BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780256|ref|YP_003064669.1| 50S ribosomal protein L22
[Candidatus Liberibacter asiaticus str. psy62]
         (131 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done


Results from round 1


>gi|254780256|ref|YP_003064669.1| 50S ribosomal protein L22 [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254039933|gb|ACT56729.1| 50S ribosomal protein L22 [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 131

 Score =  261 bits (667), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 131/131 (100%), Positives = 131/131 (100%)

Query: 1   MSGKRSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGE 60
           MSGKRSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGE
Sbjct: 1   MSGKRSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGE 60

Query: 61  VRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVI 120
           VRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVI
Sbjct: 61  VRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVI 120

Query: 121 VREVSDEGKVV 131
           VREVSDEGKVV
Sbjct: 121 VREVSDEGKVV 131


>gi|315122813|ref|YP_004063302.1| 50S ribosomal protein L22 [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313496215|gb|ADR52814.1| 50S ribosomal protein L22 [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 132

 Score =  219 bits (557), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 122/132 (92%), Gaps = 1/132 (0%)

Query: 1   MSGKRSVSKRR-MGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAG 59
           M+ KR+V +RR +GDNEANAIASMLR+SPQKLNLVAAMIRGK+VSDALADLEFSRKRIA 
Sbjct: 1   MNEKRAVPRRRRVGDNEANAIASMLRISPQKLNLVAAMIRGKKVSDALADLEFSRKRIAV 60

Query: 60  EVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTV 119
           EV+KTL SA+ANAENNHDLD+DRL+VSEAYVGKSV MKRFHCR RQRIGRI +PFSRL+V
Sbjct: 61  EVKKTLRSAIANAENNHDLDIDRLVVSEAYVGKSVVMKRFHCRARQRIGRINKPFSRLSV 120

Query: 120 IVREVSDEGKVV 131
           IVREV DE KVV
Sbjct: 121 IVREVQDERKVV 132


>gi|325293331|ref|YP_004279195.1| 50S ribosomal protein L22 [Agrobacterium sp. H13-3]
 gi|325061184|gb|ADY64875.1| 50S ribosomal protein L22 [Agrobacterium sp. H13-3]
          Length = 129

 Score =  184 bits (467), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 105/122 (86%)

Query: 8   SKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCS 67
           ++RR+ DNEA AIA  LRVSPQKLNLVAA+IRGK+V  ALA+LEFSRKRIAG V+KTL S
Sbjct: 6   TERRLKDNEAQAIARTLRVSPQKLNLVAALIRGKKVDRALAELEFSRKRIAGTVKKTLES 65

Query: 68  AVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           A+ANAENNHDLDVD L+V+EAYVGKS+ MKRFH RGR R  RI +PFS LT++VREV ++
Sbjct: 66  AIANAENNHDLDVDALVVAEAYVGKSITMKRFHARGRGRASRIEKPFSHLTIVVREVEEK 125

Query: 128 GK 129
           G+
Sbjct: 126 GE 127


>gi|15889237|ref|NP_354918.1| 50S ribosomal protein L22 [Agrobacterium tumefaciens str. C58]
 gi|51316494|sp|Q8UE23|RL22_AGRT5 RecName: Full=50S ribosomal protein L22
 gi|15157064|gb|AAK87703.1| 50S ribosomal protein L22 [Agrobacterium tumefaciens str. C58]
          Length = 129

 Score =  183 bits (464), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 87/125 (69%), Positives = 107/125 (85%)

Query: 5   RSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKT 64
           ++ ++RR+ DNEA AIA  LRVSPQKLNLVAA+IRGK+V  ALA+LEFSRKRIAG V+KT
Sbjct: 3   KAKTERRLKDNEAQAIARTLRVSPQKLNLVAALIRGKKVDRALAELEFSRKRIAGTVKKT 62

Query: 65  LCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV 124
           L SA+ANAENNHDLDVD L+V+EAYVGKS+ MKRFH RGR R  RI +PF+ LT++VREV
Sbjct: 63  LESAIANAENNHDLDVDALVVAEAYVGKSITMKRFHARGRGRASRIEKPFAHLTIVVREV 122

Query: 125 SDEGK 129
            ++G+
Sbjct: 123 EEKGE 127


>gi|23502105|ref|NP_698232.1| 50S ribosomal protein L22 [Brucella suis 1330]
 gi|161619184|ref|YP_001593071.1| 50S ribosomal protein L22 [Brucella canis ATCC 23365]
 gi|225627698|ref|ZP_03785735.1| ribosomal protein L22 [Brucella ceti str. Cudo]
 gi|254701969|ref|ZP_05163797.1| 50S ribosomal protein L22 [Brucella suis bv. 5 str. 513]
 gi|254706591|ref|ZP_05168419.1| 50S ribosomal protein L22 [Brucella pinnipedialis M163/99/10]
 gi|254710299|ref|ZP_05172110.1| 50S ribosomal protein L22 [Brucella pinnipedialis B2/94]
 gi|254714296|ref|ZP_05176107.1| 50S ribosomal protein L22 [Brucella ceti M644/93/1]
 gi|254717733|ref|ZP_05179544.1| 50S ribosomal protein L22 [Brucella ceti M13/05/1]
 gi|254719286|ref|ZP_05181097.1| 50S ribosomal protein L22 [Brucella sp. 83/13]
 gi|256031793|ref|ZP_05445407.1| 50S ribosomal protein L22 [Brucella pinnipedialis M292/94/1]
 gi|256159963|ref|ZP_05457681.1| 50S ribosomal protein L22 [Brucella ceti M490/95/1]
 gi|256255194|ref|ZP_05460730.1| 50S ribosomal protein L22 [Brucella ceti B1/94]
 gi|256369652|ref|YP_003107162.1| 50S ribosomal protein L22 [Brucella microti CCM 4915]
 gi|260168927|ref|ZP_05755738.1| 50S ribosomal protein L22 [Brucella sp. F5/99]
 gi|260566243|ref|ZP_05836713.1| L22 ribosomal protein [Brucella suis bv. 4 str. 40]
 gi|261219576|ref|ZP_05933857.1| L22 ribosomal protein [Brucella ceti M13/05/1]
 gi|261222390|ref|ZP_05936671.1| L22 ribosomal protein [Brucella ceti B1/94]
 gi|261314050|ref|ZP_05953247.1| L22 ribosomal protein [Brucella pinnipedialis M163/99/10]
 gi|261317862|ref|ZP_05957059.1| L22 ribosomal protein [Brucella pinnipedialis B2/94]
 gi|261322071|ref|ZP_05961268.1| L22 ribosomal protein [Brucella ceti M644/93/1]
 gi|261752537|ref|ZP_05996246.1| L22 ribosomal protein [Brucella suis bv. 5 str. 513]
 gi|261758420|ref|ZP_06002129.1| L22 ribosomal protein [Brucella sp. F5/99]
 gi|265984286|ref|ZP_06097021.1| L22 ribosomal protein [Brucella sp. 83/13]
 gi|265988891|ref|ZP_06101448.1| L22 ribosomal protein [Brucella pinnipedialis M292/94/1]
 gi|265998355|ref|ZP_06110912.1| L22 ribosomal protein [Brucella ceti M490/95/1]
 gi|306838038|ref|ZP_07470896.1| ribosomal protein L22 [Brucella sp. NF 2653]
 gi|306840306|ref|ZP_07473078.1| ribosomal protein L22 [Brucella sp. BO2]
 gi|306844132|ref|ZP_07476726.1| ribosomal protein L22 [Brucella sp. BO1]
 gi|51316474|sp|Q8G080|RL22_BRUSU RecName: Full=50S ribosomal protein L22
 gi|23348065|gb|AAN30147.1| ribosomal protein L22 [Brucella suis 1330]
 gi|82470711|gb|ABB77391.1| L22 ribosomal protein [Brucella canis]
 gi|82470717|gb|ABB77394.1| L22 ribosomal protein [Brucella suis 1330]
 gi|82470719|gb|ABB77395.1| L22 ribosomal protein [Brucella suis bv. 4 str. 40]
 gi|82470725|gb|ABB77398.1| L22 ribosomal protein [Brucella suis]
 gi|82470727|gb|ABB77399.1| L22 ribosomal protein [Brucella pinnipedialis]
 gi|82470729|gb|ABB77400.1| L22 ribosomal protein [Brucella ceti]
 gi|82470731|gb|ABB77401.1| L22 ribosomal protein [Brucella ceti]
 gi|161335995|gb|ABX62300.1| ribosomal protein L22 [Brucella canis ATCC 23365]
 gi|225617703|gb|EEH14748.1| ribosomal protein L22 [Brucella ceti str. Cudo]
 gi|255999814|gb|ACU48213.1| 50S ribosomal protein L22 [Brucella microti CCM 4915]
 gi|260155761|gb|EEW90841.1| L22 ribosomal protein [Brucella suis bv. 4 str. 40]
 gi|260920974|gb|EEX87627.1| L22 ribosomal protein [Brucella ceti B1/94]
 gi|260924665|gb|EEX91233.1| L22 ribosomal protein [Brucella ceti M13/05/1]
 gi|261294761|gb|EEX98257.1| L22 ribosomal protein [Brucella ceti M644/93/1]
 gi|261297085|gb|EEY00582.1| L22 ribosomal protein [Brucella pinnipedialis B2/94]
 gi|261303076|gb|EEY06573.1| L22 ribosomal protein [Brucella pinnipedialis M163/99/10]
 gi|261738404|gb|EEY26400.1| L22 ribosomal protein [Brucella sp. F5/99]
 gi|261742290|gb|EEY30216.1| L22 ribosomal protein [Brucella suis bv. 5 str. 513]
 gi|262552823|gb|EEZ08813.1| L22 ribosomal protein [Brucella ceti M490/95/1]
 gi|264661088|gb|EEZ31349.1| L22 ribosomal protein [Brucella pinnipedialis M292/94/1]
 gi|264662878|gb|EEZ33139.1| L22 ribosomal protein [Brucella sp. 83/13]
 gi|306275575|gb|EFM57307.1| ribosomal protein L22 [Brucella sp. BO1]
 gi|306289705|gb|EFM60894.1| ribosomal protein L22 [Brucella sp. BO2]
 gi|306406962|gb|EFM63183.1| ribosomal protein L22 [Brucella sp. NF 2653]
          Length = 129

 Score =  182 bits (461), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 105/122 (86%)

Query: 8   SKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCS 67
           + R++ DNEA A+A  LRVSPQKLNLVA+MIRGK+V+ ALADL FSRKRIAG V+KTL S
Sbjct: 6   APRQLKDNEAKAVARTLRVSPQKLNLVASMIRGKKVNAALADLTFSRKRIAGTVKKTLES 65

Query: 68  AVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           A+ANAENNHDLDVD LIV+EAYVGKS+ MKRFH RGR R  RI +PFS LT++VREV+++
Sbjct: 66  AIANAENNHDLDVDALIVAEAYVGKSIVMKRFHVRGRGRASRIEKPFSHLTIVVREVAEK 125

Query: 128 GK 129
           G+
Sbjct: 126 GE 127


>gi|227821761|ref|YP_002825731.1| 50S ribosomal protein L22 [Sinorhizobium fredii NGR234]
 gi|227340760|gb|ACP24978.1| 50S ribosomal protein L22 [Sinorhizobium fredii NGR234]
          Length = 129

 Score =  181 bits (459), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 104/122 (85%)

Query: 8   SKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCS 67
           ++RR+ DNEA AIA  +RVSPQKLNLVAA+IRGK+V  ALA+LEFSRKRIAG V+KTL S
Sbjct: 6   AERRLKDNEAQAIARTIRVSPQKLNLVAALIRGKKVDRALAELEFSRKRIAGTVKKTLES 65

Query: 68  AVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           A+ANAENNHDLDVD LIV+EAYVGKS+ MKRFH RGR R  R+ +PFS LT++VREV  +
Sbjct: 66  AIANAENNHDLDVDSLIVAEAYVGKSIVMKRFHARGRGRASRVEKPFSHLTIVVREVEAK 125

Query: 128 GK 129
           G+
Sbjct: 126 GE 127


>gi|17987045|ref|NP_539679.1| 50S ribosomal protein L22 [Brucella melitensis bv. 1 str. 16M]
 gi|62290139|ref|YP_221932.1| 50S ribosomal protein L22 [Brucella abortus bv. 1 str. 9-941]
 gi|82700062|ref|YP_414636.1| 50S ribosomal protein L22 [Brucella melitensis biovar Abortus 2308]
 gi|189024377|ref|YP_001935145.1| 50S ribosomal protein L22 [Brucella abortus S19]
 gi|225852725|ref|YP_002732958.1| 50S ribosomal protein L22 [Brucella melitensis ATCC 23457]
 gi|237815647|ref|ZP_04594644.1| ribosomal protein L22 [Brucella abortus str. 2308 A]
 gi|254689448|ref|ZP_05152702.1| 50S ribosomal protein L22 [Brucella abortus bv. 6 str. 870]
 gi|254693933|ref|ZP_05155761.1| 50S ribosomal protein L22 [Brucella abortus bv. 3 str. Tulya]
 gi|254697583|ref|ZP_05159411.1| 50S ribosomal protein L22 [Brucella abortus bv. 2 str. 86/8/59]
 gi|254730477|ref|ZP_05189055.1| 50S ribosomal protein L22 [Brucella abortus bv. 4 str. 292]
 gi|256044878|ref|ZP_05447782.1| 50S ribosomal protein L22 [Brucella melitensis bv. 1 str. Rev.1]
 gi|256113782|ref|ZP_05454586.1| 50S ribosomal protein L22 [Brucella melitensis bv. 3 str. Ether]
 gi|256257694|ref|ZP_05463230.1| 50S ribosomal protein L22 [Brucella abortus bv. 9 str. C68]
 gi|256263785|ref|ZP_05466317.1| L22 ribosomal protein [Brucella melitensis bv. 2 str. 63/9]
 gi|260546687|ref|ZP_05822426.1| L22 ribosomal protein [Brucella abortus NCTC 8038]
 gi|260565520|ref|ZP_05836004.1| L22 ribosomal protein [Brucella melitensis bv. 1 str. 16M]
 gi|260754971|ref|ZP_05867319.1| L22 ribosomal protein [Brucella abortus bv. 6 str. 870]
 gi|260758187|ref|ZP_05870535.1| L22 ribosomal protein [Brucella abortus bv. 4 str. 292]
 gi|260762013|ref|ZP_05874356.1| L22 ribosomal protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883980|ref|ZP_05895594.1| L22 ribosomal protein [Brucella abortus bv. 9 str. C68]
 gi|261214225|ref|ZP_05928506.1| L22 ribosomal protein [Brucella abortus bv. 3 str. Tulya]
 gi|265991305|ref|ZP_06103862.1| L22 ribosomal protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|265995142|ref|ZP_06107699.1| L22 ribosomal protein [Brucella melitensis bv. 3 str. Ether]
 gi|297248534|ref|ZP_06932252.1| large subunit ribosomal protein L22 [Brucella abortus bv. 5 str.
           B3196]
 gi|51316502|sp|Q8YHN5|RL22_BRUME RecName: Full=50S ribosomal protein L22
 gi|75496684|sp|Q57CR3|RL22_BRUAB RecName: Full=50S ribosomal protein L22
 gi|109893184|sp|Q2YRA0|RL22_BRUA2 RecName: Full=50S ribosomal protein L22
 gi|17982701|gb|AAL51943.1| lsu ribosomal protein l22p [Brucella melitensis bv. 1 str. 16M]
 gi|62196271|gb|AAX74571.1| RplV, ribosomal protein L22 [Brucella abortus bv. 1 str. 9-941]
 gi|82470691|gb|ABB77381.1| L22 ribosomal protein [Brucella abortus]
 gi|82470693|gb|ABB77382.1| L22 ribosomal protein [Brucella abortus]
 gi|82470695|gb|ABB77383.1| L22 ribosomal protein [Brucella abortus]
 gi|82470697|gb|ABB77384.1| L22 ribosomal protein [Brucella abortus]
 gi|82470699|gb|ABB77385.1| L22 ribosomal protein [Brucella abortus]
 gi|82470701|gb|ABB77386.1| L22 ribosomal protein [Brucella abortus]
 gi|82470703|gb|ABB77387.1| L22 ribosomal protein [Brucella abortus]
 gi|82470705|gb|ABB77388.1| L22 ribosomal protein [Brucella melitensis]
 gi|82470707|gb|ABB77389.1| L22 ribosomal protein [Brucella melitensis]
 gi|82470709|gb|ABB77390.1| L22 ribosomal protein [Brucella melitensis]
 gi|82616163|emb|CAJ11206.1| Ribosomal protein L22/L17:ATP/GTP-binding site motif A
           (P-loop):Ribosomal protein S2:Ribosomal protein L22,
           bacterial and org [Brucella melitensis biovar Abortus
           2308]
 gi|189019949|gb|ACD72671.1| 50S ribosomal protein L22 [Brucella abortus S19]
 gi|225641090|gb|ACO01004.1| ribosomal protein L22 [Brucella melitensis ATCC 23457]
 gi|237788945|gb|EEP63156.1| ribosomal protein L22 [Brucella abortus str. 2308 A]
 gi|260095737|gb|EEW79614.1| L22 ribosomal protein [Brucella abortus NCTC 8038]
 gi|260151588|gb|EEW86682.1| L22 ribosomal protein [Brucella melitensis bv. 1 str. 16M]
 gi|260668505|gb|EEX55445.1| L22 ribosomal protein [Brucella abortus bv. 4 str. 292]
 gi|260672445|gb|EEX59266.1| L22 ribosomal protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675079|gb|EEX61900.1| L22 ribosomal protein [Brucella abortus bv. 6 str. 870]
 gi|260873508|gb|EEX80577.1| L22 ribosomal protein [Brucella abortus bv. 9 str. C68]
 gi|260915832|gb|EEX82693.1| L22 ribosomal protein [Brucella abortus bv. 3 str. Tulya]
 gi|262766255|gb|EEZ12044.1| L22 ribosomal protein [Brucella melitensis bv. 3 str. Ether]
 gi|263002089|gb|EEZ14664.1| L22 ribosomal protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|263093913|gb|EEZ17847.1| L22 ribosomal protein [Brucella melitensis bv. 2 str. 63/9]
 gi|297175703|gb|EFH35050.1| large subunit ribosomal protein L22 [Brucella abortus bv. 5 str.
           B3196]
 gi|326409250|gb|ADZ66315.1| 50S ribosomal protein L22 [Brucella melitensis M28]
 gi|326538958|gb|ADZ87173.1| ribosomal protein L22 [Brucella melitensis M5-90]
          Length = 129

 Score =  180 bits (457), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 104/122 (85%)

Query: 8   SKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCS 67
           + R++ DNEA A+A  LRVSPQKLNLVA+MIRGK+V+ ALADL FSRKRIAG V+KTL S
Sbjct: 6   APRQLKDNEAKAVARTLRVSPQKLNLVASMIRGKKVNAALADLTFSRKRIAGTVKKTLES 65

Query: 68  AVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           A+ANAENNHDLDVD LIV+EAYVGKS+ MKRFH R R R  RI +PFS LT++VREV+++
Sbjct: 66  AIANAENNHDLDVDALIVAEAYVGKSIVMKRFHVRDRGRASRIEKPFSHLTIVVREVAEK 125

Query: 128 GK 129
           GK
Sbjct: 126 GK 127


>gi|153009291|ref|YP_001370506.1| 50S ribosomal protein L22 [Ochrobactrum anthropi ATCC 49188]
 gi|151561179|gb|ABS14677.1| ribosomal protein L22 [Ochrobactrum anthropi ATCC 49188]
          Length = 129

 Score =  180 bits (456), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 104/122 (85%)

Query: 8   SKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCS 67
           + R++ DNEA A+A  LRVSPQKLNLVA+MIRGK+V+ ALADL FSRKRIA  V+KTL S
Sbjct: 6   APRQLKDNEAQAVARTLRVSPQKLNLVASMIRGKKVNAALADLTFSRKRIADTVKKTLQS 65

Query: 68  AVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           A+ANAENNHDLDVD LIV+EAYVGKS+ MKRFH RGR R  RI +PFS LT++VREV+++
Sbjct: 66  AIANAENNHDLDVDSLIVAEAYVGKSIVMKRFHVRGRGRASRIEKPFSHLTIVVREVAEK 125

Query: 128 GK 129
           G+
Sbjct: 126 GE 127


>gi|239832117|ref|ZP_04680446.1| ribosomal protein L22 [Ochrobactrum intermedium LMG 3301]
 gi|239824384|gb|EEQ95952.1| ribosomal protein L22 [Ochrobactrum intermedium LMG 3301]
          Length = 129

 Score =  179 bits (455), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 104/122 (85%)

Query: 8   SKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCS 67
           + R++ DNEA A+A  LRVSPQKLNLVA+MIRGK+V+ ALADL FSRKRIA  V+KTL S
Sbjct: 6   APRQLKDNEAQAVARTLRVSPQKLNLVASMIRGKKVNAALADLTFSRKRIADTVKKTLQS 65

Query: 68  AVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           A+ANAENNHDLDVD LIV+EAYVGKS+ MKRFH RGR R  RI +PFS LT++VREV+++
Sbjct: 66  AIANAENNHDLDVDALIVAEAYVGKSIVMKRFHVRGRGRASRIEKPFSHLTIVVREVAEK 125

Query: 128 GK 129
           G+
Sbjct: 126 GE 127


>gi|222148371|ref|YP_002549328.1| 50S ribosomal protein L22 [Agrobacterium vitis S4]
 gi|221735359|gb|ACM36322.1| 50S ribosomal protein L22 [Agrobacterium vitis S4]
          Length = 129

 Score =  179 bits (455), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 103/122 (84%)

Query: 8   SKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCS 67
           ++RR+ DNEA A+A  LRVSPQKLNLVAA+IRGK+V  ALADL FSRKRIA  V+KTL S
Sbjct: 6   AERRLKDNEAQAVARTLRVSPQKLNLVAALIRGKKVDRALADLTFSRKRIADTVKKTLES 65

Query: 68  AVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           A+ANAENNHDLDVD+LIV+EAYVGKS+ MKRFH RGR R  RI +PFS LT++VREV  +
Sbjct: 66  AIANAENNHDLDVDQLIVAEAYVGKSITMKRFHARGRGRASRIEKPFSHLTIVVREVEAK 125

Query: 128 GK 129
           G+
Sbjct: 126 GE 127


>gi|163868645|ref|YP_001609854.1| 50S ribosomal protein L22 [Bartonella tribocorum CIP 105476]
 gi|161018301|emb|CAK01859.1| 50S ribosomal protein L22 [Bartonella tribocorum CIP 105476]
          Length = 129

