BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254780255|ref|YP_003064668.1| 30S ribosomal protein S3
[Candidatus Liberibacter asiaticus str. psy62]
         (227 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254780255|ref|YP_003064668.1| 30S ribosomal protein S3 [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 227

 Score =  469 bits (1207), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 227/227 (100%), Positives = 227/227 (100%)

Query: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60
           MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT
Sbjct: 1   MGQKINPILFRLGVNCTWNSRWFARGSEYGALLHEDLKIREYLQCHLKQAGVAKILIERT 60

Query: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120
           HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI
Sbjct: 61  HKNCRIIVYSARPGLIIGKKGTDIEKIRKKLSNMTNSEIHLSVNEVPKPEINATLIAQSI 120

Query: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180
           AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA
Sbjct: 121 AQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLNGAELSRTECYLEGRVPLQTLRA 180

Query: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227
           HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS
Sbjct: 181 HIDYGTAVAETAYGSCGIKVYVSLRDEVSDSDSTIPAAEHRVVEKDS 227


>gi|254781033|ref|YP_003065446.1| HemY domain-containing protein [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 492

 Score = 29.3 bits (64), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 18/79 (22%), Positives = 40/79 (50%), Gaps = 4/79 (5%)

Query: 101 LSVNEVPKPEINATL--IAQSIAQQLERRVVFRRAMKRAVQSAMRFGADGVKVIASGRLN 158
           L++   P+ EI   L  I Q+ +   ++ + + ++   A+   +    DG   ++S  L 
Sbjct: 350 LAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGY--LSSVWLP 407

Query: 159 GAELSRTECYLEGRVPLQT 177
            + +S+T CY E ++P ++
Sbjct: 408 LSPISKTLCYFEWKIPTKS 426


>gi|254781051|ref|YP_003065464.1| alpha-ketoglutarate decarboxylase [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 957

 Score = 25.0 bits (53), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 19/35 (54%)

Query: 118 QSIAQQLERRVVFRRAMKRAVQSAMRFGADGVKVI 152
           + I  +L R   F + +    + A RFGADG +VI
Sbjct: 212 RDILDKLVRAEGFEKFIDIKYKGAKRFGADGSEVI 246


>gi|254780787|ref|YP_003065200.1| translation initiation factor IF-2 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 884

 Score = 24.3 bits (51), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 8/25 (32%), Positives = 17/25 (68%)

Query: 161 ELSRTECYLEGRVPLQTLRAHIDYG 185
           +++ +E  L+ R P+ T+  H+D+G
Sbjct: 371 DVADSESDLDIRPPVVTIMGHVDHG 395


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.320    0.134    0.387 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 133,080
Number of Sequences: 1233
Number of extensions: 4977
Number of successful extensions: 20
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 13
Number of HSP's gapped (non-prelim): 9
length of query: 227
length of database: 328,796
effective HSP length: 71
effective length of query: 156
effective length of database: 241,253
effective search space: 37635468
effective search space used: 37635468
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 37 (18.9 bits)