRIIVYSARPGLII---GKKGTDIEKIRKKL 91 + IER R + ++ LI G+ GTD EK KKL Sbjct: 18 LQIERRLDTVRSVSHNVHKRLIACFQGQVGTDAEKRHKKL 57 >gnl|CDD|132736 cd06938, NR_LBD_EcR, The ligand binding domain (LBD) of the Ecdysone receptor, a member of the nuclear receptors super family. The ligand binding domain (LBD) of the ecdysone receptor: The ecdysone receptor (EcR) belongs to the superfamily of nuclear receptors (NRs) of ligand-dependent transcription factors. Ecdysone receptor is present only in invertebrates and regulates the expression of a large number of genes during development and reproduction. ECR functions as a heterodimer by partnering with ultraspiracle protein (USP), the ortholog of the vertebrate retinoid X receptor (RXR). The natural ligands of ecdysone receptor are ecdysteroids#the endogenous steroidal hormones found in invertebrates. In addition, insecticide bisacylhydrazine used against pests has shown to act on EcR. EcR must be dimerised with a USP for high-affinity ligand binding to occur. The ligand binding triggers a conformational change in the C-terminal part of the EcR ligand-binding domain that leads to transcriptional activation of genes controlled by EcR. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, ec dysone receptors have a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a non-conserved hinge and a C-terminal ligand binding domain (LBD). Length = 231 Score = 26.2 bits (58), Expect = 8.1 Identities = 10/22 (45%), Positives = 16/22 (72%) Query: 66 IIVYSARPGLIIGKKGTDIEKI 87 I+++S RPGL+ KK I++I Sbjct: 148 IVIFSDRPGLLQPKKVEKIQEI 169 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.320 0.134 0.387 Gapped Lambda K H 0.267 0.0690 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,624,125 Number of extensions: 130956 Number of successful extensions: 427 Number of sequences better than 10.0: 1 Number of HSP's gapped: 418 Number of HSP's successfully gapped: 35 Length of query: 227 Length of database: 6,263,737 Length adjustment: 90 Effective length of query: 137 Effective length of database: 4,318,927 Effective search space: 591692999 Effective search space used: 591692999 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 56 (25.4 bits)