 Score =  179 bits (453), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 87/118 (73%), Positives = 100/118 (84%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           R++ DNEA A+   +RVSPQKLNLVAAMIRGKRV+ ALADL FSRKRIA  V+KTL SA+
Sbjct: 8   RQLKDNEAKAVTRTIRVSPQKLNLVAAMIRGKRVNVALADLTFSRKRIAATVKKTLESAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           ANAENNHDLD+D LIV+EAYVGKS+ MKRFH RGR R  RI RPFS LT+IVREVS++
Sbjct: 68  ANAENNHDLDIDSLIVAEAYVGKSIVMKRFHVRGRGRASRIERPFSHLTIIVREVSEK 125


>gi|319408760|emb|CBI82417.1| 50S ribosomal protein L22 [Bartonella schoenbuchensis R1]
          Length = 129

 Score =  179 bits (453), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 87/118 (73%), Positives = 101/118 (85%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           R++ DNEA A+A  +RVSPQKLNLVAAMIRGK+V+ ALADL FSRKRIA  VRKTL SA+
Sbjct: 8   RQLKDNEAKAVARTIRVSPQKLNLVAAMIRGKKVNTALADLTFSRKRIAQTVRKTLESAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           ANAENNHDLD+D LIVSEA+VGKS+ MKRFH RGR R  RI RPFS LT+IVREV+++
Sbjct: 68  ANAENNHDLDIDSLIVSEAHVGKSIVMKRFHVRGRGRSSRIERPFSHLTIIVREVTEK 125


>gi|150396212|ref|YP_001326679.1| 50S ribosomal protein L22 [Sinorhizobium medicae WSM419]
 gi|166221999|sp|A6U864|RL22_SINMW RecName: Full=50S ribosomal protein L22
 gi|150027727|gb|ABR59844.1| ribosomal protein L22 [Sinorhizobium medicae WSM419]
          Length = 129

 Score =  179 bits (453), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 85/122 (69%), Positives = 104/122 (85%)

Query: 8   SKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCS 67
           ++RR+ DNEA A+A  +RVSPQKLNLVAA+IRGK+V  ALA+LEFSRKRIAG VRKTL S
Sbjct: 6   AERRLKDNEAQAVARTIRVSPQKLNLVAALIRGKKVDRALAELEFSRKRIAGTVRKTLES 65

Query: 68  AVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           A+ANAENNHDLDVD LIV+EA+VGKS+ MKRFH RGR R  R+ +PF+ LT++VREV  +
Sbjct: 66  AIANAENNHDLDVDSLIVAEAFVGKSIVMKRFHARGRGRASRVEKPFAHLTIVVREVEAK 125

Query: 128 GK 129
           G+
Sbjct: 126 GE 127


>gi|49475789|ref|YP_033830.1| 50S ribosomal protein L22 [Bartonella henselae str. Houston-1]
 gi|81696138|sp|Q6G2X0|RL22_BARHE RecName: Full=50S ribosomal protein L22
 gi|49238596|emb|CAF27837.1| 50S ribosomal protein l22 [Bartonella henselae str. Houston-1]
          Length = 129

 Score =  178 bits (452), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 88/121 (72%), Positives = 102/121 (84%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           R++ DNEA A+A  +RVSPQKLNLVAAMIRGK+V  ALADL FSRKRIAG V+KTL SAV
Sbjct: 8   RQLKDNEAKAVARTIRVSPQKLNLVAAMIRGKKVGAALADLTFSRKRIAGTVKKTLESAV 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEGK 129
           ANAENNHDLD+D L+V+EAYVGKS+ MKRFH RGR R  RI RPFS LT+IVREV ++ +
Sbjct: 68  ANAENNHDLDIDSLVVAEAYVGKSIVMKRFHVRGRGRASRIERPFSHLTIIVREVIEKVE 127

Query: 130 V 130
           V
Sbjct: 128 V 128


>gi|222085680|ref|YP_002544210.1| ribosomal protein L22 [Agrobacterium radiobacter K84]
 gi|221723128|gb|ACM26284.1| ribosomal protein L22 [Agrobacterium radiobacter K84]
          Length = 132

 Score =  178 bits (452), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 86/117 (73%), Positives = 100/117 (85%)

Query: 8   SKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCS 67
           ++RR+ DNEA A+A  LRVSPQKLNLVAA IRGK+V  ALA+LEFSRKRIAG V+KTL S
Sbjct: 6   AERRLKDNEAQAVARTLRVSPQKLNLVAASIRGKKVDRALAELEFSRKRIAGAVKKTLES 65

Query: 68  AVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV 124
           A+ANAENNHDLDVD L+V+EAYVGKS+ MKRFH RGR R  RI RPF+ LT++VREV
Sbjct: 66  AIANAENNHDLDVDSLVVAEAYVGKSIVMKRFHARGRGRASRIERPFAHLTIVVREV 122


>gi|148560541|ref|YP_001259148.1| 50S ribosomal protein L22 [Brucella ovis ATCC 25840]
 gi|294852565|ref|ZP_06793238.1| 50S ribosomal protein L22 [Brucella sp. NVSL 07-0026]
 gi|82470715|gb|ABB77393.1| L22 ribosomal protein [Brucella ovis]
 gi|148371798|gb|ABQ61777.1| ribosomal protein L22 [Brucella ovis ATCC 25840]
 gi|294821154|gb|EFG38153.1| 50S ribosomal protein L22 [Brucella sp. NVSL 07-0026]
          Length = 129

 Score =  178 bits (451), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 104/122 (85%)

Query: 8   SKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCS 67
           + R++ DNEA A+A  LRVSPQKLNLVA+MIRGK+V+ ALADL FSRKRIAG V+KTL S
Sbjct: 6   APRQLKDNEAKAVARTLRVSPQKLNLVASMIRGKKVNAALADLTFSRKRIAGTVKKTLES 65

Query: 68  AVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           A+ANAENNHDLDVD LIV+EAYVGKS+ MKRFH R R R  RI +PFS LT++VREV+++
Sbjct: 66  AIANAENNHDLDVDALIVAEAYVGKSIVMKRFHVRVRGRASRIEKPFSHLTIVVREVAEK 125

Query: 128 GK 129
           G+
Sbjct: 126 GE 127


>gi|116251545|ref|YP_767383.1| 50S ribosomal protein L22 [Rhizobium leguminosarum bv. viciae 3841]
 gi|241204170|ref|YP_002975266.1| 50S ribosomal protein L22 [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|115256193|emb|CAK07274.1| putative 50S ribosomal protein L22 [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|240858060|gb|ACS55727.1| ribosomal protein L22 [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 129

 Score =  178 bits (451), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 100/118 (84%)

Query: 8   SKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCS 67
           ++RR+ DNEA A+A  LRVSPQKLNLVAA IRGK+V  ALA+LEFSRKRIAG V+KTL S
Sbjct: 6   AERRLKDNEAQAVARTLRVSPQKLNLVAAAIRGKKVERALAELEFSRKRIAGAVKKTLES 65

Query: 68  AVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVS 125
           A+ANAENNHDLDVD L+V+EAYVGKS+ MKRFH RGR R  RI +PF+ LT++VREV 
Sbjct: 66  AIANAENNHDLDVDSLVVAEAYVGKSIVMKRFHARGRGRASRIEKPFAHLTIVVREVQ 123


>gi|209548940|ref|YP_002280857.1| 50S ribosomal protein L22 [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209534696|gb|ACI54631.1| ribosomal protein L22 [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 129

 Score =  178 bits (451), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 100/118 (84%)

Query: 8   SKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCS 67
           ++RR+ DNEA A+A  LRVSPQKLNLVAA IRGK+V  ALA+LEFSRKRIAG V+KTL S
Sbjct: 6   AERRLKDNEAQAVARTLRVSPQKLNLVAAAIRGKKVERALAELEFSRKRIAGAVKKTLES 65

Query: 68  AVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVS 125
           A+ANAENNHDLDVD L+V+EAYVGKS+ MKRFH RGR R  RI +PF+ LT++VREV 
Sbjct: 66  AIANAENNHDLDVDALVVAEAYVGKSIVMKRFHARGRGRASRIEKPFAHLTIVVREVQ 123


>gi|86357310|ref|YP_469202.1| 50S ribosomal protein L22 [Rhizobium etli CFN 42]
 gi|190891360|ref|YP_001977902.1| 50S ribosomal protein L22 [Rhizobium etli CIAT 652]
 gi|218512755|ref|ZP_03509595.1| 50S ribosomal protein L22 [Rhizobium etli 8C-3]
 gi|109893227|sp|Q2K9L1|RL22_RHIEC RecName: Full=50S ribosomal protein L22
 gi|86281412|gb|ABC90475.1| 50S ribosomal protein L22 [Rhizobium etli CFN 42]
 gi|190696639|gb|ACE90724.1| 50S ribosomal protein L22 [Rhizobium etli CIAT 652]
 gi|327191390|gb|EGE58416.1| 50S ribosomal protein L22 [Rhizobium etli CNPAF512]
          Length = 129

 Score =  178 bits (451), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 100/118 (84%)

Query: 8   SKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCS 67
           ++RR+ DNEA A+A  LRVSPQKLNLVAA IRGK+V  ALA+LEFSRKRIAG V+KTL S
Sbjct: 6   AERRLKDNEAQAVARTLRVSPQKLNLVAAAIRGKKVERALAELEFSRKRIAGAVKKTLES 65

Query: 68  AVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVS 125
           A+ANAENNHDLDVD L+V+EAYVGKS+ MKRFH RGR R  RI +PF+ LT++VREV 
Sbjct: 66  AIANAENNHDLDVDALVVAEAYVGKSIVMKRFHARGRGRASRIEKPFAHLTIVVREVQ 123


>gi|218672111|ref|ZP_03521780.1| 50S ribosomal protein L22 [Rhizobium etli GR56]
          Length = 129

 Score =  177 bits (450), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 85/117 (72%), Positives = 100/117 (85%)

Query: 8   SKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCS 67
           ++RR+ DNEA A+A  LRVSPQKLNLVAA IRGK+V  ALA+LEFSRKRIAG V+KTL S
Sbjct: 6   AERRLKDNEAQAVARTLRVSPQKLNLVAAAIRGKKVERALAELEFSRKRIAGAVKKTLES 65

Query: 68  AVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV 124
           A+ANAENNHDLDVD L+V+EAYVGKS+ MKRFH RGR R  RI +PF+ LT++VREV
Sbjct: 66  AIANAENNHDLDVDALVVAEAYVGKSIVMKRFHARGRGRASRIEKPFAHLTIVVREV 122


>gi|15965114|ref|NP_385467.1| 50S ribosomal protein L22 [Sinorhizobium meliloti 1021]
 gi|307314364|ref|ZP_07593970.1| ribosomal protein L22 [Sinorhizobium meliloti BL225C]
 gi|307322076|ref|ZP_07601452.1| ribosomal protein L22 [Sinorhizobium meliloti AK83]
 gi|51316894|sp|Q92QG5|RL22_RHIME RecName: Full=50S ribosomal protein L22
 gi|15074294|emb|CAC45940.1| Probable 50S ribosomal protein L22 [Sinorhizobium meliloti 1021]
 gi|306892258|gb|EFN23068.1| ribosomal protein L22 [Sinorhizobium meliloti AK83]
 gi|306899062|gb|EFN29704.1| ribosomal protein L22 [Sinorhizobium meliloti BL225C]
          Length = 129

 Score =  177 bits (450), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 84/122 (68%), Positives = 104/122 (85%)

Query: 8   SKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCS 67
           ++RR+ DNEA A+A  +RVSPQKLNLVAA+IRGK+V  ALA+LEFSRKRIAG V+KTL S
Sbjct: 6   AERRLKDNEAQAVARTIRVSPQKLNLVAALIRGKKVDRALAELEFSRKRIAGTVKKTLES 65

Query: 68  AVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           A+ANAENNHDLDVD LIV+EA+VGKS+ MKRFH RGR R  R+ +PF+ LT++VREV  +
Sbjct: 66  AIANAENNHDLDVDSLIVAEAFVGKSIVMKRFHARGRGRASRVEKPFAHLTIVVREVEAK 125

Query: 128 GK 129
           G+
Sbjct: 126 GE 127


>gi|260468549|ref|ZP_05813716.1| ribosomal protein L22 [Mesorhizobium opportunistum WSM2075]
 gi|319783325|ref|YP_004142801.1| ribosomal protein L22 [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|259028705|gb|EEW30014.1| ribosomal protein L22 [Mesorhizobium opportunistum WSM2075]
 gi|317169213|gb|ADV12751.1| ribosomal protein L22 [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 129

 Score =  177 bits (449), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 103/122 (84%)

Query: 8   SKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCS 67
           + RR+ DNEA A+   +R+SPQKLNLVAA+IRGK+V+ AL+DLEFS KRI+G V+KTL S
Sbjct: 6   APRRLADNEARAVLRTIRISPQKLNLVAALIRGKKVATALSDLEFSAKRISGTVKKTLES 65

Query: 68  AVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           A+ANAENNHDLDVD LIV+EAYVGKS+ MKRFH RGR R  RI +PFS LT++VREV ++
Sbjct: 66  AIANAENNHDLDVDALIVAEAYVGKSIVMKRFHARGRGRASRIEKPFSHLTIVVREVEEK 125

Query: 128 GK 129
           G+
Sbjct: 126 GE 127


>gi|121601656|ref|YP_988972.1| 50S ribosomal protein L22 [Bartonella bacilliformis KC583]
 gi|121602710|ref|YP_989002.1| 50S ribosomal protein L22 [Bartonella bacilliformis KC583]
 gi|120613833|gb|ABM44434.1| ribosomal protein L22 [Bartonella bacilliformis KC583]
 gi|120614887|gb|ABM45488.1| ribosomal protein L22 [Bartonella bacilliformis KC583]
          Length = 129

 Score =  177 bits (449), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 101/120 (84%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           R++ DNEA A+  M+RVSPQKLNLVAAMIRGK+V  ALADL FSRKRIA  V+KTL SA+
Sbjct: 8   RQLKDNEAKAVTRMIRVSPQKLNLVAAMIRGKKVDVALADLMFSRKRIAQTVKKTLESAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEGK 129
           ANAENNHDLD+D LIVSEA+VGKS+ MKRFH RGR R  RI RPFS LTVIVREV ++G+
Sbjct: 68  ANAENNHDLDIDSLIVSEAHVGKSIVMKRFHVRGRGRASRIERPFSHLTVIVREVIEKGE 127


>gi|49474399|ref|YP_032441.1| 50S ribosomal protein L22 [Bartonella quintana str. Toulouse]
 gi|81696013|sp|Q6FZC7|RL22_BARQU RecName: Full=50S ribosomal protein L22
 gi|49239903|emb|CAF26301.1| 50s ribosomal protein l22 [Bartonella quintana str. Toulouse]
          Length = 129

 Score =  177 bits (449), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 87/118 (73%), Positives = 100/118 (84%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           R++ DNEA A+A  +RVSPQKLNLV AMIRGKRV  ALADL FSRKRIAG V+KTL SA+
Sbjct: 8   RQLKDNEAKAVARTIRVSPQKLNLVVAMIRGKRVGVALADLAFSRKRIAGTVKKTLESAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           ANAENNHDLD+D LIV+EAYVGKSV +KRFH RGR R  RI RPFS LT+IVREV+++
Sbjct: 68  ANAENNHDLDIDSLIVAEAYVGKSVVVKRFHVRGRGRASRIERPFSHLTIIVREVTEK 125


>gi|13470556|ref|NP_102125.1| 50S ribosomal protein L22 [Mesorhizobium loti MAFF303099]
 gi|51316905|sp|Q98N52|RL22_RHILO RecName: Full=50S ribosomal protein L22
 gi|14021298|dbj|BAB47911.1| 50S ribosomal protein L22 [Mesorhizobium loti MAFF303099]
          Length = 129

 Score =  177 bits (448), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 103/122 (84%)

Query: 8   SKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCS 67
           + RR+ DNEA A+   +R+SPQKLNLVAA+IRGK+V+ AL+DLEFS KRI+G V+KTL S
Sbjct: 6   APRRLADNEARAVLRTIRISPQKLNLVAALIRGKKVATALSDLEFSAKRISGTVKKTLES 65

Query: 68  AVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           A+ANAENNHDLDVD L+V+EAYVGKS+ MKRFH RGR R  RI +PFS LT++VREV ++
Sbjct: 66  AIANAENNHDLDVDALVVAEAYVGKSIVMKRFHARGRGRASRIEKPFSHLTIVVREVEEK 125

Query: 128 GK 129
           G+
Sbjct: 126 GE 127


>gi|163760804|ref|ZP_02167883.1| 50S ribosomal protein L22 [Hoeflea phototrophica DFL-43]
 gi|162281848|gb|EDQ32140.1| 50S ribosomal protein L22 [Hoeflea phototrophica DFL-43]
          Length = 129

 Score =  176 bits (447), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 84/117 (71%), Positives = 99/117 (84%)

Query: 8   SKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCS 67
           ++RR+ DNEA A+A  LRVSPQKLNLVA +IRGK+V  ALA+LEFSRKRIA  V+KTL S
Sbjct: 6   TERRLKDNEAQAVARTLRVSPQKLNLVAGLIRGKKVGKALAELEFSRKRIASTVKKTLES 65

Query: 68  AVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV 124
           A+ANAENNHDLDVD L+V+EAYVGKS+ MKRFH RGR R  RI +PFS LT++VREV
Sbjct: 66  AIANAENNHDLDVDSLVVAEAYVGKSIVMKRFHARGRGRSSRIEKPFSHLTIVVREV 122


>gi|163843494|ref|YP_001627898.1| 50S ribosomal protein L22 [Brucella suis ATCC 23445]
 gi|254704513|ref|ZP_05166341.1| 50S ribosomal protein L22 [Brucella suis bv. 3 str. 686]
 gi|261755196|ref|ZP_05998905.1| L22 ribosomal protein [Brucella suis bv. 3 str. 686]
 gi|215274809|sp|B0CH27|RL22_BRUSI RecName: Full=50S ribosomal protein L22
 gi|82470721|gb|ABB77396.1| L22 ribosomal protein [Brucella suis ATCC 23445]
 gi|82470723|gb|ABB77397.1| L22 ribosomal protein [Brucella suis bv. 3 str. 686]
 gi|163674217|gb|ABY38328.1| ribosomal protein L22 [Brucella suis ATCC 23445]
 gi|261744949|gb|EEY32875.1| L22 ribosomal protein [Brucella suis bv. 3 str. 686]
          Length = 127

 Score =  176 bits (447), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 104/122 (85%), Gaps = 2/122 (1%)

Query: 8   SKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCS 67
           + R++ DNEA A+A  LRVSPQKLNLVA+MIRGK+V+ ALADL FSRKRIAG V+KTL S
Sbjct: 6   APRQLKDNEAKAVARTLRVSPQKLNLVASMIRGKKVNAALADLTFSRKRIAGTVKKTLES 65

Query: 68  AVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           A+ANAENNHDLDVD LIV+EAYVGKS+ MKRFH RGR    RI +PFS LT++VREV+++
Sbjct: 66  AIANAENNHDLDVDALIVAEAYVGKSIVMKRFHVRGRA--SRIEKPFSHLTIVVREVAEK 123

Query: 128 GK 129
           G+
Sbjct: 124 GE 125


>gi|319899094|ref|YP_004159187.1| 50S ribosomal protein L22 [Bartonella clarridgeiae 73]
 gi|319403058|emb|CBI76613.1| 50S ribosomal protein L22 [Bartonella clarridgeiae 73]
          Length = 129

 Score =  176 bits (447), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 86/123 (69%), Positives = 103/123 (83%)

Query: 8   SKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCS 67
           + R++ D EA A+A  +RVSPQKLNLVAAMIRGK+V+ ALADL FSRKRIAG V+ TL S
Sbjct: 6   APRQLKDIEAKAVARTIRVSPQKLNLVAAMIRGKKVNMALADLTFSRKRIAGAVKSTLES 65

Query: 68  AVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           A+ANAENNHDLD+D LIV+EAYVGKS+ MKRFH RGR R  R+ RPFS LT+IVREV ++
Sbjct: 66  AIANAENNHDLDIDSLIVAEAYVGKSIVMKRFHVRGRGRASRVKRPFSHLTIIVREVVEK 125

Query: 128 GKV 130
           G+V
Sbjct: 126 GEV 128


>gi|312115692|ref|YP_004013288.1| ribosomal protein L22 [Rhodomicrobium vannielii ATCC 17100]
 gi|311220821|gb|ADP72189.1| ribosomal protein L22 [Rhodomicrobium vannielii ATCC 17100]
          Length = 126

 Score =  176 bits (447), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 83/121 (68%), Positives = 104/121 (85%)

Query: 8   SKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCS 67
           ++RR+ DNEA A+A  LRVSPQKLNLVA +IRGK+V  ALADL FSRKRIA +V+KTL S
Sbjct: 6   TERRIKDNEAQAVARSLRVSPQKLNLVAQLIRGKKVDKALADLTFSRKRIAQDVKKTLQS 65

Query: 68  AVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           A+ANAENNH+LDVD+LIV+EAYVGK++ +KRFH R R R+GRI +PFS+LTV+VREV ++
Sbjct: 66  AIANAENNHNLDVDQLIVAEAYVGKNLVLKRFHARARGRMGRIEKPFSQLTVVVREVQEQ 125

Query: 128 G 128
            
Sbjct: 126 A 126


>gi|240850830|ref|YP_002972230.1| 50S ribosomal protein L22 [Bartonella grahamii as4aup]
 gi|240267953|gb|ACS51541.1| 50S ribosomal protein L22 [Bartonella grahamii as4aup]
          Length = 129

 Score =  176 bits (446), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 87/118 (73%), Positives = 100/118 (84%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           R++ DNEA A+   +RVSPQKLNLVAAMIRGKRV+ ALADL FSRKRIA  V+KTL SA+
Sbjct: 8   RQLRDNEARAVTRTIRVSPQKLNLVAAMIRGKRVNVALADLMFSRKRIAATVKKTLESAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           ANAENNHDLD+D LIV+EAYVGKS+ MKRFH RGR R  RI RPFS LTVIVREV+++
Sbjct: 68  ANAENNHDLDIDSLIVAEAYVGKSIVMKRFHVRGRGRASRIERPFSHLTVIVREVTEK 125


>gi|154253182|ref|YP_001414006.1| 50S ribosomal protein L22 [Parvibaculum lavamentivorans DS-1]
 gi|154157132|gb|ABS64349.1| ribosomal protein L22 [Parvibaculum lavamentivorans DS-1]
          Length = 126

 Score =  173 bits (439), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 105/124 (84%)

Query: 5   RSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKT 64
           ++V+KRR+ +NEA A+  MLRVSPQKLNLVA +IRGK+V  ALADL FSRKRI+ +V+K 
Sbjct: 3   KAVNKRRLPENEAQAVGRMLRVSPQKLNLVAQLIRGKKVETALADLTFSRKRISDDVKKI 62

