RPSBLAST alignment of GI: 254780255 and MMDB domain: 3i1m_C_110-233

>3i1m_C (C:110-233) 30S ribosomal protein S3; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1vs7_C* 3e1a_O 3e1c_O 1vs5_C 3i1o_C 3i1q_C 3i1s_C 3i1z_C 3i21_C 2qal_C* 1p6g_C 1p87_C 2aw7_C 2avy_C 2i2u_C 2i2p_C* 2qan_C* 2qb9_C* 2qbb_C* 2qbd_C ...Length = 124
 Score =  120 bits (302), Expect = 2e-28
 Identities = 63/116 (54%), Positives = 79/116 (68%)

Query: 110 EINATLIAQSIAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYL 169
           E++A L+A SI  QLERRV+FRRAMKRAVQ+AMR GA G+KV  SGRL GAE++RTE Y 
Sbjct: 1   ELDAKLVADSITSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYR 60

Query: 170 EGRVPLQTLRAHIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEK 225
           EGRVPL TLRA IDY T+ A T YG  G+KV++   + +    +     +     K
Sbjct: 61  EGRVPLHTLRADIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEKPAAQPK 116