RPSBLAST alignment of GI: 254780255 and protein with PDBid: 1wh9

>1wh9_A 40S ribosomal protein S3; KH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, ribosome; NMR {Homo sapiens} SCOP: d.52.3.1 Length = 92
 Score = 72.4 bits (178), Expect = 7e-14
 Identities = 14/72 (19%), Positives = 31/72 (43%), Gaps = 3/72 (4%)

Query: 38  KIREYLQCHLKQAGVAKILIERTHKNCRIIVYSARPGLIIGKKGTDIEKIRKKLS---NM 94
           ++ E+L   L + G + + +  T     II+ + R   ++G+KG  I ++   +      
Sbjct: 11  ELNEFLTRELAEDGYSGVEVRVTPTRTEIIILATRTQNVLGEKGRRIRELTAVVQKRFGF 70

Query: 95  TNSEIHLSVNEV 106
               + L   +V
Sbjct: 71  PEGSVELYAEKV 82