Query: 65  LCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV 124
           L SA+ANAENNHDLDVD LIV+EAYVGK++ MKR+H R R R+GRI +PFS++T++VR+V
Sbjct: 63  LQSAIANAENNHDLDVDDLIVAEAYVGKNLVMKRWHARARGRVGRIEKPFSQITIVVRQV 122

Query: 125 SDEG 128
            ++ 
Sbjct: 123 EEQA 126


>gi|319405893|emb|CBI79525.1| 50S ribosomal protein L22 [Bartonella sp. AR 15-3]
          Length = 129

 Score =  173 bits (438), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 100/124 (80%)

Query: 8   SKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCS 67
           + R++ D EA AIA  +RVSPQKLNLVAAMIRGK+V  ALADL FSRKRIA  VR TL S
Sbjct: 6   APRQLKDTEAKAIARTIRVSPQKLNLVAAMIRGKKVDMALADLTFSRKRIASTVRTTLES 65

Query: 68  AVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           A+ANAENNHDLD+D LIV+EAYVGKS+ MKRFH RGR R  R+ RPFS LT++VREV  +
Sbjct: 66  AIANAENNHDLDIDSLIVAEAYVGKSIVMKRFHVRGRGRANRVKRPFSHLTIVVREVIGK 125

Query: 128 GKVV 131
           G+ V
Sbjct: 126 GRGV 129


>gi|90417760|ref|ZP_01225672.1| ribosomal protein L22 [Aurantimonas manganoxydans SI85-9A1]
 gi|90337432|gb|EAS51083.1| ribosomal protein L22 [Aurantimonas manganoxydans SI85-9A1]
          Length = 129

 Score =  172 bits (436), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 81/118 (68%), Positives = 99/118 (83%)

Query: 8   SKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCS 67
           ++RR+ +NEA A+A  +RVSPQKLNLVA MIRGK+V  ALADL FSRKRIA  V+KTL S
Sbjct: 6   AERRLSENEARAVARTIRVSPQKLNLVAQMIRGKKVDAALADLTFSRKRIAETVKKTLES 65

Query: 68  AVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVS 125
           A+ANAENNHDLDVD L+V+EAYVGKS+ MKRFH RGR R  R+ +PFS LT++VRE++
Sbjct: 66  AIANAENNHDLDVDSLVVAEAYVGKSITMKRFHARGRGRASRVEKPFSHLTIVVREIA 123


>gi|254470290|ref|ZP_05083694.1| ribosomal protein L22 [Pseudovibrio sp. JE062]
 gi|211960601|gb|EEA95797.1| ribosomal protein L22 [Pseudovibrio sp. JE062]
          Length = 126

 Score =  171 bits (433), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 81/118 (68%), Positives = 100/118 (84%)

Query: 9   KRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSA 68
           +R + DNEA A+A MLRVSPQKLNLVAA IRGK+V  ALADL FSRKRI+G+V+K L SA
Sbjct: 7   ERTLADNEAKAVARMLRVSPQKLNLVAASIRGKKVGTALADLTFSRKRISGDVKKCLMSA 66

Query: 69  VANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           +ANAENNHDLDVD L+V+EA+VGK++ MKRF  R R R+GRI++PFS LT++VREV +
Sbjct: 67  IANAENNHDLDVDNLVVAEAFVGKALVMKRFQPRARGRVGRILKPFSNLTIVVREVEE 124


>gi|319407421|emb|CBI81072.1| 50S ribosomal protein L22 [Bartonella sp. 1-1C]
          Length = 129

 Score =  171 bits (433), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 100/121 (82%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           R++ D EA A+A  +RVSPQKLNLVAAMIRGK+V+ ALADL FS KRIAG VR TL SA+
Sbjct: 8   RQLKDIEAKAVARTVRVSPQKLNLVAAMIRGKKVNMALADLTFSHKRIAGTVRSTLESAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEGK 129
           ANAENNH+LD+D LIV+EAYVGKS+ MKRFH RGR R  R+ RPFS LT+IVREV ++ +
Sbjct: 68  ANAENNHNLDIDSLIVAEAYVGKSIVMKRFHVRGRGRASRVKRPFSHLTIIVREVVEKAE 127

Query: 130 V 130
           V
Sbjct: 128 V 128


>gi|319404420|emb|CBI78023.1| 50S ribosomal protein L22 [Bartonella rochalimae ATCC BAA-1498]
          Length = 129

 Score =  170 bits (431), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 100/121 (82%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           R++ D EA A+A  +RVSPQKLNLVA MIRGK+V+ ALADL FSRKRIAG VR  L SA+
Sbjct: 8   RQLKDIEAKAVARTVRVSPQKLNLVAEMIRGKKVNMALADLAFSRKRIAGTVRSALESAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEGK 129
           ANAENNH+LD+D LIV+EAYVGKS+ MKRFH RGR R  R+ RPFS LT+IVREV ++G+
Sbjct: 68  ANAENNHNLDIDSLIVAEAYVGKSIVMKRFHVRGRGRASRVKRPFSHLTIIVREVVEKGE 127

Query: 130 V 130
           V
Sbjct: 128 V 128


>gi|182678342|ref|YP_001832488.1| 50S ribosomal protein L22 [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|226733434|sp|B2IK67|RL22_BEII9 RecName: Full=50S ribosomal protein L22
 gi|182634225|gb|ACB94999.1| ribosomal protein L22 [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 129

 Score =  169 bits (427), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 99/118 (83%)

Query: 8   SKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCS 67
           + R +GDNEA A+A MLRVSPQKLNLVA +IRGK+V  ALADLEFSRKRIA +V+KTL S
Sbjct: 6   TPRSLGDNEAKAVARMLRVSPQKLNLVAQLIRGKKVDKALADLEFSRKRIAYDVKKTLES 65

Query: 68  AVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVS 125
           A+ANAENNH LDVD LIV+EA+VGK++ MKRF  R R R GRI +PF+ LT++VREV+
Sbjct: 66  AIANAENNHSLDVDDLIVAEAFVGKAMVMKRFSPRARGRSGRIEKPFAHLTIVVREVT 123


>gi|256061308|ref|ZP_05451458.1| 50S ribosomal protein L22 [Brucella neotomae 5K33]
 gi|261325315|ref|ZP_05964512.1| L22 ribosomal protein [Brucella neotomae 5K33]
 gi|82470713|gb|ABB77392.1| L22 ribosomal protein [Brucella neotomae 5K33]
 gi|261301295|gb|EEY04792.1| L22 ribosomal protein [Brucella neotomae 5K33]
          Length = 131

 Score =  169 bits (427), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 105/124 (84%), Gaps = 2/124 (1%)

Query: 8   SKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCS 67
           + R++ DNEA A+A  LRVSPQKLNLVA+MIRGK+V+ ALADL FSRKRIAG V+KTL S
Sbjct: 6   APRQLKDNEAKAVARTLRVSPQKLNLVASMIRGKKVNAALADLTFSRKRIAGTVKKTLES 65

Query: 68  AVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRI--GRIVRPFSRLTVIVREVS 125
           A+ANAENNHDLDVD LIV+EAYVGKS+ MKRFH RGR R    RI +PFS LT++VREV+
Sbjct: 66  AIANAENNHDLDVDALIVAEAYVGKSIVMKRFHVRGRGRGRASRIEKPFSHLTIVVREVA 125

Query: 126 DEGK 129
           ++G+
Sbjct: 126 EKGE 129


>gi|170738698|ref|YP_001767353.1| 50S ribosomal protein L22 [Methylobacterium sp. 4-46]
 gi|226733486|sp|B0UHW4|RL22_METS4 RecName: Full=50S ribosomal protein L22
 gi|168192972|gb|ACA14919.1| ribosomal protein L22 [Methylobacterium sp. 4-46]
          Length = 127

 Score =  168 bits (426), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 102/124 (82%)

Query: 5   RSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKT 64
           ++ + R + +NEA A+A MLRVSPQKLNLVA +IRGK+V++ALADL+FSRKRIA EVRK 
Sbjct: 3   KAAAPRALPENEAKAVARMLRVSPQKLNLVAQLIRGKKVANALADLQFSRKRIAVEVRKC 62

Query: 65  LCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV 124
           L SA+ANAENNHDLDVD L+V EAYVGK++ +KRFH R R R  RI++PF+ LT++VREV
Sbjct: 63  LESAIANAENNHDLDVDDLVVKEAYVGKALVLKRFHARARGRGARILKPFANLTIVVREV 122

Query: 125 SDEG 128
             E 
Sbjct: 123 RAEA 126


>gi|110277324|gb|ABG57186.1| 23S ribosomal protein subunit L22 [Brucella neotomae 5K33]
          Length = 133

 Score =  168 bits (425), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 105/126 (83%), Gaps = 4/126 (3%)

Query: 8   SKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCS 67
           + R++ DNEA A+A  LRVSPQKLNLVA+MIRGK+V+ ALADL FSRKRIAG V+KTL S
Sbjct: 6   APRQLKDNEAKAVARTLRVSPQKLNLVASMIRGKKVNAALADLTFSRKRIAGTVKKTLES 65

Query: 68  AVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRI----GRIVRPFSRLTVIVRE 123
           A+ANAENNHDLDVD LIV+EAYVGKS+ MKRFH RGR R      RI +PFS LT++VRE
Sbjct: 66  AIANAENNHDLDVDALIVAEAYVGKSIVMKRFHVRGRGRGRGRASRIEKPFSHLTIVVRE 125

Query: 124 VSDEGK 129
           V+++G+
Sbjct: 126 VAEKGE 131


>gi|323136091|ref|ZP_08071174.1| ribosomal protein L22 [Methylocystis sp. ATCC 49242]
 gi|322399182|gb|EFY01701.1| ribosomal protein L22 [Methylocystis sp. ATCC 49242]
          Length = 128

 Score =  167 bits (424), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 80/118 (67%), Positives = 97/118 (82%)

Query: 11  RMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVA 70
           R+ DNEA A+A M+RVSPQKLNL+A +IRGK+V  ALADLEFSRKRIA EV+KTL SA+A
Sbjct: 9   RLADNEAKAVARMIRVSPQKLNLLAQLIRGKKVDRALADLEFSRKRIAYEVKKTLESAIA 68

Query: 71  NAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           NAENNH LDVD L+V++AYVGK++ MKRFH R R R  R+ +PFS LT+IVREV  + 
Sbjct: 69  NAENNHGLDVDDLVVAQAYVGKALVMKRFHARARGRASRVEKPFSNLTIIVREVEAQA 126


>gi|75675561|ref|YP_317982.1| 50S ribosomal protein L22 [Nitrobacter winogradskyi Nb-255]
 gi|85715126|ref|ZP_01046110.1| 50S ribosomal protein L22 [Nitrobacter sp. Nb-311A]
 gi|109893215|sp|Q3SSW1|RL22_NITWN RecName: Full=50S ribosomal protein L22
 gi|74420431|gb|ABA04630.1| LSU ribosomal protein L22P [Nitrobacter winogradskyi Nb-255]
 gi|85698041|gb|EAQ35914.1| 50S ribosomal protein L22 [Nitrobacter sp. Nb-311A]
          Length = 128

 Score =  167 bits (423), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 99/120 (82%)

Query: 9   KRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSA 68
           +R + +NEA AIA MLRVSPQKLNLVA +IRG++ S ALADL+FSRKRIAG+V+K L SA
Sbjct: 7   ERSLPENEAKAIARMLRVSPQKLNLVAQLIRGRKASAALADLQFSRKRIAGDVKKCLESA 66

Query: 69  VANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           +ANAENNHDLDVD LIVSEA+VG  + MKRF  RGR R GRI +PFS+LT++VR+V  E 
Sbjct: 67  IANAENNHDLDVDELIVSEAFVGNGMVMKRFAPRGRGRSGRIYKPFSQLTIVVRQVEAEA 126


>gi|46203603|ref|ZP_00051289.2| COG0091: Ribosomal protein L22 [Magnetospirillum magnetotacticum
           MS-1]
 gi|188581380|ref|YP_001924825.1| 50S ribosomal protein L22 [Methylobacterium populi BJ001]
 gi|226733484|sp|B1Z757|RL22_METPB RecName: Full=50S ribosomal protein L22
 gi|179344878|gb|ACB80290.1| ribosomal protein L22 [Methylobacterium populi BJ001]
          Length = 127

 Score =  167 bits (423), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 101/124 (81%)

Query: 5   RSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKT 64
           +  + R + +NEA A+A MLRVSPQKLNLVAA+IRGK+V  ALADLEFSRKRIA +V+K 
Sbjct: 3   KPATPRALPENEAKAVARMLRVSPQKLNLVAALIRGKKVDTALADLEFSRKRIARDVKKC 62

Query: 65  LCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV 124
           L SA+ANAENNHDLDVD L+VS+A+VGK++ +KRFH R R R  RI++PFS LT++VREV
Sbjct: 63  LESAIANAENNHDLDVDDLVVSQAFVGKALVLKRFHARARGRGARILKPFSNLTIVVREV 122

Query: 125 SDEG 128
             E 
Sbjct: 123 RAEA 126


>gi|220921904|ref|YP_002497205.1| 50S ribosomal protein L22 [Methylobacterium nodulans ORS 2060]
 gi|254800448|sp|B8IS90|RL22_METNO RecName: Full=50S ribosomal protein L22
 gi|219946510|gb|ACL56902.1| ribosomal protein L22 [Methylobacterium nodulans ORS 2060]
          Length = 127

 Score =  167 bits (422), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 101/124 (81%)

Query: 5   RSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKT 64
           ++ + R + +NEA A+A MLRVSPQKLNLVA +IRGK+V+ ALADL+FS+KRIA EV+K 
Sbjct: 3   KAAAPRALPENEAKAVARMLRVSPQKLNLVAQLIRGKKVATALADLQFSQKRIAVEVKKC 62

Query: 65  LCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV 124
           L SA+ANAENNHDLDVD L+V EAYVGK++ +KRFH R R R  RI++PFS LT++VREV
Sbjct: 63  LESAIANAENNHDLDVDDLVVKEAYVGKALVLKRFHARARGRGARILKPFSNLTIVVREV 122

Query: 125 SDEG 128
             E 
Sbjct: 123 RAEA 126


>gi|328543363|ref|YP_004303472.1| 50S ribosomal protein L22 [Polymorphum gilvum SL003B-26A1]
 gi|326413108|gb|ADZ70171.1| 50S ribosomal protein L22 [Polymorphum gilvum SL003B-26A1]
          Length = 126

 Score =  166 bits (420), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 79/118 (66%), Positives = 97/118 (82%)

Query: 9   KRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSA 68
           +R + DNEA A+  MLRVSP+KLNLVAA IRGK+V  ALADL FSRKRIAG+V+KTL SA
Sbjct: 7   ERTLADNEAKAVTRMLRVSPRKLNLVAAAIRGKKVGSALADLTFSRKRIAGDVKKTLMSA 66

Query: 69  VANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           +ANAENNHDLDVD L+V+EA+VGK+  +KRFH R R R  RI +PFS LT++VR+V +
Sbjct: 67  IANAENNHDLDVDSLVVAEAHVGKAFVIKRFHARARGRASRIEKPFSNLTIVVRQVEE 124


>gi|163851590|ref|YP_001639633.1| ribosomal protein L22 [Methylobacterium extorquens PA1]
 gi|218530399|ref|YP_002421215.1| 50S ribosomal protein L22 [Methylobacterium chloromethanicum CM4]
 gi|240138758|ref|YP_002963230.1| 50S ribosomal subunit protein L22 [Methylobacterium extorquens AM1]
 gi|254561358|ref|YP_003068453.1| 50S ribosomal subunit protein L22 [Methylobacterium extorquens DM4]
 gi|226733483|sp|A9W4Q6|RL22_METEP RecName: Full=50S ribosomal protein L22
 gi|254800446|sp|B7L0R6|RL22_METC4 RecName: Full=50S ribosomal protein L22
 gi|163663195|gb|ABY30562.1| ribosomal protein L22 [Methylobacterium extorquens PA1]
 gi|218522702|gb|ACK83287.1| ribosomal protein L22 [Methylobacterium chloromethanicum CM4]
 gi|240008727|gb|ACS39953.1| 50S ribosomal subunit protein L22 [Methylobacterium extorquens AM1]
 gi|254268636|emb|CAX24595.1| 50S ribosomal subunit protein L22 [Methylobacterium extorquens DM4]
          Length = 127

 Score =  166 bits (420), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 101/124 (81%)

Query: 5   RSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKT 64
           +  + R + +NEA A+A MLRVSPQKLNLVAA+IRGK+V  ALADLEFSRKRIA +V+K 
Sbjct: 3   KPATPRALPENEAKAVARMLRVSPQKLNLVAALIRGKKVDTALADLEFSRKRIARDVKKC 62

Query: 65  LCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV 124
           L SA+ANAENNHDLDVD L+VS+A+VGK++ +KRFH R R R  RI++PF+ LT++VREV
Sbjct: 63  LESAIANAENNHDLDVDDLVVSQAFVGKALVLKRFHARARGRGARILKPFANLTIVVREV 122

Query: 125 SDEG 128
             E 
Sbjct: 123 RAEA 126


>gi|90424932|ref|YP_533302.1| 50S ribosomal protein L22 [Rhodopseudomonas palustris BisB18]
 gi|109893230|sp|Q211F3|RL22_RHOPB RecName: Full=50S ribosomal protein L22
 gi|90106946|gb|ABD88983.1| LSU ribosomal protein L22P [Rhodopseudomonas palustris BisB18]
          Length = 128

 Score =  166 bits (419), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 99/120 (82%)

Query: 9   KRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSA 68
           +R + DNEA AIA MLRVSPQKLNLVA +IRG++ S ALADL+FSRKRIA +V+K L SA
Sbjct: 7   ERSLPDNEAKAIARMLRVSPQKLNLVAQLIRGRKASAALADLQFSRKRIAVDVKKCLESA 66

Query: 69  VANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           +ANAENNHDLDVD LIVSEA+VGK + MKRF  RGR R GRI +PF++LT++VR+V  E 
Sbjct: 67  IANAENNHDLDVDALIVSEAHVGKGIVMKRFAPRGRGRSGRIFKPFAQLTIVVRQVEAEA 126


>gi|299135252|ref|ZP_07028443.1| ribosomal protein L22 [Afipia sp. 1NLS2]
 gi|298590229|gb|EFI50433.1| ribosomal protein L22 [Afipia sp. 1NLS2]
          Length = 128

 Score =  165 bits (418), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 99/120 (82%)

Query: 9   KRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSA 68
           +R + +NEA A+A MLRVSPQKLNLVA +IRGK+ + ALADL+FSRKRIAG+V+K L SA
Sbjct: 7   ERALSENEAKAVARMLRVSPQKLNLVAQLIRGKKAASALADLQFSRKRIAGDVKKCLESA 66

Query: 69  VANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           +ANAENNHDLDVD L+V+EA+VG  + MKRF  RGR R GR+ +PFS+LT++VR+V  E 
Sbjct: 67  IANAENNHDLDVDALVVAEAHVGNGIVMKRFAPRGRGRSGRVYKPFSQLTIVVRQVEAEA 126


>gi|114704489|ref|ZP_01437397.1| 50S ribosomal protein L22 [Fulvimarina pelagi HTCC2506]
 gi|114539274|gb|EAU42394.1| 50S ribosomal protein L22 [Fulvimarina pelagi HTCC2506]
          Length = 129

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 79/112 (70%), Positives = 93/112 (83%)

Query: 8   SKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCS 67
           ++RR+ DNEA A+A  +RVSPQKLNLVAAMIRGK+V  ALADL FSRKRI+  V+KTL S
Sbjct: 6   AERRLKDNEAKAVARTIRVSPQKLNLVAAMIRGKKVDRALADLTFSRKRISETVKKTLES 65

Query: 68  AVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTV 119
           A+ANAENNHDLDVD L V+EAYVGKS+ MKRFH RGR R  R+ +PFS LT+
Sbjct: 66  AIANAENNHDLDVDSLFVAEAYVGKSITMKRFHARGRGRASRVEKPFSHLTI 117


>gi|92117103|ref|YP_576832.1| 50S ribosomal protein L22 [Nitrobacter hamburgensis X14]
 gi|123265323|sp|Q1QN25|RL22_NITHX RecName: Full=50S ribosomal protein L22
 gi|91799997|gb|ABE62372.1| LSU ribosomal protein L22P [Nitrobacter hamburgensis X14]
          Length = 128

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 79/120 (65%), Positives = 99/120 (82%)

Query: 9   KRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSA 68
           +R + +NEA AIA MLRVSPQKLNLVA +IRG++ S ALADL+FSRKRIAG+V+K L SA
Sbjct: 7   ERSLPENEAKAIARMLRVSPQKLNLVAQLIRGRKASAALADLQFSRKRIAGDVKKCLESA 66

Query: 69  VANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           +ANAENNHDLDVD L+V++A+VG  + MKRF  RGR R GRI +PFS+LT++VR+V  E 
Sbjct: 67  IANAENNHDLDVDELVVAQAFVGNGMVMKRFAPRGRGRSGRIYKPFSQLTIVVRQVEAEA 126


>gi|170748641|ref|YP_001754901.1| ribosomal protein L22 [Methylobacterium radiotolerans JCM 2831]
 gi|226733485|sp|B1LWT1|RL22_METRJ RecName: Full=50S ribosomal protein L22
 gi|170655163|gb|ACB24218.1| ribosomal protein L22 [Methylobacterium radiotolerans JCM 2831]
          Length = 128

 Score =  164 bits (415), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 99/120 (82%)

Query: 5   RSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKT 64
           +  + R + +NEA A+A MLRVSPQKLNLVA MIRGK+V  ALA+L+FSRKRI+ EV+K 
Sbjct: 3   KQATPRALPENEAKAVARMLRVSPQKLNLVAQMIRGKKVDTALAELQFSRKRISTEVKKC 62

Query: 65  LCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV 124
           L SA+ANAENNHDLDVD L+VS+A+VGK++ +KRFH R R R  RI++PFS LT++VREV
Sbjct: 63  LESAIANAENNHDLDVDDLVVSQAFVGKALVLKRFHARARGRGARILKPFSNLTIVVREV 122


>gi|115525580|ref|YP_782491.1| 50S ribosomal protein L22 [Rhodopseudomonas palustris BisA53]
 gi|122295413|sp|Q07KM3|RL22_RHOP5 RecName: Full=50S ribosomal protein L22
 gi|115519527|gb|ABJ07511.1| LSU ribosomal protein L22P [Rhodopseudomonas palustris BisA53]
          Length = 128

 Score =  164 bits (415), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 80/120 (66%), Positives = 99/120 (82%)

