HHsearch alignment of GI: 254780256 and MMDB domain: 3bbo_U_

>3bbo_U (U:) Ribosomal protein L22; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea}
Probab=100.00  E-value=3.3e-38  Score=245.56  Aligned_cols=117  Identities=28%  Similarity=0.359  Sum_probs=112.6

Q ss_pred             HHHHEEEEECCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCCHHHEEEEEEEEC
Q ss_conf             10112311214875088999999998479869999988865820247999999999999998405998233699999988
Q gi|254780256|r   12 MGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLIVSEAYVG   91 (131)
Q Consensus        12 ~~~~e~~A~~k~ir~Sp~K~r~va~~IrG~~v~eAl~~L~f~~kk~A~~i~k~L~SA~aNA~~n~~ld~~~L~I~~~~v~   91 (131)
                      ..+.+++|.++++++||+|++++|++||||+|++|+.||+|+|+++|.+|+++|.||++||++++|+|+|+|||+++|||
T Consensus        27 ~~~~~~~a~~~~ir~S~KK~~~va~~IrG~~v~eA~~~L~~~~kK~a~~i~k~L~sA~anA~~~~~~d~~~L~I~~~~v~  106 (199)
T 3bbo_U           27 GKCDEITTRGYSISMSVDKARRVIDQIRGRSYAETLMILELMPYRACYPIFKLIYSAAANASHNKQFNKANLIISKAEVN  106 (199)
T ss_dssp             ---CCBCCCCSCCSSCSSSSSTTHHHHTTCBTTTTTTTGGGCCCTTHHHHHHHHHHHTTHHHHTSSCCSSSCEEEECCCC
T ss_pred             CCCCEEEEECCEEEECHHHHHHHHHHHCCCCHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEEEC
T ss_conf             98514899768521487999999999869919999999712966679999999999999997225555553489999988


Q ss_pred             CCCEEEEEEECCCCCCCCEECCCCEEEEEEEECCCCC
Q ss_conf             9811420102566663720178500899998517233
Q gi|254780256|r   92 KSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG  128 (131)
Q Consensus        92 ~G~~~KR~~prarGRa~~i~k~~sHi~VvL~e~~~~~  128 (131)
                      +||++||++|||+||++++++++|||+|||+|.+++.
T Consensus       107 ~g~~~kr~~~rArGR~~~~~~~~~hi~ivL~E~~~~~  143 (199)
T 3bbo_U          107 KGITLKKVKPRARGRSYMILRPTCHITIVLRDITHFD  143 (199)
T ss_dssp             BCCCCCCCCCSSSSCSCCCCCCCBCCCCEEECCCCCC
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEECCCHH
T ss_conf             8973548798746788775589723899998787146