RPSBLAST alignment of GI: 254780255 and MMDB domain: 1wh9_A_

>1wh9_A (A:) 40S ribosomal protein S3; KH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, ribosome; NMR {Homo sapiens}Length = 92
 Score =  108 bits (273), Expect = 5e-25
 Identities = 17/96 (17%), Positives = 36/96 (37%), Gaps = 11/96 (11%)

Query: 33  LHEDLKIREYLQCHLKQAGVAKILIERTHKNCRIIVYSARPGLIIGKKGTDIEKIRKKLS 92
                ++ E+L   L + G + + +  T     II+ + R   ++G+KG  I ++   + 
Sbjct: 6   SGFKAELNEFLTRELAEDGYSGVEVRVTPTRTEIIILATRTQNVLGEKGRRIRELTAVVQ 65

Query: 93  NMTNSEIHLSVNEVPKPEINATLIAQSIAQQLERRV 128
                           PE +  L A+ +A +     
Sbjct: 66  -----------KRFGFPEGSVELYAEKVATRGSGPS 90