Query: 9   KRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSA 68
           +R + DNEA A+A MLRVSPQKLNLVA +IRG++ S ALADL+FSRKRIA +V+K L SA
Sbjct: 7   ERSLPDNEAKAVARMLRVSPQKLNLVAQLIRGRKASAALADLQFSRKRIAVDVKKCLESA 66

Query: 69  VANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           +ANAENNHDLDVD L+VS+A+VGK + MKRF  RGR R GRI +PF++LT+IVR+V  E 
Sbjct: 67  IANAENNHDLDVDDLVVSQAFVGKGIVMKRFAPRGRGRSGRIFKPFAQLTIIVRQVEAEA 126


>gi|110634025|ref|YP_674233.1| 50S ribosomal protein L22 [Mesorhizobium sp. BNC1]
 gi|110285009|gb|ABG63068.1| LSU ribosomal protein L22P [Chelativorans sp. BNC1]
          Length = 129

 Score =  164 bits (414), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 78/112 (69%), Positives = 94/112 (83%)

Query: 8   SKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCS 67
           + RR+ DNEA A+   +RVSPQKLNLVAA+IRGK+V+ ALADLEFSRKRIA  V++TL S
Sbjct: 6   APRRLADNEARAVLRTIRVSPQKLNLVAALIRGKKVATALADLEFSRKRIADTVKRTLES 65

Query: 68  AVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTV 119
           A+ANAENNH+LDVD L+V+EAYVGKS+ MKRFH RGR R  RI +PFS LT+
Sbjct: 66  AIANAENNHNLDVDALVVAEAYVGKSIVMKRFHARGRGRANRIEKPFSHLTI 117


>gi|86749420|ref|YP_485916.1| 50S ribosomal protein L22 [Rhodopseudomonas palustris HaA2]
 gi|91977647|ref|YP_570306.1| 50S ribosomal protein L22 [Rhodopseudomonas palustris BisB5]
 gi|109893229|sp|Q2IXQ5|RL22_RHOP2 RecName: Full=50S ribosomal protein L22
 gi|86572448|gb|ABD07005.1| LSU ribosomal protein L22P [Rhodopseudomonas palustris HaA2]
 gi|91684103|gb|ABE40405.1| LSU ribosomal protein L22P [Rhodopseudomonas palustris BisB5]
          Length = 128

 Score =  163 bits (413), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 79/120 (65%), Positives = 100/120 (83%)

Query: 9   KRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSA 68
           +R + DNEA A+A MLRVSPQKLNLVA +IRG++ + ALADL+FSRKRIA +V+K L SA
Sbjct: 7   ERVLPDNEAKAVARMLRVSPQKLNLVAQLIRGRKAAAALADLQFSRKRIAVDVKKCLESA 66

Query: 69  VANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           +ANAENNHDLDVD L+VSEA+VGK + MKRF  RGR R GRI++PF++LT++VR+V  E 
Sbjct: 67  IANAENNHDLDVDALVVSEAHVGKGIVMKRFSPRGRGRSGRILKPFAQLTIVVRQVEAEA 126


>gi|296447535|ref|ZP_06889457.1| ribosomal protein L22 [Methylosinus trichosporium OB3b]
 gi|296254923|gb|EFH02028.1| ribosomal protein L22 [Methylosinus trichosporium OB3b]
          Length = 128

 Score =  163 bits (412), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 81/120 (67%), Positives = 96/120 (80%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           R + DNEA A+A+ LRVSPQKLNL+A +IRGK+V  ALADLEFSRKRIA EV+KTL SA+
Sbjct: 8   RALADNEAKAVANTLRVSPQKLNLLAQLIRGKKVDRALADLEFSRKRIAHEVKKTLESAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEGK 129
           ANAENNH LDVD LIV++A+VGKS+ MKRF  R R R  RI +PF+ LT+IVREV    K
Sbjct: 68  ANAENNHGLDVDDLIVAQAFVGKSLVMKRFAARARGRSSRIEKPFANLTIIVREVEATAK 127


>gi|300022546|ref|YP_003755157.1| ribosomal protein L22 [Hyphomicrobium denitrificans ATCC 51888]
 gi|299524367|gb|ADJ22836.1| ribosomal protein L22 [Hyphomicrobium denitrificans ATCC 51888]
          Length = 148

 Score =  163 bits (412), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 80/122 (65%), Positives = 100/122 (81%), Gaps = 1/122 (0%)

Query: 3   GKRSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVR 62
           GK S  +RR+ D EA A+A  LR+SPQKLNLVA +IRGK+V  ALA+LEFS KRIAG+VR
Sbjct: 2   GKPS-HQRRLADTEAQAVAKSLRISPQKLNLVAGLIRGKKVEQALAELEFSEKRIAGDVR 60

Query: 63  KTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVR 122
           K + SAVANAENNH LDV+ L+V+EAYVGK++ +KRFH RGR R   I++PFS+LTV+VR
Sbjct: 61  KCVMSAVANAENNHSLDVNDLVVAEAYVGKNMVLKRFHARGRGRGAAILKPFSQLTVVVR 120

Query: 123 EV 124
           +V
Sbjct: 121 QV 122


>gi|316933532|ref|YP_004108514.1| 50S ribosomal protein L22 [Rhodopseudomonas palustris DX-1]
 gi|315601246|gb|ADU43781.1| ribosomal protein L22 [Rhodopseudomonas palustris DX-1]
          Length = 127

 Score =  162 bits (411), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 79/118 (66%), Positives = 98/118 (83%)

Query: 9   KRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSA 68
           +R + DNEA A+A MLRVSPQKLNLVA +IRG++ S ALADL FSRKRIA +V+K L SA
Sbjct: 7   ERSLPDNEAKAVARMLRVSPQKLNLVAQLIRGRKASAALADLTFSRKRIAVDVKKCLESA 66

Query: 69  VANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           +ANAENNHDLDVD L+VSEA+VGK + MKRF  RGR R GRI +PF++LT++VR+V +
Sbjct: 67  IANAENNHDLDVDALVVSEAHVGKGIVMKRFTPRGRGRSGRIFKPFAQLTIVVRQVEE 124


>gi|118591179|ref|ZP_01548578.1| 50S ribosomal protein L22 [Stappia aggregata IAM 12614]
 gi|118436255|gb|EAV42897.1| 50S ribosomal protein L22 [Stappia aggregata IAM 12614]
          Length = 126

 Score =  162 bits (411), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 97/118 (82%)

Query: 9   KRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSA 68
           +R + DNEA A+  MLRVSP+KLNLVAA IRGK+V  A+ADL FSRKRIA +V+KTL SA
Sbjct: 7   ERTLADNEARAMTRMLRVSPRKLNLVAASIRGKKVGSAIADLTFSRKRIAQDVKKTLMSA 66

Query: 69  VANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           +ANAENNHDLD+D L+V+EA+VGK+  +KRF  R R R+GRI +PFS LT++VREV +
Sbjct: 67  IANAENNHDLDIDNLVVAEAHVGKAFVIKRFQARARGRVGRIEKPFSNLTIVVREVEE 124


>gi|39936308|ref|NP_948584.1| 50S ribosomal protein L22 [Rhodopseudomonas palustris CGA009]
 gi|192292032|ref|YP_001992637.1| 50S ribosomal protein L22 [Rhodopseudomonas palustris TIE-1]
 gi|51316642|sp|Q6N4T9|RL22_RHOPA RecName: Full=50S ribosomal protein L22; AltName: Full=RRP-L22
 gi|39650163|emb|CAE28686.1| 50S ribosomal protein L22 [Rhodopseudomonas palustris CGA009]
 gi|192285781|gb|ACF02162.1| ribosomal protein L22 [Rhodopseudomonas palustris TIE-1]
          Length = 127

 Score =  162 bits (410), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 79/118 (66%), Positives = 98/118 (83%)

Query: 9   KRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSA 68
           +R + DNEA A+A MLRVSPQKLNLVA +IRG++ S ALADL FSRKRIA +V+K L SA
Sbjct: 7   ERSLPDNEAKAVARMLRVSPQKLNLVAQLIRGRKASAALADLAFSRKRIAVDVKKCLESA 66

Query: 69  VANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           +ANAENNHDLDVD L+VSEA+VGK + MKRF  RGR R GRI +PF++LT++VR+V +
Sbjct: 67  IANAENNHDLDVDALVVSEAHVGKGIVMKRFTPRGRGRSGRIFKPFAQLTIVVRQVEE 124


>gi|307946291|ref|ZP_07661626.1| ribosomal protein L22 [Roseibium sp. TrichSKD4]
 gi|307769955|gb|EFO29181.1| ribosomal protein L22 [Roseibium sp. TrichSKD4]
          Length = 126

 Score =  162 bits (409), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 97/118 (82%)

Query: 9   KRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSA 68
           +R + DNEA A+  MLRVSP+KLNLVAA IRGK+V  A+ADL FSRKRIA +V+KTL SA
Sbjct: 7   ERTLADNEARAMTRMLRVSPRKLNLVAASIRGKKVGSAIADLTFSRKRIAQDVKKTLMSA 66

Query: 69  VANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           +ANAENNHDLD+D L+V+EA+VGK+  +KRF  R R R+GRI +PFS LT++VREV +
Sbjct: 67  IANAENNHDLDIDNLMVAEAHVGKAFVIKRFQARARGRVGRIEKPFSNLTIVVREVEE 124


>gi|209884818|ref|YP_002288675.1| ribosomal protein L22 [Oligotropha carboxidovorans OM5]
 gi|209873014|gb|ACI92810.1| ribosomal protein L22 [Oligotropha carboxidovorans OM5]
          Length = 128

 Score =  162 bits (409), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 79/120 (65%), Positives = 98/120 (81%)

Query: 9   KRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSA 68
           +R + +NEA A+A MLRVSPQKLNLVA +IRGK+ + ALADL+FSRKRIA +V+K L SA
Sbjct: 7   ERALPENEAKAVARMLRVSPQKLNLVAQLIRGKKAASALADLQFSRKRIAVDVKKCLESA 66

Query: 69  VANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           +ANAENNHDLDVD L+VSEA+VG  + MKRF  RGR R GRI +PFS+LT++VR+V  E 
Sbjct: 67  IANAENNHDLDVDALVVSEAHVGNGMVMKRFAPRGRGRSGRIYKPFSQLTIVVRQVEAEA 126


>gi|148256387|ref|YP_001240972.1| 50S ribosomal protein L22 [Bradyrhizobium sp. BTAi1]
 gi|166220828|sp|A5ELM2|RL22_BRASB RecName: Full=50S ribosomal protein L22
 gi|215274926|sp|A4YSJ7|RL22_BRASO RecName: Full=50S ribosomal protein L22
 gi|146408560|gb|ABQ37066.1| LSU ribosomal protein L22P [Bradyrhizobium sp. BTAi1]
          Length = 126

 Score =  161 bits (408), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 98/116 (84%)

Query: 9   KRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSA 68
           +R + DNEA A+A MLRVSPQKLNLVA MIRG++ S ALADL+FSRKRIA +V+K L SA
Sbjct: 7   ERSLPDNEAKAVARMLRVSPQKLNLVAQMIRGRKASAALADLQFSRKRIAVDVKKCLESA 66

Query: 69  VANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV 124
           +ANAENNH+L+VD L+VS+A+VGK + MKRF  RGR R GR+ +PFS+LT+IVR+V
Sbjct: 67  IANAENNHELEVDDLVVSQAFVGKGIVMKRFSPRGRGRSGRVFKPFSQLTIIVRQV 122


>gi|158424173|ref|YP_001525465.1| ribosomal protein L22 [Azorhizobium caulinodans ORS 571]
 gi|158331062|dbj|BAF88547.1| ribosomal protein L22 [Azorhizobium caulinodans ORS 571]
          Length = 126

 Score =  160 bits (406), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 80/122 (65%), Positives = 97/122 (79%)

Query: 5   RSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKT 64
           +  + R + DNEA A+A  LRVSPQKLNLVA +IRGK+VS ALADLEFSRKRIA +V+K 
Sbjct: 3   KQATPRALADNEAKAVARNLRVSPQKLNLVAGLIRGKKVSTALADLEFSRKRIARDVKKC 62

Query: 65  LCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV 124
           L SA+ANAENNHDLDVD LIV+EA+VGK + MKRF  R R R  RI +PFS +T++VREV
Sbjct: 63  LESAIANAENNHDLDVDDLIVAEAHVGKGLVMKRFSPRARGRASRIEKPFSHITIVVREV 122

Query: 125 SD 126
            +
Sbjct: 123 EE 124


>gi|254505194|ref|ZP_05117345.1| ribosomal protein L22 [Labrenzia alexandrii DFL-11]
 gi|222441265|gb|EEE47944.1| ribosomal protein L22 [Labrenzia alexandrii DFL-11]
          Length = 126

 Score =  160 bits (406), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 97/118 (82%)

Query: 9   KRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSA 68
           +R + DNEA A+  M+RVSP+KLNLVAA IRGK+V  A+ADL FSRKRIA +V+KTL SA
Sbjct: 7   ERVLADNEARAMTRMIRVSPRKLNLVAAAIRGKKVGSAIADLTFSRKRIAQDVKKTLMSA 66

Query: 69  VANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           +ANAENNHDLD+D L+V+EA+VGK+  +KRF  R R R+GRI +PFS LT++VREV +
Sbjct: 67  IANAENNHDLDIDNLVVAEAHVGKAFVIKRFQARARGRVGRIEKPFSNLTIVVREVEE 124


>gi|27380506|ref|NP_772035.1| 50S ribosomal protein L22 [Bradyrhizobium japonicum USDA 110]
 gi|51316446|sp|Q89J89|RL22_BRAJA RecName: Full=50S ribosomal protein L22
 gi|27353670|dbj|BAC50660.1| 50S ribosomal protein L22 [Bradyrhizobium japonicum USDA 110]
          Length = 129

 Score =  159 bits (403), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 98/120 (81%)

Query: 9   KRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSA 68
           +R + +NEA A+A MLRVSPQKLNLVA +IRG++ + ALADL+FSRKRIA +V+K L SA
Sbjct: 7   ERSLAENEAKAVARMLRVSPQKLNLVAQLIRGRKAAAALADLQFSRKRIAVDVKKCLESA 66

Query: 69  VANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           +ANAENNHDLDVD L+V++A+VG  + MKRF  RGR R GR+ +PFS+LT+IVR+V  E 
Sbjct: 67  IANAENNHDLDVDDLVVAQAFVGNGLVMKRFAARGRGRSGRVYKPFSQLTIIVRQVEAEA 126


>gi|254452864|ref|ZP_05066301.1| ribosomal protein L22 [Octadecabacter antarcticus 238]
 gi|198267270|gb|EDY91540.1| ribosomal protein L22 [Octadecabacter antarcticus 238]
          Length = 126

 Score =  159 bits (402), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 77/119 (64%), Positives = 95/119 (79%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           RR+ DNEA A   MLR SPQKLNLVAAMIRGK+V  AL DL FS+KRIA +V+K L SA+
Sbjct: 8   RRVADNEARAKLRMLRTSPQKLNLVAAMIRGKKVDKALTDLTFSKKRIAADVKKCLQSAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           ANAENNH+LDVD LI++EAYVGK++ MKR   R R R G+IV+PFS LT++VR+V ++ 
Sbjct: 68  ANAENNHNLDVDELIIAEAYVGKNLTMKRGRPRARGRFGKIVKPFSELTILVRQVEEQA 126


>gi|217976762|ref|YP_002360909.1| 50S ribosomal protein L22 [Methylocella silvestris BL2]
 gi|254800449|sp|B8ELF8|RL22_METSB RecName: Full=50S ribosomal protein L22
 gi|217502138|gb|ACK49547.1| ribosomal protein L22 [Methylocella silvestris BL2]
          Length = 128

 Score =  157 bits (398), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 75/118 (63%), Positives = 97/118 (82%)

Query: 8   SKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCS 67
           + R + DNEA A+A MLR+SPQKLNL+A +IRGK+V  ALA+LEFSRKR A +VRKTL S
Sbjct: 6   TPRALKDNEAKAVARMLRISPQKLNLLAQLIRGKKVERALAELEFSRKRAAFDVRKTLES 65

Query: 68  AVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVS 125
           A+ANAENNH L+VD L+V+EA+VGK++ MKRF  R R R G+I +PFS LT+++REV+
Sbjct: 66  AIANAENNHSLEVDDLVVAEAFVGKALVMKRFSPRARGRSGKIQKPFSHLTIVLREVA 123


>gi|254437064|ref|ZP_05050558.1| ribosomal protein L22 [Octadecabacter antarcticus 307]
 gi|198252510|gb|EDY76824.1| ribosomal protein L22 [Octadecabacter antarcticus 307]
          Length = 126

 Score =  157 bits (396), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 94/119 (78%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           RR+ DNEA A   MLR SPQKLNLVA MIRGK+V  AL DL FS+KRIA +V+K L SA+
Sbjct: 8   RRVADNEARAKLRMLRTSPQKLNLVAQMIRGKKVDKALTDLTFSKKRIAADVKKCLQSAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           ANAENNH+LDVD L+++EAYVGK++ MKR   R R R G+IV+PFS LT++VR+V ++ 
Sbjct: 68  ANAENNHNLDVDELVIAEAYVGKNLTMKRGRPRARGRFGKIVKPFSELTILVRQVEEQA 126


>gi|254488378|ref|ZP_05101583.1| ribosomal protein L22 [Roseobacter sp. GAI101]
 gi|214045247|gb|EEB85885.1| ribosomal protein L22 [Roseobacter sp. GAI101]
          Length = 126

 Score =  156 bits (395), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 94/119 (78%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           RR+ DNEA A   MLR SPQKLNLVAAMIRGK+V  AL DL FS+KRIA +V+K L SA+
Sbjct: 8   RRVADNEARAKLRMLRTSPQKLNLVAAMIRGKKVDKALTDLTFSKKRIAADVKKCLQSAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           AN ENNH+LDVD L+V+EAYVGK++ MKR   R R R G+I++PFS +T++VR+V ++ 
Sbjct: 68  ANGENNHNLDVDELVVAEAYVGKNLIMKRGRPRARGRFGKIIKPFSEITIVVRQVEEQA 126


>gi|83854972|ref|ZP_00948502.1| 50S ribosomal protein L22 [Sulfitobacter sp. NAS-14.1]
 gi|83941494|ref|ZP_00953956.1| 50S ribosomal protein L22 [Sulfitobacter sp. EE-36]
 gi|83842815|gb|EAP81982.1| 50S ribosomal protein L22 [Sulfitobacter sp. NAS-14.1]
 gi|83847314|gb|EAP85189.1| 50S ribosomal protein L22 [Sulfitobacter sp. EE-36]
          Length = 126

 Score =  156 bits (394), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 94/119 (78%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           RR+ DNEA A   MLR SPQKLNLVAAMIRGK+V  AL DL FS+KRIA +V+K L SA+
Sbjct: 8   RRVADNEARAKLRMLRTSPQKLNLVAAMIRGKKVDKALTDLTFSKKRIAQDVKKCLQSAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           AN ENNH+LDVD L+V+EAYVGK++ MKR   R R R G+I++PFS +T++VR+V ++ 
Sbjct: 68  ANGENNHNLDVDELVVAEAYVGKNLIMKRGRPRARGRFGKIIKPFSEITIVVRQVEEQA 126


>gi|304391458|ref|ZP_07373400.1| ribosomal protein L22 [Ahrensia sp. R2A130]
 gi|303295687|gb|EFL90045.1| ribosomal protein L22 [Ahrensia sp. R2A130]
          Length = 128

 Score =  154 bits (390), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 91/114 (79%)

Query: 9   KRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSA 68
           +R++ DNEA ++  M+RVSPQKLNLVA +IRGK+  +AL DLEFS KRIAG VRK L SA
Sbjct: 7   ERQLADNEAKSVHRMIRVSPQKLNLVAQLIRGKKAQNALNDLEFSNKRIAGTVRKCLQSA 66

Query: 69  VANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVR 122
           +ANAENNHDLDVD L+V EA+VG S+ MKRF  RGR +  RI +PF+ LT+IV+
Sbjct: 67  IANAENNHDLDVDSLVVKEAHVGHSIVMKRFMARGRGKASRIQKPFAHLTIIVK 120


>gi|119383516|ref|YP_914572.1| 50S ribosomal protein L22 [Paracoccus denitrificans PD1222]
 gi|166221979|sp|A1B032|RL22_PARDP RecName: Full=50S ribosomal protein L22
 gi|119373283|gb|ABL68876.1| LSU ribosomal protein L22P [Paracoccus denitrificans PD1222]
          Length = 126

 Score =  154 bits (390), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 76/117 (64%), Positives = 94/117 (80%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           RR+ +NEA A   MLR SPQKLNLVAAMIRGK+V  ALADL FS KRIAG+V+K L SA+
Sbjct: 8   RRVAENEAFAKTKMLRTSPQKLNLVAAMIRGKKVDKALADLTFSSKRIAGDVKKCLQSAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           ANAENNH+LDVD LIV+EA+VGK++ MKR   R R R G+I++PFS +T+ VR+V +
Sbjct: 68  ANAENNHNLDVDNLIVAEAWVGKNLVMKRGRPRARGRYGKIMKPFSEITIKVRQVEE 124


>gi|114771264|ref|ZP_01448684.1| 50S ribosomal protein L22 [alpha proteobacterium HTCC2255]
 gi|114548189|gb|EAU51076.1| 50S ribosomal protein L22 [alpha proteobacterium HTCC2255]
          Length = 129

 Score =  154 bits (389), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 75/118 (63%), Positives = 94/118 (79%)

Query: 5   RSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKT 64
           +S + RR+ DNEA A+  MLR SPQKLNLVA MIR K V  ALADL FS+KRI+ +V+KT
Sbjct: 3   KSKNTRRVADNEAMAVNKMLRTSPQKLNLVAQMIRNKPVEKALADLTFSKKRISADVKKT 62

Query: 65  LCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVR 122
           L SA+ANAENNH LDVD LIV+EAYVGK++ MKR   R R R G+I++PF++LT++VR
Sbjct: 63  LQSAIANAENNHGLDVDDLIVAEAYVGKNLTMKRGRPRARGRYGKILKPFAQLTILVR 120


>gi|294675861|ref|YP_003576476.1| 50S ribosomal protein L22 [Rhodobacter capsulatus SB 1003]
 gi|294474681|gb|ADE84069.1| 50S ribosomal protein L22 [Rhodobacter capsulatus SB 1003]
          Length = 126

 Score =  154 bits (388), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 76/117 (64%), Positives = 94/117 (80%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           RR+ DNEA A A MLR SPQKLNLVAA+IRGK+V  ALADL FS+KRIA +VRK L SA+
Sbjct: 8   RRVADNEAFAKAKMLRTSPQKLNLVAALIRGKKVEKALADLTFSKKRIAEDVRKCLQSAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           ANAENNH LDVD L+V+EA+VGK++ MKR   R R R G+I++PFS +T+ VR+V +
Sbjct: 68  ANAENNHGLDVDNLVVAEAWVGKNLVMKRGRPRARGRFGKIMKPFSEITIKVRQVEE 124


>gi|255263834|ref|ZP_05343176.1| ribosomal protein L22 [Thalassiobium sp. R2A62]
 gi|255106169|gb|EET48843.1| ribosomal protein L22 [Thalassiobium sp. R2A62]
          Length = 126

 Score =  154 bits (388), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 95/121 (78%)

Query: 8   SKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCS 67
           + RR+ DNEA +   MLR SPQKLNLVAAMIRGK+V  AL DL FS KRIA +V+K L S
Sbjct: 6   NPRRVADNEARSKTRMLRTSPQKLNLVAAMIRGKKVDKALTDLTFSHKRIAIDVKKCLQS 65

Query: 68  AVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           A+ANAENNH+LDVD L+V+EAYVGK++ MKR   R R R G+I++PF+ LT++VR+V ++
Sbjct: 66  AIANAENNHNLDVDELVVAEAYVGKNLTMKRGRPRARGRFGKILKPFAELTIVVRQVEEQ 125

Query: 128 G 128
            
Sbjct: 126 A 126


>gi|126724868|ref|ZP_01740711.1| 50S ribosomal protein L22 [Rhodobacterales bacterium HTCC2150]
 gi|126706032|gb|EBA05122.1| 50S ribosomal protein L22 [Rhodobacterales bacterium HTCC2150]
          Length = 126

 Score =  153 bits (387), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 74/118 (62%), Positives = 94/118 (79%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           RR+ DNEA A   MLR S QKLNLVA M+RGK+V  AL DL FS+KRIAG+V+K L SA+
Sbjct: 8   RRVADNEAMAKTKMLRTSGQKLNLVAQMVRGKKVEAALTDLTFSKKRIAGDVKKCLQSAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           ANAENNH+LDVD LIV+EAYVGK++ +KR   R R R G+I++PFS LT++VR+V ++
Sbjct: 68  ANAENNHNLDVDELIVAEAYVGKNMTLKRGRPRARGRFGKILKPFSELTIVVRQVEEQ 125


>gi|84685424|ref|ZP_01013322.1| 50S ribosomal protein L22 [Maritimibacter alkaliphilus HTCC2654]
 gi|84666581|gb|EAQ13053.1| 50S ribosomal protein L22 [Rhodobacterales bacterium HTCC2654]
          Length = 126

 Score =  153 bits (387), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 77/119 (64%), Positives = 94/119 (78%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           RR+ DNEA A   MLR SPQKLNLVAAMIRGK+V  ALADL FS+KRIA +V+K L SA+
Sbjct: 8   RRVADNEAMAKLRMLRTSPQKLNLVAAMIRGKKVEKALADLTFSKKRIAVDVKKCLQSAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           ANAENNH+LDVD L+V+EA+VGK++ MKR   R R R GRI +PFS LT+ VR+V ++ 
Sbjct: 68  ANAENNHNLDVDELVVAEAFVGKNLVMKRGRPRARGRYGRINKPFSELTIKVRQVEEQA 126


>gi|56695400|ref|YP_165748.1| 50S ribosomal protein L22 [Ruegeria pomeroyi DSS-3]
 gi|81350698|sp|Q5LW57|RL22_SILPO RecName: Full=50S ribosomal protein L22
 gi|56677137|gb|AAV93803.1| ribosomal protein L22 [Ruegeria pomeroyi DSS-3]
          Length = 126

 Score =  153 bits (386), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 75/121 (61%), Positives = 94/121 (77%)

Query: 8   SKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCS 67
           + RR+ +NEA A   MLR SPQKLNLVAAMIRGK+V  AL DL FS KRIA +V+K L S
Sbjct: 6   NPRRVAENEAMAKLRMLRTSPQKLNLVAAMIRGKKVGQALTDLTFSNKRIAQDVKKCLQS 65

Query: 68  AVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           A+ANAENNH+LDVD LIV+EA+VGK++ MKR   R R R G+I++PFS LT+ VR+V ++
Sbjct: 66  AIANAENNHNLDVDELIVAEAWVGKNLVMKRGRPRARGRFGKIMKPFSELTITVRQVEEQ 125

Query: 128 G 128
            
Sbjct: 126 A 126


>gi|84515639|ref|ZP_01003000.1| 50S ribosomal protein L22 [Loktanella vestfoldensis SKA53]
 gi|84510081|gb|EAQ06537.1| 50S ribosomal protein L22 [Loktanella vestfoldensis SKA53]
          Length = 126

 Score =  153 bits (386), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 94/119 (78%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           RR+ DNEA A   MLR SPQKLNLVAA+IRGK+V  AL DL FS+KRI+ +V+K L SA+
Sbjct: 8   RRVADNEAMAKLRMLRTSPQKLNLVAALIRGKKVEKALQDLTFSKKRISDDVKKCLQSAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           ANAENNH+LDVD L+V+EAYVGK++ MKR   R R R G+IV+PFS LT+ VR+V ++ 
Sbjct: 68  ANAENNHNLDVDALVVAEAYVGKNLIMKRGRPRARGRFGKIVKPFSELTIKVRQVEEQS 126


>gi|154245628|ref|YP_001416586.1| ribosomal protein L22 [Xanthobacter autotrophicus Py2]
 gi|154159713|gb|ABS66929.1| ribosomal protein L22 [Xanthobacter autotrophicus Py2]
          Length = 126

 Score =  153 bits (386), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 94/122 (77%)

Query: 5   RSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKT 64
           +    R + DNEA A+   LR+SPQKLNLVA +IRGK+V+ ALADLEFS KRIA +VRK 
Sbjct: 3   KQAKPRALADNEAKAVLRNLRISPQKLNLVAGLIRGKKVATALADLEFSHKRIARDVRKC 62

Query: 65  LCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV 124
           L SA+ANAENNH+LDVD L+V+EA+VGK + MKRF  R R R  RI +PFS +T++VREV
Sbjct: 63  LESAIANAENNHELDVDDLVVAEAHVGKGLVMKRFSPRARGRASRIEKPFSHITIVVREV 122

Query: 125 SD 126
            +
Sbjct: 123 EE 124


>gi|83594015|ref|YP_427767.1| 50S ribosomal protein L22 [Rhodospirillum rubrum ATCC 11170]
 gi|109893231|sp|Q2RQW5|RL22_RHORT RecName: Full=50S ribosomal protein L22
 gi|83576929|gb|ABC23480.1| LSU ribosomal protein L22P [Rhodospirillum rubrum ATCC 11170]
          Length = 126

 Score =  153 bits (386), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 71/119 (59%), Positives = 93/119 (78%)

Query: 5   RSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKT 64
           +  ++RR+ D EA AI  M+R SP KLNLVA  IRGK    ALA+L FS++R+A  V+KT
Sbjct: 3   KQATERRLADTEARAITKMIRTSPYKLNLVAESIRGKTAERALAELTFSKRRMADTVKKT 62

Query: 65  LCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           L SA+ANAENNH LDVD+LIVSEAYVGK++ +KR+  R R R+G+I++PFS LT++VRE
Sbjct: 63  LQSAIANAENNHQLDVDQLIVSEAYVGKAMVLKRWRARARGRVGKILKPFSNLTIVVRE 121


>gi|84503637|ref|ZP_01001675.1| 50S ribosomal protein L22 [Oceanicola batsensis HTCC2597]
 gi|84387934|gb|EAQ00986.1| 50S ribosomal protein L22 [Oceanicola batsensis HTCC2597]
          Length = 126

 Score =  152 bits (385), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 93/119 (78%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           RR+ DNEA A   MLR SPQKLNLVA +IRGK+V  AL DL FS+KRIA +V+K L SA+
Sbjct: 8   RRVADNEAMAKVRMLRTSPQKLNLVAQLIRGKKVDKALTDLTFSKKRIAEDVKKCLQSAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           ANAENNH+LDVD LIV+EAYVGK++ MKR   R R R GRI++PFS LT+ VR++ ++ 
Sbjct: 68  ANAENNHNLDVDDLIVAEAYVGKNLIMKRGRPRARGRYGRIMKPFSELTIKVRQIEEQA 126


>gi|110678726|ref|YP_681733.1| 50S ribosomal protein L22 [Roseobacter denitrificans OCh 114]
 gi|163733820|ref|ZP_02141262.1| 50S ribosomal protein L22 [Roseobacter litoralis Och 149]
 gi|109454842|gb|ABG31047.1| ribosomal protein L22 [Roseobacter denitrificans OCh 114]
 gi|161392931|gb|EDQ17258.1| 50S ribosomal protein L22 [Roseobacter litoralis Och 149]
          Length = 126

 Score =  152 bits (385), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 93/119 (78%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           RR+ DNEA A   MLR SPQKLNLVA +IRGK+V  AL DL FS+KRIA +V+K L SA+
Sbjct: 8   RRVADNEAMAKLRMLRTSPQKLNLVAGLIRGKKVEQALTDLTFSKKRIAHDVKKCLQSAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           AN ENNH+LDVD LIV+EAYVGK++ MKR   R R R G+I++PFS +T++VR+V ++ 
Sbjct: 68  ANGENNHNLDVDELIVAEAYVGKNLTMKRGRPRARGRFGKIIKPFSEITIVVRQVEEQA 126


>gi|254462184|ref|ZP_05075600.1| ribosomal protein L22 [Rhodobacterales bacterium HTCC2083]
 gi|206678773|gb|EDZ43260.1| ribosomal protein L22 [Rhodobacteraceae bacterium HTCC2083]
          Length = 117

 Score =  152 bits (383), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 73/116 (62%), Positives = 92/116 (79%)

Query: 12  MGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVAN 71
           M DNEA A   MLR SPQKLNLVA MIRGK+V  AL DL FS+KRIA +VRK L SA+AN
Sbjct: 1   MADNEAMAKLRMLRTSPQKLNLVAGMIRGKKVDKALTDLAFSKKRIAVDVRKCLQSAIAN 60

Query: 72  AENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           AENNH+LDVD LIV+EAYVGK++ MKR   R R R G+I++PF+ +T++VR++ ++
Sbjct: 61  AENNHNLDVDELIVAEAYVGKNLTMKRGRPRARGRFGKIIKPFAEITILVRQIEEQ 116


>gi|83949790|ref|ZP_00958523.1| 50S ribosomal protein L22 [Roseovarius nubinhibens ISM]
 gi|83837689|gb|EAP76985.1| 50S ribosomal protein L22 [Roseovarius nubinhibens ISM]
          Length = 126

 Score =  151 bits (382), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 77/119 (64%), Positives = 92/119 (77%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           RR+ DNEA A   MLR SPQKLNLVAAMIRGK+V  AL DL FS+KRIA +V+K L SA+
Sbjct: 8   RRVADNEAMAKLRMLRTSPQKLNLVAAMIRGKKVDKALNDLTFSQKRIAQDVKKCLQSAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           ANAENNH+LDVD LIV+EAYVGK++ MKR   R R R G + +PFS LT+ VREV ++ 
Sbjct: 68  ANAENNHNLDVDELIVAEAYVGKNLVMKRGRPRARGRFGALRKPFSELTIKVREVEEQA 126


>gi|163739443|ref|ZP_02146853.1| 50S ribosomal protein L22 [Phaeobacter gallaeciensis BS107]
 gi|163740237|ref|ZP_02147631.1| 50S ribosomal protein L22 [Phaeobacter gallaeciensis 2.10]
 gi|254475641|ref|ZP_05089027.1| ribosomal protein L22 [Ruegeria sp. R11]
 gi|161386095|gb|EDQ10470.1| 50S ribosomal protein L22 [Phaeobacter gallaeciensis 2.10]
 gi|161387196|gb|EDQ11555.1| 50S ribosomal protein L22 [Phaeobacter gallaeciensis BS107]
 gi|214029884|gb|EEB70719.1| ribosomal protein L22 [Ruegeria sp. R11]
          Length = 126

 Score =  151 bits (382), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 74/124 (59%), Positives = 95/124 (76%)

Query: 5   RSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKT 64
           ++ + RR+ DNEA A   MLR SPQKLNLVA MIRGK+V  AL DL FS KR+A +V+K 
Sbjct: 3   KAKNPRRVADNEAMAKLRMLRTSPQKLNLVAGMIRGKKVEKALTDLTFSNKRVAQDVKKC 62

Query: 65  LCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV 124
           L SA+ANAENNH+LDVD LIV+EAYVGK++ MKR   R R R G+I++PFS +T+ VR+V
Sbjct: 63  LQSAIANAENNHNLDVDELIVAEAYVGKNLTMKRGRPRARGRFGKILKPFSEITIKVRQV 122

Query: 125 SDEG 128
            ++ 
Sbjct: 123 EEQA 126


>gi|260432435|ref|ZP_05786406.1| ribosomal protein L22 [Silicibacter lacuscaerulensis ITI-1157]
 gi|260416263|gb|EEX09522.1| ribosomal protein L22 [Silicibacter lacuscaerulensis ITI-1157]
          Length = 126

 Score =  151 bits (381), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 73/124 (58%), Positives = 96/124 (77%)

Query: 5   RSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKT 64
           ++ + RR+ +NEA A   MLR SPQKLNLVAAMIRGK+V  AL DL FS KR+A +V+K 
Sbjct: 3   KAKNPRRVAENEAMAKTRMLRTSPQKLNLVAAMIRGKKVEKALTDLTFSNKRVAQDVKKC 62

Query: 65  LCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV 124
           L SA+ANAENNH+LDVD LIV+EA+VGK++ MKR   R R R G+I++PFS +T+ VR+V
Sbjct: 63  LQSAIANAENNHNLDVDELIVAEAWVGKNLVMKRGRPRARGRFGKIMKPFSEITIKVRQV 122

Query: 125 SDEG 128
            ++ 
Sbjct: 123 EEQA 126


>gi|260428234|ref|ZP_05782213.1| ribosomal protein L22 [Citreicella sp. SE45]
 gi|260422726|gb|EEX15977.1| ribosomal protein L22 [Citreicella sp. SE45]
          Length = 126

 Score =  150 bits (380), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 93/119 (78%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           RR+ DNEA A   MLR SPQKLNLVAA+IRGK+V  AL+DL FS+KRIA +V+K L SA+
Sbjct: 8   RRVADNEAMAKLRMLRTSPQKLNLVAALIRGKKVEKALSDLTFSKKRIAVDVKKCLQSAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           ANAENNH LDVD L+V+EAYVGK++ MKR   R R R GRI +PFS LT+ VR++ ++ 
Sbjct: 68  ANAENNHGLDVDELVVAEAYVGKNLVMKRGRPRARGRFGRINKPFSELTIKVRQIEEQA 126


>gi|114570340|ref|YP_757020.1| 50S ribosomal protein L22 [Maricaulis maris MCS10]
 gi|122315788|sp|Q0ANQ5|RL22_MARMM RecName: Full=50S ribosomal protein L22
 gi|114340802|gb|ABI66082.1| LSU ribosomal protein L22P [Maricaulis maris MCS10]
          Length = 126

 Score =  150 bits (380), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 79/122 (64%), Positives = 99/122 (81%)

Query: 5   RSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKT 64
           +S + RR+ DNEA A   M+R SPQKLNLVAA+IRGK+V  ALADLEFSRKRI+ EV+KT
Sbjct: 3   QSTNPRRVADNEARAKLRMIRTSPQKLNLVAALIRGKKVERALADLEFSRKRISKEVKKT 62

Query: 65  LCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV 124
           L SA+ANAENNH LD+D L+VSEA+VGK++ MKRF  R R R  +I++PFS LT++VREV
Sbjct: 63  LESAIANAENNHGLDIDSLVVSEAFVGKNLVMKRFRARARGRGAKILKPFSELTIVVREV 122

Query: 125 SD 126
            +
Sbjct: 123 EE 124


>gi|146278563|ref|YP_001168722.1| 50S ribosomal protein L22 [Rhodobacter sphaeroides ATCC 17025]
 gi|215274864|sp|A4WVK3|RL22_RHOS5 RecName: Full=50S ribosomal protein L22
 gi|145556804|gb|ABP71417.1| LSU ribosomal protein L22P [Rhodobacter sphaeroides ATCC 17025]
          Length = 126

 Score =  150 bits (380), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 93/117 (79%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           RR+G+NEA A A MLR SPQKLNLVAA+IRGK+V  A+ADL FS+KRI+ +V K L SA+
Sbjct: 8   RRVGENEAFAKAKMLRTSPQKLNLVAALIRGKKVEKAIADLTFSKKRISQDVLKCLQSAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           ANAENNH LDVD L+VSEAY GK++ MKR   R R R G+I++PFS LT+ V++V +
Sbjct: 68  ANAENNHGLDVDELVVSEAYCGKNLVMKRGRPRARGRFGKIMKPFSELTIKVKQVGE 124


>gi|163745545|ref|ZP_02152905.1| 50S ribosomal protein L22 [Oceanibulbus indolifex HEL-45]
 gi|161382363|gb|EDQ06772.1| 50S ribosomal protein L22 [Oceanibulbus indolifex HEL-45]
          Length = 126

 Score =  150 bits (380), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 93/119 (78%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           RR+ DNEA A   MLR SPQKLNLVAA+IRGK V  AL DL FS+KRIA +V+K L SA+
Sbjct: 8   RRVADNEAMAKLRMLRTSPQKLNLVAALIRGKSVDKALTDLTFSKKRIALDVKKCLQSAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           ANAENNH+LDVD LIV+EAYVGK++ MKR   R R R G+I++PF+ +T+ VR+V ++ 
Sbjct: 68  ANAENNHNLDVDELIVAEAYVGKNLTMKRGRPRARGRFGKIIKPFAEITIKVRQVEEQA 126


>gi|114766894|ref|ZP_01445816.1| 50S ribosomal protein L22 [Pelagibaca bermudensis HTCC2601]
 gi|114540940|gb|EAU44000.1| 50S ribosomal protein L22 [Roseovarius sp. HTCC2601]
          Length = 126

 Score =  150 bits (380), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 92/119 (77%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           RR+ DNEA A   MLR SPQKLNLVAA+IRGK+V  AL DL FS+KRIA +V+K L SA+
Sbjct: 8   RRVADNEAMAKLRMLRTSPQKLNLVAALIRGKKVEKALTDLTFSKKRIAVDVKKCLQSAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           ANAENNH LDVD L+V+EAYVGK++ MKR   R R R GRI +PFS LT+ VR++ ++ 
Sbjct: 68  ANAENNHGLDVDELVVAEAYVGKNLVMKRGRPRARGRFGRINKPFSELTIKVRQIEEQA 126


>gi|85703994|ref|ZP_01035097.1| 50S ribosomal protein L22 [Roseovarius sp. 217]
 gi|85671314|gb|EAQ26172.1| 50S ribosomal protein L22 [Roseovarius sp. 217]
          Length = 126

 Score =  150 bits (379), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 91/119 (76%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           RR+ DNEA A   MLR SPQKLNLVAAMIRGK+V  AL DL FS KRIA +V+K L SA+
Sbjct: 8   RRVADNEAMAKLRMLRTSPQKLNLVAAMIRGKKVDKALTDLTFSNKRIAADVKKCLQSAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           ANAENNH+LDVD L+V+EAYVGK++ MKR   R R R G + +PFS LT+ VRE+ ++ 
Sbjct: 68  ANAENNHNLDVDGLVVAEAYVGKNLVMKRGRPRARGRFGALKKPFSELTIKVREIEEQA 126


>gi|149203517|ref|ZP_01880487.1| 50S ribosomal protein L22 [Roseovarius sp. TM1035]
 gi|149143350|gb|EDM31389.1| 50S ribosomal protein L22 [Roseovarius sp. TM1035]
          Length = 126

 Score =  150 bits (379), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 76/119 (63%), Positives = 91/119 (76%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           RR+ DNEA A   MLR SPQKLNLVAAMIRGK+V  AL DL FS KRIA +V+K L SA+
Sbjct: 8   RRVADNEAMAKLRMLRTSPQKLNLVAAMIRGKKVDKALTDLTFSNKRIAQDVKKCLQSAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           ANAENNH+LDVD LIV+EAYVGK++ MKR   R R R G + +PFS LT+ VRE+ ++ 
Sbjct: 68  ANAENNHNLDVDGLIVAEAYVGKNLVMKRGRPRARGRFGALKKPFSELTIKVREIEEQA 126


>gi|126739685|ref|ZP_01755377.1| 50S ribosomal protein L22 [Roseobacter sp. SK209-2-6]
 gi|126719331|gb|EBA16041.1| 50S ribosomal protein L22 [Roseobacter sp. SK209-2-6]
          Length = 126

 Score =  150 bits (379), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 92/119 (77%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           RR+ DNEA A   MLR SPQKLNLVA MIRGK+V  AL DL FS KRIA +V+K L SA+
Sbjct: 8   RRVADNEAMAKTRMLRTSPQKLNLVAQMIRGKKVEKALTDLTFSNKRIAQDVKKCLQSAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           ANAENNH+LDVD LIV+EA+VGK++ MKR   R R R G+I++PF+ +T+ VR+V ++ 
Sbjct: 68  ANAENNHNLDVDELIVAEAWVGKNMTMKRGRPRARGRFGKILKPFAEITIKVRQVEEQA 126


>gi|149915849|ref|ZP_01904373.1| 50S ribosomal protein L22 [Roseobacter sp. AzwK-3b]
 gi|149810172|gb|EDM70018.1| 50S ribosomal protein L22 [Roseobacter sp. AzwK-3b]
          Length = 126

 Score =  149 bits (377), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 75/121 (61%), Positives = 93/121 (76%)

Query: 8   SKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCS 67
           + RR+ DNEA A   MLR SPQKLNLVAA+IRGK+V  AL DL FS+KRIA +VRK L S
Sbjct: 6   NPRRVADNEAMAKLRMLRTSPQKLNLVAALIRGKKVDKALNDLTFSKKRIADDVRKCLQS 65

Query: 68  AVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           A+ANAENNH+LDVD LIV+EAYVGK++ MKR   R R R G + +PFS LT+ VR++ ++
Sbjct: 66  AIANAENNHNLDVDELIVAEAYVGKNLVMKRGRPRARGRFGALRKPFSELTIKVRQIEEQ 125

Query: 128 G 128
            
Sbjct: 126 A 126


>gi|254467194|ref|ZP_05080605.1| ribosomal protein L22 [Rhodobacterales bacterium Y4I]
 gi|206688102|gb|EDZ48584.1| ribosomal protein L22 [Rhodobacterales bacterium Y4I]
          Length = 126

 Score =  149 bits (377), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 92/119 (77%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           RR+ DNEA A   MLR SPQKLNLVA MIRGK+V  AL DL FS KRIA +V+K L SA+
Sbjct: 8   RRVADNEAMAKLRMLRTSPQKLNLVAQMIRGKKVEKALTDLTFSNKRIAQDVKKCLQSAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           ANAENNH+LDVD LIV+EA+VGK++ MKR   R R R G+I++PF+ +T+ VR+V ++ 
Sbjct: 68  ANAENNHNLDVDELIVAEAWVGKNLTMKRGRPRARGRFGKILKPFAEITIKVRQVEEQA 126


>gi|126728169|ref|ZP_01743985.1| 50S ribosomal protein L22 [Sagittula stellata E-37]
 gi|126711134|gb|EBA10184.1| 50S ribosomal protein L22 [Sagittula stellata E-37]
          Length = 126

 Score =  149 bits (377), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 92/119 (77%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           RR+ DNEA A   MLR SPQKLNLVAA+IRGK+V  AL DL FS+KRI+ +V+K L SA+
Sbjct: 8   RRVADNEAMAKLRMLRTSPQKLNLVAALIRGKKVEKALTDLTFSKKRISQDVKKCLQSAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           ANAENNH LDVD L+V+EAYVGK++ MKR   R R R GRI +PFS +T+ VR+V ++ 
Sbjct: 68  ANAENNHGLDVDELVVAEAYVGKNLVMKRGRPRARGRFGRINKPFSEITIKVRQVEEQA 126


>gi|254510654|ref|ZP_05122721.1| ribosomal protein L22 [Rhodobacteraceae bacterium KLH11]
 gi|221534365|gb|EEE37353.1| ribosomal protein L22 [Rhodobacteraceae bacterium KLH11]
          Length = 126

 Score =  149 bits (377), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 72/119 (60%), Positives = 92/119 (77%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           RR+ +NEA A   MLR SPQKLNLVA MIRGK+V  AL DL FS KR+A +V+K L SA+
Sbjct: 8   RRVAENEAMAKTRMLRTSPQKLNLVAQMIRGKKVEKALTDLTFSNKRVAQDVKKCLQSAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           ANAENNH+LDVD LIV+EA+VGK++ MKR   R R R G+I++PFS +T+ VR+V ++ 
Sbjct: 68  ANAENNHNLDVDELIVAEAWVGKNLVMKRGRPRARGRFGKILKPFSEITIKVRQVEEQA 126


>gi|126736605|ref|ZP_01752345.1| ribosomal protein L22 [Roseobacter sp. CCS2]
 gi|126713918|gb|EBA10789.1| ribosomal protein L22 [Roseobacter sp. CCS2]
          Length = 126

 Score =  149 bits (377), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 93/118 (78%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           RR+ DNEA A   MLR SPQKLNLVA +IRGK+V  AL DL FS+KRI+ +V+K L SA+
Sbjct: 8   RRVADNEAMAKLRMLRTSPQKLNLVAGLIRGKKVEQALTDLTFSKKRISDDVKKCLQSAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           ANAENNH+LDVD L+V+EAYVGK++ MKR   R R R G+I++PF+ +T+ VR+V ++
Sbjct: 68  ANAENNHNLDVDELVVAEAYVGKNLTMKRGRPRARGRFGKIIKPFAEITIKVRQVEEQ 125


>gi|99080095|ref|YP_612249.1| 50S ribosomal protein L22 [Ruegeria sp. TM1040]
 gi|259416031|ref|ZP_05739951.1| ribosomal protein L22 [Silicibacter sp. TrichCH4B]
 gi|123077808|sp|Q1GK29|RL22_SILST RecName: Full=50S ribosomal protein L22
 gi|99036375|gb|ABF62987.1| LSU ribosomal protein L22P [Ruegeria sp. TM1040]
 gi|259347470|gb|EEW59247.1| ribosomal protein L22 [Silicibacter sp. TrichCH4B]
          Length = 126

 Score =  149 bits (377), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 92/119 (77%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           RR+ DNEA A   MLR SPQKLNLVA MIRGK+V  AL DL FS KRIA +V+K L SA+
Sbjct: 8   RRVADNEAMAKVRMLRTSPQKLNLVAQMIRGKKVDKALTDLTFSNKRIAQDVKKCLQSAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           ANAENNH+LDVD LIV+EA+VGK++ MKR   R R R G+I++PF+ +T+ VR+V ++ 
Sbjct: 68  ANAENNHNLDVDELIVAEAWVGKNLTMKRGRPRARGRFGKILKPFAEITIKVRQVEEQA 126


>gi|146340062|ref|YP_001205110.1| 50S ribosomal subunit protein L22 [Bradyrhizobium sp. ORS278]
 gi|146192868|emb|CAL76873.1| 50S ribosomal subunit protein L22 [Bradyrhizobium sp. ORS278]
          Length = 109

 Score =  149 bits (375), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 72/105 (68%), Positives = 90/105 (85%)

Query: 20  IASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLD 79
           +A MLRVSPQKLNLVA MIRG++ S ALADL+FSRKRIA +V+K L SA+ANAENNH+L+
Sbjct: 1   MARMLRVSPQKLNLVAQMIRGRKASAALADLQFSRKRIAVDVKKCLESAIANAENNHELE 60

Query: 80  VDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV 124
           VD L+VS+A+VGK + MKRF  RGR R GR+ +PFS+LT+IVR+V
Sbjct: 61  VDDLVVSQAFVGKGIVMKRFSPRGRGRSGRVFKPFSQLTIIVRQV 105


>gi|159042843|ref|YP_001531637.1| 50S ribosomal protein L22 [Dinoroseobacter shibae DFL 12]
 gi|189041949|sp|A8LM59|RL22_DINSH RecName: Full=50S ribosomal protein L22
 gi|157910603|gb|ABV92036.1| 50S ribosomal protein L22 [Dinoroseobacter shibae DFL 12]
          Length = 126

 Score =  148 bits (373), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 92/119 (77%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           RR+ +NEA A   MLR SPQKLNLVA MIRGK+V  ALADL FS KRIA +V+K L SA+
Sbjct: 8   RRVAENEAMAKTRMLRTSPQKLNLVAQMIRGKKVDKALADLTFSHKRIAVDVKKCLQSAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           ANAENNH LDVD LIV+EA+VGK++ MKR   R R R G+I++PF+ +T+ VR+V ++ 
Sbjct: 68  ANAENNHGLDVDELIVAEAWVGKNLTMKRGRPRARGRFGKIIKPFAEITIKVRQVEEQA 126


>gi|86135768|ref|ZP_01054347.1| 50S ribosomal protein L22 [Roseobacter sp. MED193]
 gi|85826642|gb|EAQ46838.1| 50S ribosomal protein L22 [Roseobacter sp. MED193]
          Length = 126

 Score =  147 bits (372), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 71/119 (59%), Positives = 92/119 (77%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           RR+ DNEA A   MLR SPQKLNLVA MIRGK+V  AL DL FS KR+A +V+K L SA+
Sbjct: 8   RRVADNEAMAKTRMLRTSPQKLNLVAQMIRGKKVDKALTDLTFSNKRVAQDVKKCLQSAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           ANAENNH+LDVD LIV+EA+VGK++ +KR   R R R G+I++PF+ +T+ VR+V ++ 
Sbjct: 68  ANAENNHNLDVDELIVAEAWVGKNMTLKRGRPRARGRFGKILKPFAEITIKVRQVEEQA 126


>gi|89053081|ref|YP_508532.1| 50S ribosomal protein L22 [Jannaschia sp. CCS1]
 gi|109893202|sp|Q28UV5|RL22_JANSC RecName: Full=50S ribosomal protein L22
 gi|88862630|gb|ABD53507.1| LSU ribosomal protein L22P [Jannaschia sp. CCS1]
          Length = 126

 Score =  147 bits (372), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 72/117 (61%), Positives = 91/117 (77%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           RR+ DNEA A   ML+ SPQKLNLVA +IRG++V  AL DL FS+KRIA +V+K L SA+
Sbjct: 8   RRVADNEAMAKLRMLKTSPQKLNLVAGLIRGQKVEKALTDLTFSKKRIAVDVKKCLQSAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           ANAENNH LDVD LIV+EA+VGK++ MKR   R R R G+I++PFS LT+ VR+V +
Sbjct: 68  ANAENNHGLDVDELIVAEAWVGKNLVMKRGRPRARGRFGKILKPFSELTITVRQVEE 124


>gi|209964045|ref|YP_002296960.1| ribosomal protein L22 [Rhodospirillum centenum SW]
 gi|226733501|sp|B6IRR1|RL22_RHOCS RecName: Full=50S ribosomal protein L22
 gi|209957511|gb|ACI98147.1| ribosomal protein L22 [Rhodospirillum centenum SW]
          Length = 132

 Score =  147 bits (372), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 72/123 (58%), Positives = 94/123 (76%)

Query: 5   RSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKT 64
           +  ++RR+ +NEA A A ++R SP+KLNLVA +IRGK   +ALA L FS++R+AGEV+K 
Sbjct: 3   KPAAERRLSENEAQAFARLIRSSPRKLNLVAQLIRGKAAGEALALLTFSKRRVAGEVKKV 62

Query: 65  LCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV 124
           L SA+ANAENNH LDVDRL VS A VG+++ MKRFH R R R  R+ + FS LTV+VRE 
Sbjct: 63  LQSAIANAENNHQLDVDRLYVSHATVGRALVMKRFHARARGRGARVEKWFSNLTVVVRER 122

Query: 125 SDE 127
           +DE
Sbjct: 123 ADE 125


>gi|163796914|ref|ZP_02190871.1| Ribosomal protein L22 [alpha proteobacterium BAL199]
 gi|159177903|gb|EDP62452.1| Ribosomal protein L22 [alpha proteobacterium BAL199]
          Length = 126

 Score =  147 bits (371), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 95/126 (75%), Gaps = 1/126 (0%)

Query: 3   GKRSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVR 62
           GK+S + R++ DNEA AI   LRVS QKLN+VA  IRG   + A++ L FS++RIAG V+
Sbjct: 2   GKQSAA-RKLDDNEAQAIVHNLRVSAQKLNVVAETIRGLDAAKAISSLMFSKRRIAGAVK 60

Query: 63  KTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVR 122
           K L SA+ANAENNH LDVDRL V EAYVGKS+ MKRF  R R R+G+I +PFS LTV+VR
Sbjct: 61  KALESAIANAENNHQLDVDRLYVKEAYVGKSMRMKRFRPRARGRVGKIEKPFSHLTVVVR 120

Query: 123 EVSDEG 128
           E  ++G
Sbjct: 121 EREEQG 126


>gi|77462264|ref|YP_351768.1| 50S ribosomal protein L22 [Rhodobacter sphaeroides 2.4.1]
 gi|126461140|ref|YP_001042254.1| 50S ribosomal protein L22 [Rhodobacter sphaeroides ATCC 17029]
 gi|221638118|ref|YP_002524380.1| 50S ribosomal protein L22 [Rhodobacter sphaeroides KD131]
 gi|109893232|sp|Q3J5R7|RL22_RHOS4 RecName: Full=50S ribosomal protein L22
 gi|215274863|sp|A3PGL6|RL22_RHOS1 RecName: Full=50S ribosomal protein L22
 gi|254800456|sp|B9KL96|RL22_RHOSK RecName: Full=50S ribosomal protein L22
 gi|77386682|gb|ABA77867.1| LSU ribosomal protein L22P [Rhodobacter sphaeroides 2.4.1]
 gi|126102804|gb|ABN75482.1| LSU ribosomal protein L22P [Rhodobacter sphaeroides ATCC 17029]
 gi|221158899|gb|ACL99878.1| 50S ribosomal protein L22 [Rhodobacter sphaeroides KD131]
          Length = 126

 Score =  147 bits (370), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 72/117 (61%), Positives = 92/117 (78%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           RR+G+NEA A   MLR SPQKLNLVAA+IRGK+V  A+ADL FS+KRI+ +V K L SA+
Sbjct: 8   RRVGENEAFAKVKMLRTSPQKLNLVAALIRGKKVDKAIADLTFSKKRISQDVLKCLQSAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           ANAENNH LDVD L+VSEA+ GK++ MKR   R R R G+I++PFS LT+ V++V +
Sbjct: 68  ANAENNHGLDVDELVVSEAFCGKNLVMKRGRPRARGRFGKIMKPFSELTIKVKQVGE 124


>gi|329850212|ref|ZP_08265057.1| ribosomal protein L22 [Asticcacaulis biprosthecum C19]
 gi|328840527|gb|EGF90098.1| ribosomal protein L22 [Asticcacaulis biprosthecum C19]
          Length = 127

 Score =  146 bits (369), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 72/119 (60%), Positives = 90/119 (75%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           RR+  NEA      +R+SPQKLNLVAA IRG +V  AL +LEFSRKRIA +VRK L SA+
Sbjct: 8   RRVNANEARTKLVSVRISPQKLNLVAASIRGLKVQRALNELEFSRKRIAKDVRKALYSAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           +NAENNH+LD+D L+V+EAYVGK + MKRF  R R R  RI++PFS LT++VRE+  E 
Sbjct: 68  SNAENNHNLDIDNLVVAEAYVGKGLVMKRFASRARGRSSRIMKPFSELTIVVRELGQEA 126


>gi|94498481|ref|ZP_01305037.1| ribosomal protein L22 [Sphingomonas sp. SKA58]
 gi|94422024|gb|EAT07069.1| ribosomal protein L22 [Sphingomonas sp. SKA58]
          Length = 128

 Score =  146 bits (368), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 94/122 (77%)

Query: 8   SKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCS 67
           + RR+ DNEA A+ + +R S QKLNLVA +IRG++V DAL  L FS+K +A +VRK L S
Sbjct: 6   APRRVADNEALAVGTQIRGSAQKLNLVATLIRGRKVEDALNILAFSKKAMAVDVRKVLAS 65

Query: 68  AVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           A+ANAENNH+LDVD L+V+EA VGKS  MKRFH RGR +  RI++PFSR+ ++VRE  +E
Sbjct: 66  AIANAENNHNLDVDALVVAEASVGKSFTMKRFHARGRGKSTRILKPFSRVRIVVREAGEE 125

Query: 128 GK 129
            +
Sbjct: 126 AE 127


>gi|260577176|ref|ZP_05845153.1| ribosomal protein L22 [Rhodobacter sp. SW2]
 gi|259020650|gb|EEW23969.1| ribosomal protein L22 [Rhodobacter sp. SW2]
          Length = 126

 Score =  146 bits (368), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 70/117 (59%), Positives = 93/117 (79%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           RR+ DNEA A + MLR SPQKLNLVA +IRGK+V  A+A+L FS+KRI+ +V K L SA+
Sbjct: 8   RRVADNEAMAKSKMLRTSPQKLNLVAGLIRGKKVDKAIAELVFSKKRISQDVLKCLQSAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           ANAENNH+LDVD L+V+EAY GK++ MKR   R R R G+I++PFS +T++VR+V +
Sbjct: 68  ANAENNHNLDVDELVVAEAYCGKNLVMKRGRPRARGRFGKIMKPFSEITILVRQVGE 124


>gi|103488290|ref|YP_617851.1| 50S ribosomal protein L22 [Sphingopyxis alaskensis RB2256]
 gi|123252917|sp|Q1GPA4|RL22_SPHAL RecName: Full=50S ribosomal protein L22
 gi|98978367|gb|ABF54518.1| LSU ribosomal protein L22P [Sphingopyxis alaskensis RB2256]
          Length = 126

 Score =  145 bits (367), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 72/121 (59%), Positives = 94/121 (77%)

Query: 8   SKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCS 67
           S RR+ DNEA ++ + +R S QKLNLVAA+IRG++V DA+  L FS+K +A +VRK L S
Sbjct: 6   SPRRVADNEALSVGTQIRGSAQKLNLVAALIRGRKVEDAMNVLAFSKKAMAVDVRKVLAS 65

Query: 68  AVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           AVANAENNH+LDVD L+V EA VGKS+ MKR+H RGR +  RIV+PFSR+ ++VRE  +E
Sbjct: 66  AVANAENNHNLDVDALVVKEASVGKSLSMKRWHARGRGKSTRIVKPFSRIRIVVREQEEE 125

Query: 128 G 128
            
Sbjct: 126 A 126


>gi|326388202|ref|ZP_08209805.1| 50S ribosomal protein L22 [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326207368|gb|EGD58182.1| 50S ribosomal protein L22 [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 125

 Score =  145 bits (367), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 93/122 (76%)

Query: 5   RSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKT 64
           +  + RR+GD EA A+ + +R S QKLNLVAA+IRGK   +AL  L FS+K +A + RK 
Sbjct: 3   KPAAPRRVGDKEALAVGTTIRGSAQKLNLVAALIRGKSAEEALNILSFSKKAMAVDARKV 62

Query: 65  LCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV 124
           L SA+ANAENNH+LDVD L+V+EA VGKS+ MKRFH RGR +  RI++PFSRL ++VREV
Sbjct: 63  LASAIANAENNHNLDVDALVVAEASVGKSITMKRFHTRGRGKSTRILKPFSRLRIVVREV 122

Query: 125 SD 126
            +
Sbjct: 123 EE 124


>gi|296282587|ref|ZP_06860585.1| 50S ribosomal protein L22 [Citromicrobium bathyomarinum JL354]
          Length = 125

 Score =  145 bits (365), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 70/117 (59%), Positives = 90/117 (76%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           RR+ DNEA A+ + +R S QKLNLVA +IRGK+  +AL  L FS+K +A +  K L SA+
Sbjct: 8   RRVADNEALAVGTTIRGSAQKLNLVAELIRGKKAEEALNILAFSKKAMAKDASKVLASAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           ANAENNHDLDVD L+V+EA VGKS+ MKRFH RGR +  RI++PFSRL ++VREV +
Sbjct: 68  ANAENNHDLDVDALVVAEASVGKSITMKRFHTRGRGKSTRILKPFSRLRIVVREVEE 124


>gi|148554269|ref|YP_001261851.1| 50S ribosomal protein L22 [Sphingomonas wittichii RW1]
 gi|215274869|sp|A5V5Z7|RL22_SPHWW RecName: Full=50S ribosomal protein L22
 gi|148499459|gb|ABQ67713.1| LSU ribosomal protein L22P [Sphingomonas wittichii RW1]
          Length = 127

 Score =  145 bits (365), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 71/125 (56%), Positives = 94/125 (75%)

Query: 5   RSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKT 64
           +  + RR+G+ EA A+A+ +R SP KLNLVA +IRGK+  DAL  L FS+K +A +VRK 
Sbjct: 3   KPAAPRRVGEKEALAVATTVRGSPYKLNLVAGLIRGKKAGDALNILTFSKKAMAVDVRKV 62

Query: 65  LCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV 124
           L SA+ANAENNH+LDVD L+V EA VGKS+ MKRF  RGR +  RI++PF+RL V+VRE 
Sbjct: 63  LASAIANAENNHNLDVDALVVKEASVGKSIVMKRFATRGRGKSTRIIKPFARLRVVVREQ 122

Query: 125 SDEGK 129
            +E +
Sbjct: 123 QEEAE 127


>gi|87199275|ref|YP_496532.1| 50S ribosomal protein L22 [Novosphingobium aromaticivorans DSM
           12444]
 gi|123749870|sp|Q2G8X5|RL22_NOVAD RecName: Full=50S ribosomal protein L22
 gi|87134956|gb|ABD25698.1| LSU ribosomal protein L22P [Novosphingobium aromaticivorans DSM
           12444]
          Length = 125

 Score =  145 bits (365), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 70/119 (58%), Positives = 92/119 (77%)

Query: 8   SKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCS 67
           + RR+GD EA ++ + +R S QKLNLVA +IRGKR  DA+  L FS+K +A + RK L S
Sbjct: 6   APRRVGDKEALSVGTQIRGSAQKLNLVAGLIRGKRAEDAMNILAFSKKAMAVDARKVLAS 65

Query: 68  AVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           A+ANAENNH+LDVD L+V+EA VGKS+ MKRFH RGR +  RI++PFSRL ++VREV +
Sbjct: 66  AIANAENNHNLDVDALVVAEASVGKSITMKRFHTRGRGKSTRILKPFSRLRIVVREVEE 124


>gi|298291443|ref|YP_003693382.1| ribosomal protein L22 [Starkeya novella DSM 506]
 gi|296927954|gb|ADH88763.1| ribosomal protein L22 [Starkeya novella DSM 506]
          Length = 126

 Score =  145 bits (365), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 79/124 (63%), Positives = 98/124 (79%)

Query: 5   RSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKT 64
           ++   R + D EA A+A  LRVSPQKLNLVA +IRGK+VS ALADL+FSRKRIAG+VRK 
Sbjct: 3   KAARPRTLADTEAKAVARNLRVSPQKLNLVAGLIRGKKVSAALADLQFSRKRIAGDVRKC 62

Query: 65  LCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV 124
           L SA+ANAENNH+LDVD LIV+EA+VGK + MKRF  R R R  RI +PFS +T++VREV
Sbjct: 63  LESAIANAENNHELDVDDLIVAEAHVGKGLVMKRFAARARGRASRIEKPFSHITIVVREV 122

Query: 125 SDEG 128
            ++ 
Sbjct: 123 EEKA 126


>gi|85374460|ref|YP_458522.1| 50S ribosomal protein L22 [Erythrobacter litoralis HTCC2594]
 gi|123293710|sp|Q2N9B6|RL22_ERYLH RecName: Full=50S ribosomal protein L22
 gi|84787543|gb|ABC63725.1| ribosomal protein L22 [Erythrobacter litoralis HTCC2594]
          Length = 125

 Score =  144 bits (363), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 70/119 (58%), Positives = 91/119 (76%)

Query: 8   SKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCS 67
           S RR+ DNEA A+ + +R S QKLNLVA +IRGK+  +AL  L FS+K +A +  K L S
Sbjct: 6   SPRRVADNEALAVGTTIRGSAQKLNLVAELIRGKKAEEALNILAFSKKAMARDASKVLAS 65

Query: 68  AVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           A+ANAENNHDLDVD L+V+EA VGKS+ MKRFH RGR +  RI++PFS+L ++VREV +
Sbjct: 66  AIANAENNHDLDVDALVVAEASVGKSITMKRFHTRGRGKSTRILKPFSKLRIVVREVEE 124


>gi|294010618|ref|YP_003544078.1| ribosomal protein L22 [Sphingobium japonicum UT26S]
 gi|292673948|dbj|BAI95466.1| ribosomal protein L22 [Sphingobium japonicum UT26S]
          Length = 127

 Score =  144 bits (362), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 70/119 (58%), Positives = 93/119 (78%)

Query: 8   SKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCS 67
           + RR+ DNEA A+ + +R S QKLNLVA +IRG++V DAL  L FS+K +A +VRK L S
Sbjct: 6   APRRVADNEALAVGTQIRGSAQKLNLVATLIRGRKVEDALNILAFSKKAMAVDVRKVLAS 65

Query: 68  AVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           A+ANAENNH+LDVD L+V+EA VGKS  MKRFH RGR +  RI++PFSR+ ++VRE ++
Sbjct: 66  AIANAENNHNLDVDSLVVAEASVGKSFTMKRFHARGRGKSTRILKPFSRVRIVVREQAE 124


>gi|83858561|ref|ZP_00952083.1| 50S ribosomal protein L22 [Oceanicaulis alexandrii HTCC2633]
 gi|83853384|gb|EAP91236.1| 50S ribosomal protein L22 [Oceanicaulis alexandrii HTCC2633]
          Length = 126

 Score =  143 bits (361), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 74/122 (60%), Positives = 97/122 (79%)

Query: 5   RSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKT 64
           ++ + RR+ DNEA A   M+R+SPQKLNL+A +IRGK+V  ALADLEFSRKR + +V+K 
Sbjct: 3   KAANPRRVADNEARAKLRMIRISPQKLNLIAQLIRGKKVERALADLEFSRKRHSADVKKV 62

Query: 65  LCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV 124
           L SA+ANAENNH LD+D L+VSEAYVGK++ MKRF  R R R  +I++PFS LT++VREV
Sbjct: 63  LKSAIANAENNHGLDIDSLVVSEAYVGKNLVMKRFRARARGRGAKILKPFSELTIVVREV 122

Query: 125 SD 126
            +
Sbjct: 123 EE 124


>gi|85709052|ref|ZP_01040118.1| 50S ribosomal protein L22 [Erythrobacter sp. NAP1]
 gi|85690586|gb|EAQ30589.1| 50S ribosomal protein L22 [Erythrobacter sp. NAP1]
          Length = 125

 Score =  142 bits (359), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 91/119 (76%)

Query: 8   SKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCS 67
           S RR+ +NEA A+ + +R S QKLNLVA +IRGK+  +A+  L FS+K +A +  K L S
Sbjct: 6   SPRRVAENEALAVGTTIRGSAQKLNLVAELIRGKKAEEAMNILSFSKKAMAKDASKVLAS 65

Query: 68  AVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           A+ANAENNHDLDVD L+V+EA VGKS+ MKRFH RGR +  RI++PFS+L ++VREV +
Sbjct: 66  AIANAENNHDLDVDALVVAEASVGKSITMKRFHTRGRGKSTRILKPFSKLRIVVREVEE 124


>gi|302382623|ref|YP_003818446.1| ribosomal protein L22 [Brevundimonas subvibrioides ATCC 15264]
 gi|302193251|gb|ADL00823.1| ribosomal protein L22 [Brevundimonas subvibrioides ATCC 15264]
          Length = 126

 Score =  142 bits (359), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 69/117 (58%), Positives = 91/117 (77%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           RR+G+ EA A  + +R+SPQKLNLVA  IRG  V  AL +LEFSRKRI+ +VRK L SAV
Sbjct: 8   RRVGETEARAKLTNVRISPQKLNLVAQSIRGLPVQKALNELEFSRKRISDDVRKVLYSAV 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           +NAENNH+LD+D L+V+EA+VGK++ MKRF  R R R  RI++PFS +T++VRE  +
Sbjct: 68  SNAENNHNLDIDSLVVAEAFVGKNLVMKRFASRARGRSSRILKPFSEITIVVREAGE 124


>gi|315497978|ref|YP_004086782.1| ribosomal protein l22 [Asticcacaulis excentricus CB 48]
 gi|315415990|gb|ADU12631.1| ribosomal protein L22 [Asticcacaulis excentricus CB 48]
          Length = 127

 Score =  142 bits (359), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 91/124 (73%)

Query: 5   RSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKT 64
           ++ + RR+   EA A    +R+SP KLNLVA  IRG +V  AL +LEFS KRIAG+VRK 
Sbjct: 3   QTSNPRRVKPTEARAKLVSIRISPYKLNLVAQSIRGLKVQRALNELEFSHKRIAGDVRKA 62

Query: 65  LCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV 124
           L SA++NAENNH+LD+D L V+EAYVGK++ MKRF  R R R  RI++PFS LT++VRE+
Sbjct: 63  LYSAISNAENNHNLDIDNLFVAEAYVGKNIVMKRFASRARGRSSRILKPFSELTIVVREL 122

Query: 125 SDEG 128
             E 
Sbjct: 123 GQEA 126


>gi|114327223|ref|YP_744380.1| 50S ribosomal protein L22 [Granulibacter bethesdensis CGDNIH1]
 gi|122327798|sp|Q0BUP5|RL22_GRABC RecName: Full=50S ribosomal protein L22
 gi|114315397|gb|ABI61457.1| LSU ribosomal protein L22P [Granulibacter bethesdensis CGDNIH1]
          Length = 133

 Score =  142 bits (358), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 70/123 (56%), Positives = 91/123 (73%)

Query: 8   SKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCS 67
           + R + +NEA AI S LRVSP+KLNLVA +IR ++ SDA+A L FS++RIA  V+K L S
Sbjct: 6   TPRSIAENEAQAIVSNLRVSPRKLNLVAQLIRNRKASDAVATLTFSKRRIAQAVKKALES 65

Query: 68  AVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           A+ANAENNH LDVDRL+VS A VG+S+ M+RFH RGR R  R+ + FS L ++V E S E
Sbjct: 66  AIANAENNHQLDVDRLVVSRAEVGRSIVMRRFHARGRGRAARVEKWFSHLKIVVAERSQE 125

Query: 128 GKV 130
            + 
Sbjct: 126 TET 128


>gi|149184316|ref|ZP_01862634.1| 50S ribosomal protein L22 [Erythrobacter sp. SD-21]
 gi|148831636|gb|EDL50069.1| 50S ribosomal protein L22 [Erythrobacter sp. SD-21]
          Length = 125

 Score =  142 bits (357), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 68/114 (59%), Positives = 88/114 (77%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           RR+ DNEA A+ + +R S QKLNLVA +IRGK+  +AL  L FS+K +A +  K L SA+
Sbjct: 8   RRVADNEALAVGTTIRGSAQKLNLVAELIRGKKAEEALNILAFSKKSMAKDATKVLASAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           ANAENNH+LDVD L+V+EA VGKS+ MKRFH RGR +  RI++PFSRL ++VRE
Sbjct: 68  ANAENNHNLDVDSLVVAEASVGKSITMKRFHTRGRGKSTRILKPFSRLRIVVRE 121


>gi|254420193|ref|ZP_05033917.1| ribosomal protein L22 [Brevundimonas sp. BAL3]
 gi|196186370|gb|EDX81346.1| ribosomal protein L22 [Brevundimonas sp. BAL3]
          Length = 126

 Score =  141 bits (356), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 69/117 (58%), Positives = 89/117 (76%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           RR+   EA A    +R+SPQKLNLVAA IRG  V  AL +LEFSRKRIA +VRK L SA+
Sbjct: 8   RRVAPTEARAKLVNVRISPQKLNLVAASIRGMPVQKALNELEFSRKRIATDVRKVLYSAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           +NAENNH+LD+D L+V+EA+VGK++ MKRF  R R R  RI++PFS +T++VRE  +
Sbjct: 68  SNAENNHNLDIDNLVVAEAFVGKNLVMKRFASRARGRSSRILKPFSEITIVVREAGE 124


>gi|329889134|ref|ZP_08267477.1| ribosomal protein L22 [Brevundimonas diminuta ATCC 11568]
 gi|328844435|gb|EGF93999.1| ribosomal protein L22 [Brevundimonas diminuta ATCC 11568]
          Length = 126

 Score =  140 bits (353), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 69/119 (57%), Positives = 90/119 (75%)

Query: 8   SKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCS 67
           + RR+   EA A    +R+SPQKLNLVAA IRG  V  AL +LEFS KRIAG+VRK L S
Sbjct: 6   NPRRVEATEARAKLVNVRISPQKLNLVAASIRGLPVQKALNELEFSHKRIAGDVRKVLYS 65

Query: 68  AVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           A++NAENNH+LD+D L+V+EA+VGK++ MKRF  R R R  RI++PFS +T++VRE  +
Sbjct: 66  AISNAENNHNLDIDNLVVAEAFVGKNLVMKRFASRARGRSSRILKPFSEITIVVREAGE 124


>gi|310817004|ref|YP_003964968.1| ribosomal protein L22 [Ketogulonicigenium vulgare Y25]
 gi|308755739|gb|ADO43668.1| ribosomal protein L22 [Ketogulonicigenium vulgare Y25]
          Length = 106

 Score =  139 bits (351), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 85/106 (80%)

Query: 23  MLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDR 82
           MLR SPQKLNLVA +IRGK+V  AL DL FS+KRIA +V+K L SA+ANAENNH+LDVD 
Sbjct: 1   MLRTSPQKLNLVAGLIRGKKVDKALTDLTFSKKRIAQDVKKCLQSAIANAENNHNLDVDN 60

Query: 83  LIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           LIV+EA+VGK++ MKR   R R R G+I++PFS +T+ VR+V ++ 
Sbjct: 61  LIVAEAFVGKNLVMKRGRPRARGRFGKIMKPFSEITITVRQVEEKA 106


>gi|307294979|ref|ZP_07574821.1| ribosomal protein L22 [Sphingobium chlorophenolicum L-1]
 gi|306879453|gb|EFN10671.1| ribosomal protein L22 [Sphingobium chlorophenolicum L-1]
          Length = 128

 Score =  139 bits (351), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 90/115 (78%)

Query: 8   SKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCS 67
           + RR+ DNEA A+ + +R S QKLNLVA +IRG++V DAL  L FS+K +A +VRK L S
Sbjct: 6   APRRVADNEALAVGTQIRGSAQKLNLVATLIRGRKVEDALNILAFSKKAMAVDVRKVLAS 65

Query: 68  AVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVR 122
           A+ANAENNH+LDVD L+V+EA VGKS  +KRFH RGR +  RI++PFSR+ ++VR
Sbjct: 66  AIANAENNHNLDVDALVVAEASVGKSFTLKRFHARGRGKSTRILKPFSRVRIVVR 120


>gi|58038850|ref|YP_190814.1| 50S ribosomal protein L22 [Gluconobacter oxydans 621H]
 gi|81672732|sp|Q5FTY8|RL22_GLUOX RecName: Full=50S ribosomal protein L22
 gi|58001264|gb|AAW60158.1| LSU ribosomal protein L22P [Gluconobacter oxydans 621H]
          Length = 142

 Score =  138 bits (348), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 69/114 (60%), Positives = 85/114 (74%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           R + D EA A+A  +RVSP+KLNLVAAMIR +    A+A L FSR+RIA +V+KTL SAV
Sbjct: 8   RTLADTEAQAVARNIRVSPRKLNLVAAMIRNQPADKAIAALTFSRRRIAQQVKKTLESAV 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           ANAENNH LDVD+L+V  A VGKS+ MKRFH RGR R  R+ + FS L ++V E
Sbjct: 68  ANAENNHQLDVDQLVVKTAEVGKSIVMKRFHARGRGRSARVEKFFSHLKIVVAE 121


>gi|294085963|ref|YP_003552723.1| 50S ribosomal protein L22 [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292665538|gb|ADE40639.1| ribosomal protein L22 [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 125

 Score =  138 bits (347), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 86/118 (72%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           R + D+EA  +   +RVSPQKLNLVA MIRG  V+ A+A L FSR+RI+ +V K L SA+
Sbjct: 8   RVLADSEAKTVVRNIRVSPQKLNLVATMIRGMDVNKAIATLTFSRRRISNDVEKALQSAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           ANAENNH LDVDRL V EA+VGK + MKRF  R R R  RI++P+S LT+IV E  D+
Sbjct: 68  ANAENNHSLDVDRLYVKEAHVGKGLVMKRFKARARGRGARILKPYSHLTIIVGERGDQ 125


>gi|197104701|ref|YP_002130078.1| 30S ribosomal protein S3 [Phenylobacterium zucineum HLK1]
 gi|226733494|sp|B4R8M2|RL22_PHEZH RecName: Full=50S ribosomal protein L22
 gi|196478121|gb|ACG77649.1| 30S ribosomal protein S3 [Phenylobacterium zucineum HLK1]
          Length = 126

 Score =  137 bits (346), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 68/114 (59%), Positives = 86/114 (75%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           RR+   EA A    LR SP+KLNLVA  IRG +V  AL +LEFS KRIA +VRK L SA+
Sbjct: 8   RRLAGIEAMAKVRTLRTSPRKLNLVAQSIRGLKVQRALNELEFSHKRIARDVRKALYSAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           +NAENNH+LD+D L+V+EA+VGK++ MKRFH R R R  RI +PFS +T++VRE
Sbjct: 68  SNAENNHNLDIDNLVVAEAFVGKNLIMKRFHARARGRASRIEKPFSEITIVVRE 121


>gi|83312224|ref|YP_422488.1| 50S ribosomal protein L22 [Magnetospirillum magneticum AMB-1]
 gi|109893204|sp|Q2W2J6|RL22_MAGMM RecName: Full=50S ribosomal protein L22
 gi|82947065|dbj|BAE51929.1| Ribosomal protein L22 [Magnetospirillum magneticum AMB-1]
          Length = 128

 Score =  137 bits (346), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 72/121 (59%), Positives = 89/121 (73%), Gaps = 1/121 (0%)

Query: 3   GKRSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVR 62
           GK+  + R + D EA A  + +R SP+KLNLVA  IRG +   AL  L FS++RIA EVR
Sbjct: 2   GKKP-ADRVLADTEAKAFLASIRTSPRKLNLVAESIRGLKADVALNALTFSKRRIAVEVR 60

Query: 63  KTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVR 122
           K L SA+ANAENNH LDVDRL V+EA+VGK++ MKR+  R R R+GRI +PFS LTVIVR
Sbjct: 61  KVLQSAIANAENNHQLDVDRLYVAEAFVGKAMVMKRWKARARGRVGRIEKPFSNLTVIVR 120

Query: 123 E 123
           E
Sbjct: 121 E 121


>gi|89070552|ref|ZP_01157841.1| 50S ribosomal protein L22 [Oceanicola granulosus HTCC2516]
 gi|89043859|gb|EAR50057.1| 50S ribosomal protein L22 [Oceanicola granulosus HTCC2516]
          Length = 126

 Score =  137 bits (344), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 72/119 (60%), Positives = 94/119 (78%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           RR+ DNEA A   ML+ SPQKLNLVA +IRGK+V  AL DL FS++R+A +V+K L SA+
Sbjct: 8   RRVADNEAMAKLRMLKTSPQKLNLVAGLIRGKKVEKALTDLTFSKRRVAQDVKKCLQSAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           ANAENNH+LDVD L+V+EAYVGK++ MKR   RGR R GRIV+PF+ +T+ VR+V ++ 
Sbjct: 68  ANAENNHNLDVDELVVAEAYVGKNLTMKRGRPRGRGRFGRIVKPFAEITITVRQVEEQA 126


>gi|332187803|ref|ZP_08389537.1| ribosomal protein L22 [Sphingomonas sp. S17]
 gi|332012153|gb|EGI54224.1| ribosomal protein L22 [Sphingomonas sp. S17]
          Length = 125

 Score =  136 bits (342), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 89/119 (74%)

Query: 5   RSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKT 64
           +  S R++G+ EA ++ + +R S QKLNLVA +IRGK+  DA+  L FS K +A + RK 
Sbjct: 3   KPASPRKVGEKEALSVGTQIRGSAQKLNLVAGLIRGKKAGDAMNILAFSTKAMAVDARKV 62

Query: 65  LCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           L SA+ANAENNH+LDVD L+V+EA VGKS+ MKRF  RGR +  RI++PFSRL ++VRE
Sbjct: 63  LASAIANAENNHNLDVDALVVAEASVGKSITMKRFATRGRGKSTRILKPFSRLRIVVRE 121


>gi|330993851|ref|ZP_08317783.1| 50S ribosomal protein L22 [Gluconacetobacter sp. SXCC-1]
 gi|329759119|gb|EGG75631.1| 50S ribosomal protein L22 [Gluconacetobacter sp. SXCC-1]
          Length = 133

 Score =  136 bits (342), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 65/121 (53%), Positives = 88/121 (72%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           R + + EA A+   +R+SP+KLNLVA +IR K  + A+A L FS++RIA +V+KTL SA+
Sbjct: 8   RTLAETEAQALTRNIRISPRKLNLVAGLIRNKPAAQAIATLTFSKRRIAQQVKKTLESAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEGK 129
           ANAENNH LDVD+L+V+ A VGKS+ M+RFH RGR R  RI + FS LT++V E   E +
Sbjct: 68  ANAENNHQLDVDQLVVARAEVGKSIVMRRFHARGRGRSARIEKFFSHLTIVVAEKKPEAE 127

Query: 130 V 130
            
Sbjct: 128 T 128


>gi|56551417|ref|YP_162256.1| 50S ribosomal protein L22 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241761065|ref|ZP_04759154.1| ribosomal protein L22 [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|260752969|ref|YP_003225862.1| 50S ribosomal protein L22 [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
 gi|81355370|sp|Q5NQ60|RL22_ZYMMO RecName: Full=50S ribosomal protein L22
 gi|56542991|gb|AAV89145.1| ribosomal protein L22 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241374684|gb|EER64145.1| ribosomal protein L22 [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|258552332|gb|ACV75278.1| ribosomal protein L22 [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
          Length = 126

 Score =  135 bits (341), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 68/116 (58%), Positives = 88/116 (75%)

Query: 8   SKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCS 67
           + RR+G+ EA A+A+ +R S  KLNLVA +IRGK+  +AL  L FS+K +A +VRK L S
Sbjct: 6   APRRVGEKEALAVATTVRGSSYKLNLVAGLIRGKKAGEALNILSFSKKAMAKDVRKVLAS 65

Query: 68  AVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           A+ANAENNH+LDVD LIV EA VGKS+ MKRF  R R R  +I++PFSR+ V+VRE
Sbjct: 66  AIANAENNHNLDVDALIVKEASVGKSIVMKRFATRARGRSTQIIKPFSRIRVVVRE 121


>gi|296116727|ref|ZP_06835337.1| 50S ribosomal protein L22 [Gluconacetobacter hansenii ATCC 23769]
 gi|295976939|gb|EFG83707.1| 50S ribosomal protein L22 [Gluconacetobacter hansenii ATCC 23769]
          Length = 135

 Score =  135 bits (339), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 87/120 (72%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           R + + EA A    +R+SP+KLNLVA +IR K  + A+A L FS++RIA +V+KTL SA+
Sbjct: 8   RTLAETEAQATTRNIRISPRKLNLVAGLIRNKPAAQAVATLTFSKRRIAQQVKKTLESAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEGK 129
           ANAENNH LDVD+L+V+ A VGKS+ M+RFH RGR R  RI + FS LT+IV E   E +
Sbjct: 68  ANAENNHQLDVDQLVVARAEVGKSIVMRRFHARGRGRSARIEKFFSHLTIIVAERQPEAE 127


>gi|304321445|ref|YP_003855088.1| 50S ribosomal protein L22 [Parvularcula bermudensis HTCC2503]
 gi|303300347|gb|ADM09946.1| 50S ribosomal protein L22 [Parvularcula bermudensis HTCC2503]
          Length = 126

 Score =  135 bits (339), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 97/122 (79%)

Query: 5   RSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKT 64
           +S + RR+ +++A A   M++ SPQKLNLVA MIRGK+V  AL +LEFSRKR+A +VR+ 
Sbjct: 3   QSKNARRVAEDQAMAKGRMIKTSPQKLNLVAQMIRGKKVQRALDELEFSRKRVALDVRRV 62

Query: 65  LCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV 124
           L SA+ANAE NHDLDVD LIV +A+VGK++ +KR+H R R RIGRI +PFS +T++VREV
Sbjct: 63  LQSAIANAEENHDLDVDSLIVDQAFVGKNMVLKRWHARARGRIGRIRKPFSEITIVVREV 122

Query: 125 SD 126
            +
Sbjct: 123 EE 124


>gi|288957427|ref|YP_003447768.1| large subunit ribosomal protein L22 [Azospirillum sp. B510]
 gi|288909735|dbj|BAI71224.1| large subunit ribosomal protein L22 [Azospirillum sp. B510]
          Length = 131

 Score =  133 bits (335), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 88/119 (73%)

Query: 5   RSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKT 64
           +S +  R+ +NEA A   M+R SP+KLNLVA +IR    S A+A+L FS++RIAGEV+K 
Sbjct: 3   KSANPSRVAENEALARNPMIRTSPRKLNLVAQLIRNMDASRAVAELTFSKRRIAGEVKKV 62

Query: 65  LCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           L +A+ANAENNH LDVDRL VS A VG+++ MKRFH R R R  R+ + FS LT+IVRE
Sbjct: 63  LQAAIANAENNHQLDVDRLYVSSATVGRALVMKRFHARARGRGARVEKLFSNLTIIVRE 121


>gi|16125502|ref|NP_420066.1| 50S ribosomal protein L22 [Caulobacter crescentus CB15]
 gi|221234248|ref|YP_002516684.1| 50S ribosomal protein L22 [Caulobacter crescentus NA1000]
 gi|51316517|sp|Q9A8U8|RL22_CAUCR RecName: Full=50S ribosomal protein L22
 gi|13422584|gb|AAK23234.1| ribosomal protein L22 [Caulobacter crescentus CB15]
 gi|220963420|gb|ACL94776.1| LSU ribosomal protein L22P [Caulobacter crescentus NA1000]
          Length = 126

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 66/118 (55%), Positives = 86/118 (72%)

Query: 9   KRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSA 68
           +RR+   EA      LR SP+KLNLVA  IRG  V  AL +LEFS KRIA +VRK L SA
Sbjct: 7   ERRLPAAEAMCKVRTLRTSPRKLNLVAQSIRGLNVQRALNELEFSHKRIAQDVRKALYSA 66

Query: 69  VANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           ++NAENNH+LD+D L+V+EAYVGK++ MKRF  R R R  R+ +PFS +T++VRE+ +
Sbjct: 67  ISNAENNHNLDIDSLVVAEAYVGKNLIMKRFSPRARGRATRVEKPFSEITIVVRELGE 124


>gi|258542032|ref|YP_003187465.1| 50S ribosomal protein L22 [Acetobacter pasteurianus IFO 3283-01]
 gi|329114213|ref|ZP_08242975.1| 50S ribosomal protein L22 [Acetobacter pomorum DM001]
 gi|256633110|dbj|BAH99085.1| LSU ribosomal protein L22P [Acetobacter pasteurianus IFO 3283-01]
 gi|256636167|dbj|BAI02136.1| LSU ribosomal protein L22P [Acetobacter pasteurianus IFO 3283-03]
 gi|256639222|dbj|BAI05184.1| LSU ribosomal protein L22P [Acetobacter pasteurianus IFO 3283-07]
 gi|256642276|dbj|BAI08231.1| LSU ribosomal protein L22P [Acetobacter pasteurianus IFO 3283-22]
 gi|256645331|dbj|BAI11279.1| LSU ribosomal protein L22P [Acetobacter pasteurianus IFO 3283-26]
 gi|256648386|dbj|BAI14327.1| LSU ribosomal protein L22P [Acetobacter pasteurianus IFO 3283-32]
 gi|256651439|dbj|BAI17373.1| LSU ribosomal protein L22P [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256654430|dbj|BAI20357.1| LSU ribosomal protein L22P [Acetobacter pasteurianus IFO 3283-12]
 gi|326696289|gb|EGE47968.1| 50S ribosomal protein L22 [Acetobacter pomorum DM001]
          Length = 136

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 83/112 (74%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           R + + EA A+   +RVSP+KLNLVA +IR K  S A+A L FS++RIA EV+KTL SA+
Sbjct: 8   RTLAETEAQAVTRNIRVSPRKLNLVAGLIRNKPASQAVATLTFSKRRIAQEVKKTLESAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           ANAENNH LDVD+L+V  A VGKS+ M+RFH RGR R  R+ + FS L ++V
Sbjct: 68  ANAENNHQLDVDQLVVKTAEVGKSIVMRRFHARGRGRSARVEKFFSHLKIVV 119


>gi|296533992|ref|ZP_06896508.1| 50S ribosomal protein L22 [Roseomonas cervicalis ATCC 49957]
 gi|296265658|gb|EFH11767.1| 50S ribosomal protein L22 [Roseomonas cervicalis ATCC 49957]
          Length = 134

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 62/115 (53%), Positives = 84/115 (73%)

Query: 9   KRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSA 68
           +R + + EA A+   +RVSP KLNL A +IRGK+  DA+A L FS++RIA  V+ TL SA
Sbjct: 7   ERTLAETEAKAVTRNIRVSPYKLNLAAGLIRGKKAQDAIAILTFSKRRIAQTVKATLESA 66

Query: 69  VANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           +ANAENNH LDVDRL+VS   VG+++ MKRFH RGR +  R+ + FS L+++V E
Sbjct: 67  IANAENNHQLDVDRLVVSRVEVGRAIVMKRFHARGRGKAARVEKWFSHLSIVVAE 121


>gi|162149169|ref|YP_001603630.1| 50S ribosomal protein L22 [Gluconacetobacter diazotrophicus PAl 5]
 gi|209545087|ref|YP_002277316.1| 50S ribosomal protein L22 [Gluconacetobacter diazotrophicus PAl 5]
 gi|189041953|sp|A9H3P8|RL22_GLUDA RecName: Full=50S ribosomal protein L22
 gi|161787746|emb|CAP57342.1| 50S ribosomal protein L22 [Gluconacetobacter diazotrophicus PAl 5]
 gi|209532764|gb|ACI52701.1| ribosomal protein L22 [Gluconacetobacter diazotrophicus PAl 5]
          Length = 134

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 67/122 (54%), Positives = 87/122 (71%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           R + + EA A+   +RVSP+KLNLVA +IR K  S A+A L FS++RIA +VRKTL SA+
Sbjct: 8   RTLAETEAQALTRNIRVSPRKLNLVAGLIRNKPASQAVAILTFSKRRIAQDVRKTLESAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEGK 129
           ANAENNH LDVD+L+V  A VGKS+ M+RFH RGR R  RI + FS L ++V E + E +
Sbjct: 68  ANAENNHQLDVDQLVVVRAEVGKSIVMRRFHARGRGRSSRIEKFFSHLKIVVAERAAEAE 127

Query: 130 VV 131
             
Sbjct: 128 TT 129


>gi|167645583|ref|YP_001683246.1| 50S ribosomal protein L22 [Caulobacter sp. K31]
 gi|167348013|gb|ABZ70748.1| ribosomal protein L22 [Caulobacter sp. K31]
          Length = 126

 Score =  131 bits (329), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 85/117 (72%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           RR+  NEA      LR S +KLNLVA  IRG  V  AL +LEFS KRIA +VRK L SA+
Sbjct: 8   RRLPANEAMCKVRTLRTSARKLNLVAQSIRGLNVQRALNELEFSHKRIAQDVRKALYSAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           +NAENNH+LD+D L+V+EAYVGK++ MKRF  R R R  R+ +PFS +T++VRE+ +
Sbjct: 68  SNAENNHNLDIDSLVVAEAYVGKNLVMKRFSPRARGRATRVEKPFSEITIVVRELGE 124


>gi|23014083|ref|ZP_00053920.1| COG0091: Ribosomal protein L22 [Magnetospirillum magnetotacticum
           MS-1]
          Length = 128

 Score =  131 bits (329), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 87/121 (71%), Gaps = 1/121 (0%)

Query: 3   GKRSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVR 62
           GK+  + R + + EA A  + +R SP+KLNLVA  IRG +   AL  L FS++RIA  VR
Sbjct: 2   GKKP-ADRVLSETEAKAFLATIRTSPRKLNLVAESIRGLKADVALNALTFSKRRIAVVVR 60

Query: 63  KTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVR 122
             L SA+ANAENNH LDVDRL V+EA+VGK++ MKR+  R R R+GRI +PFS LTVIVR
Sbjct: 61  SVLQSAIANAENNHQLDVDRLYVAEAFVGKAMVMKRWKARARGRVGRIEKPFSNLTVIVR 120

Query: 123 E 123
           E
Sbjct: 121 E 121


>gi|295688911|ref|YP_003592604.1| 50S 50S ribosomal protein L22 [Caulobacter segnis ATCC 21756]
 gi|295430814|gb|ADG09986.1| ribosomal protein L22 [Caulobacter segnis ATCC 21756]
          Length = 126

 Score =  130 bits (328), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 85/117 (72%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           RR+   EA A    LR S +KLNLVA  IRG  V  AL +LEFS KRIA +VRK L SA+
Sbjct: 8   RRLDGAEAMAKVRTLRTSARKLNLVAQSIRGLNVQRALNELEFSHKRIAQDVRKALYSAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           +NAENNH+LD+D L+V+EAYVGK++ MKRF  R R R  R+ +PFS +T++VRE+ +
Sbjct: 68  SNAENNHNLDIDSLVVAEAYVGKNLIMKRFSPRARGRATRVEKPFSEITIVVRELGE 124


>gi|148260934|ref|YP_001235061.1| 50S ribosomal protein L22 [Acidiphilium cryptum JF-5]
 gi|326404332|ref|YP_004284414.1| 50S ribosomal protein L22 [Acidiphilium multivorum AIU301]
 gi|215274807|sp|A5FZW0|RL22_ACICJ RecName: Full=50S ribosomal protein L22
 gi|146402615|gb|ABQ31142.1| LSU ribosomal protein L22P [Acidiphilium cryptum JF-5]
 gi|325051194|dbj|BAJ81532.1| 50S ribosomal protein L22 [Acidiphilium multivorum AIU301]
          Length = 153

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 84/114 (73%)

Query: 10  RRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           R + D+EA A+   LR SP+KLN+VAA IR K    A+ADL FS++RIA +V+K L SA+
Sbjct: 8   RTLADSEAEAVLRNLRCSPRKLNVVAASIRNKPAGKAVADLTFSKRRIAKDVKKALESAI 67

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           ANAENNH LDVDRL+V+ A VG+S+ M+RFH RGR R  R+ + FS L ++V E
Sbjct: 68  ANAENNHQLDVDRLVVTTADVGRSIVMRRFHARGRGRAARVEKWFSHLRIVVAE 121


>gi|144900889|emb|CAM77753.1| 50S ribosomal protein L22 [Magnetospirillum gryphiswaldense MSR-1]
          Length = 128

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 91/121 (75%), Gaps = 1/121 (0%)

Query: 3   GKRSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVR 62
           GK+  ++R + D EA A +S +R SP+KLNLVAA IRG +   AL  L FS++RIAG V+
Sbjct: 2   GKKP-AERVLADIEAKAFSSSIRTSPRKLNLVAASIRGLKAETALHQLTFSKRRIAGVVK 60

Query: 63  KTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVR 122
             L SA+ANAENNH LDVDRL V+EAYVGK++ MKR+  R R R+GRI +PFS LTVIVR
Sbjct: 61  VVLQSAIANAENNHQLDVDRLYVAEAYVGKAMVMKRWRARARGRVGRIEKPFSNLTVIVR 120

Query: 123 E 123
           E
Sbjct: 121 E 121


>gi|262277099|ref|ZP_06054892.1| ribosomal protein L22 [alpha proteobacterium HIMB114]
 gi|262224202|gb|EEY74661.1| ribosomal protein L22 [alpha proteobacterium HIMB114]
          Length = 129

 Score =  115 bits (289), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 59/112 (52%), Positives = 78/112 (69%), Gaps = 1/112 (0%)

Query: 19  AIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDL 78
           A+   LR SP+K+N +   IRGK+   AL +L+FS KR++ E+ KT+ SAVANAENN+ L
Sbjct: 16  AVYRNLRSSPRKINDILRSIRGKKADIALRNLQFSEKRVSKEISKTIKSAVANAENNNQL 75

Query: 79  DVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD-EGK 129
           D+D L + EAYVGK + MKR+  R R R G I +PFS LT+IV E  + EGK
Sbjct: 76  DIDNLFIKEAYVGKGMVMKRYRPRARGRAGEIKKPFSNLTIIVSEKKETEGK 127


>gi|254294435|ref|YP_003060458.1| 50S ribosomal protein L22 [Hirschia baltica ATCC 49814]
 gi|254042966|gb|ACT59761.1| ribosomal protein L22 [Hirschia baltica ATCC 49814]
          Length = 132

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 62/111 (55%), Positives = 84/111 (75%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
           NE+ A+  MLRVSPQKLNL+A  IRG  V  A A+L FSRKR + EV K L SA+ANAEN
Sbjct: 13  NESRAVLRMLRVSPQKLNLIAQSIRGMSVEKAQAELTFSRKRHSNEVLKLLNSAIANAEN 72

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVS 125
           NH LD+D L+V++A+VGK++ MKR   R R R  RI++PF+++T+++R+ S
Sbjct: 73  NHGLDIDSLVVAQAHVGKNLVMKRIRARARGRAARILKPFAQMTIVLRDAS 123


>gi|15604500|ref|NP_221018.1| 50S ribosomal protein L22 [Rickettsia prowazekii str. Madrid E]
 gi|6225981|sp|Q9ZCR0|RL22_RICPR RecName: Full=50S ribosomal protein L22
 gi|3861194|emb|CAA15094.1| 50S RIBOSOMAL PROTEIN L22 (rplV) [Rickettsia prowazekii]
 gi|292572282|gb|ADE30197.1| 50S ribosomal protein L22 [Rickettsia prowazekii Rp22]
          Length = 119

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 76/112 (67%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
           N A A A  +RVSP+KLNLVA+ IR  +VS+AL  L FS KRIA  V+  L SA+ANAEN
Sbjct: 7   NFATAKAKSIRVSPRKLNLVASFIRNMKVSEALVQLTFSPKRIAKIVKDCLQSAIANAEN 66

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           N  LD+DRLI+++A VGKSV MKR   R + R  RI + FS L + V E  D
Sbjct: 67  NLGLDIDRLIITKATVGKSVVMKRIMPRAKGRATRINKFFSNLYITVTEKED 118


>gi|114799750|ref|YP_761524.1| 50S ribosomal protein L22 [Hyphomonas neptunium ATCC 15444]
 gi|114739924|gb|ABI78049.1| ribosomal protein L22 [Hyphomonas neptunium ATCC 15444]
          Length = 129

 Score =  110 bits (275), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 83/115 (72%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
           +E+ A+  M R SPQKLNL+A  IRG  +  AL +++FS KR A +V K L SAVANAEN
Sbjct: 13  HESRAVLRMYRSSPQKLNLLAQQIRGMPIQRALNEMKFSPKRPAKDVYKLLQSAVANAEN 72

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEGK 129
           NH LD+D L+V+EA+VGK++ MKR   R R R  RIV+PFS+LT+++R+ S   +
Sbjct: 73  NHGLDIDSLVVAEAHVGKNLVMKRIRARARGRAARIVKPFSQLTIVLRDTSQTAE 127


>gi|37912987|gb|AAR05316.1| ribosomal protein L22 [uncultured marine alpha proteobacterium
           HOT2C01]
          Length = 129

 Score =  110 bits (275), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 58/110 (52%), Positives = 74/110 (67%)

Query: 14  DNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAE 73
           DNEA AI   +RVSP K N V  MIRGK+ S+AL  L+FS + IA  + K L SA+ANAE
Sbjct: 8   DNEAYAIQRNMRVSPSKANAVLEMIRGKKASEALNLLKFSSRGIAKNISKVLNSAIANAE 67

Query: 74  NNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           NNH LD+D L V+EAY GK + MKR+  R + R GRI +  + +T+ V E
Sbjct: 68  NNHQLDIDILKVTEAYCGKGMVMKRWRARAKGRPGRINKFLTNITIKVSE 117


>gi|51473834|ref|YP_067591.1| 50S ribosomal protein L22 [Rickettsia typhi str. Wilmington]
 gi|81692279|sp|Q68W83|RL22_RICTY RecName: Full=50S ribosomal protein L22
 gi|51460146|gb|AAU04109.1| 50S ribosomal protein L22 [Rickettsia typhi str. Wilmington]
          Length = 119

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 76/112 (67%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
           N A A A  +RVSP+KLNLVA+ IR  +VS+AL  L FS KRIA  V+  L SAVANAEN
Sbjct: 7   NFATAKAKSIRVSPRKLNLVASFIRNMKVSEALIQLTFSPKRIAKIVKDCLRSAVANAEN 66

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           N  LD+DRLI+++A VGKSV MKR   R + R  RI + FS L + V E  D
Sbjct: 67  NLGLDIDRLIITKATVGKSVVMKRIMPRAKGRATRINKFFSNLDITVTEKED 118


>gi|157804030|ref|YP_001492579.1| 50S ribosomal protein L22 [Rickettsia canadensis str. McKiel]
 gi|166221989|sp|A8EZL1|RL22_RICCK RecName: Full=50S ribosomal protein L22
 gi|157785293|gb|ABV73794.1| 50S ribosomal protein L22 [Rickettsia canadensis str. McKiel]
          Length = 119

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 76/112 (67%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
           N A A A  +RVSP+KLNLVAA IR  +VS+AL  L FS KRIA  V+  L SA+ANAEN
Sbjct: 7   NFATAKAKSIRVSPRKLNLVAAFIRNMKVSEALVQLTFSPKRIAKVVKTCLQSAIANAEN 66

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           N  LD+DRL+V++A VGK++ MKR   R + R  RI + FS L + V E  D
Sbjct: 67  NLGLDIDRLVVTKATVGKALVMKRVMPRAKGRATRINKFFSNLYITVTEKED 118


>gi|239948314|ref|ZP_04700067.1| ribosomal protein L22 [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239922590|gb|EER22614.1| ribosomal protein L22 [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 119

 Score =  109 bits (272), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 76/112 (67%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
           N A A A  +RVSP+KLNLVAA IR  +VS+AL  L FS KRIA  V+  L SAVANAEN
Sbjct: 7   NFATAKAKSIRVSPRKLNLVAAFIRNMKVSEALVQLTFSPKRIAKVVKDCLQSAVANAEN 66

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           N  LD+DRL++++A VGK++ MKR   R + R  RI + FS L + V E  D
Sbjct: 67  NLGLDIDRLVITKATVGKALVMKRVMPRAKGRATRINKFFSNLYITVTEKED 118


>gi|157826058|ref|YP_001493778.1| 50S ribosomal protein L22 [Rickettsia akari str. Hartford]
 gi|166221987|sp|A8GPE5|RL22_RICAH RecName: Full=50S ribosomal protein L22
 gi|157800016|gb|ABV75270.1| 50S ribosomal protein L22 [Rickettsia akari str. Hartford]
          Length = 119

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 76/112 (67%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
           N A A A  +RVSP+KLNLVAA IR  +VS+AL  L FS KRIA  V+  L SAVANAEN
Sbjct: 7   NFATAKAKSVRVSPRKLNLVAAFIRNMKVSEALVQLTFSSKRIAKVVKGCLQSAVANAEN 66

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           N  LD+DRL++++A VGK++ MKR   R + R  RI + FS L + V E  D
Sbjct: 67  NLGLDIDRLVITKATVGKALVMKRVMPRAKGRATRINKFFSNLYITVTEKED 118


>gi|67458675|ref|YP_246299.1| 50S ribosomal protein L22 [Rickettsia felis URRWXCal2]
 gi|75536860|sp|Q4UMS4|RL22_RICFE RecName: Full=50S ribosomal protein L22
 gi|67004208|gb|AAY61134.1| 50S ribosomal protein L22 [Rickettsia felis URRWXCal2]
          Length = 119

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 60/112 (53%), Positives = 76/112 (67%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
           N A A A  +RVSP+KLNLVAA IR  +VS+AL  L FS K+IA  V+  L SAVANAEN
Sbjct: 7   NFATAKAKSIRVSPRKLNLVAAFIRNMKVSEALVQLTFSPKKIAKVVKDCLQSAVANAEN 66

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           N  LD+DRL++++A VGK++ MKR   R + R  RI + FS L + V E  D
Sbjct: 67  NLGLDIDRLVITKATVGKALVMKRVMPRAKGRATRINKFFSNLYITVTEKED 118


>gi|91205872|ref|YP_538227.1| 50S ribosomal protein L22 [Rickettsia bellii RML369-C]
 gi|157826769|ref|YP_001495833.1| 50S ribosomal protein L22 [Rickettsia bellii OSU 85-389]
 gi|109893233|sp|Q1RHM6|RL22_RICBR RecName: Full=50S ribosomal protein L22
 gi|166221988|sp|A8GVB9|RL22_RICB8 RecName: Full=50S ribosomal protein L22
 gi|91069416|gb|ABE05138.1| 50S ribosomal protein L22 [Rickettsia bellii RML369-C]
 gi|157802073|gb|ABV78796.1| 50S ribosomal protein L22 [Rickettsia bellii OSU 85-389]
          Length = 119

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 60/112 (53%), Positives = 75/112 (66%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
           N A A A  +RVSP+KLNLVAA IR  +VS+AL  L FS KRI+  V+  L SAVANAEN
Sbjct: 7   NFATAKAKSIRVSPRKLNLVAAFIRNMKVSEALVQLTFSPKRISKVVKACLQSAVANAEN 66

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           N  LD+DRL+++ A VGK++ MKR   R + R  RI + FS L + V E  D
Sbjct: 67  NLGLDIDRLVITNATVGKALVMKRVMPRAKGRATRINKFFSNLYITVTEKED 118


>gi|226531161|ref|NP_001142268.1| hypothetical protein LOC100274437 [Zea mays]
 gi|194707934|gb|ACF88051.1| unknown [Zea mays]
          Length = 288

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 58/112 (51%), Positives = 77/112 (68%), Gaps = 4/112 (3%)

Query: 18  NAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHD 77
            AI   ++ SP+K+NLVA ++RG RV DAL  L+ + KR A  V + + SA ANA +NH 
Sbjct: 132 QAIKKDIKQSPKKVNLVAKLVRGMRVEDALLQLQVTVKRAAKTVYQVIHSARANASHNHG 191

Query: 78  LDVDRLIVSEAYVGKSVFMKR--FHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           LD D+LIV EA+VGK +F+KR  +H RGR   G +VRP  RLTV+VRE + E
Sbjct: 192 LDPDKLIVEEAFVGKGLFLKRVSYHARGRS--GIMVRPRCRLTVVVREATAE 241


>gi|15892924|ref|NP_360638.1| 50S ribosomal protein L22 [Rickettsia conorii str. Malish 7]
 gi|51316893|sp|Q92GX1|RL22_RICCN RecName: Full=50S ribosomal protein L22
 gi|15620116|gb|AAL03539.1| 50S ribosomal protein L22 [Rickettsia conorii str. Malish 7]
          Length = 119

 Score =  105 bits (263), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 75/112 (66%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
           N A A A  +RVS +KLNLVAA IR  +VS+AL  L FS KRIA  V+  L SAVANAEN
Sbjct: 7   NFATAQAKSIRVSSRKLNLVAAFIRNMKVSEALVQLTFSPKRIAKVVKDCLQSAVANAEN 66

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           N  LD+DRL+V++A VGK++ MKR   R + R  RI + FS L + V E  D
Sbjct: 67  NLGLDIDRLVVTKATVGKALVMKRVMPRAKGRATRINKFFSNLYITVTEKED 118


>gi|71083799|ref|YP_266519.1| 50S ribosomal protein L22 [Candidatus Pelagibacter ubique HTCC1062]
 gi|91763165|ref|ZP_01265129.1| 50S ribosomal protein L22 [Candidatus Pelagibacter ubique HTCC1002]
 gi|123734365|sp|Q4FLM3|RL22_PELUB RecName: Full=50S ribosomal protein L22
 gi|71062912|gb|AAZ21915.1| 50S ribosomal protein L22 [Candidatus Pelagibacter ubique HTCC1062]
 gi|91717578|gb|EAS84229.1| 50S ribosomal protein L22 [Candidatus Pelagibacter ubique HTCC1002]
          Length = 132

 Score =  105 bits (263), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 52/105 (49%), Positives = 74/105 (70%)

Query: 19  AIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDL 78
           ++ + +R S +KLN +   I GK+V  A+ +L+FS KRI  E+RKT+ SAVANAENN+  
Sbjct: 17  SVNNNIRSSVRKLNPILKAIVGKKVDVAIRELQFSAKRITREIRKTVSSAVANAENNNQY 76

Query: 79  DVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           D+D+LIV EAY GK V MKRF  R + R   I++P+S +T+I+ E
Sbjct: 77  DIDKLIVKEAYCGKKVVMKRFRPRAKGRAAPILKPYSTITIILSE 121


>gi|254456351|ref|ZP_05069780.1| ribosomal protein L22 [Candidatus Pelagibacter sp. HTCC7211]
 gi|207083353|gb|EDZ60779.1| ribosomal protein L22 [Candidatus Pelagibacter sp. HTCC7211]
          Length = 132

 Score =  105 bits (263), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 74/106 (69%)

Query: 19  AIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDL 78
           ++ + +R S +KLN +   I GK+V  A+ DL+FS KRI+ ++RKT+ SAVANAENN   
Sbjct: 17  SVNNSIRTSVRKLNPILKSIVGKKVDVAIRDLQFSAKRISKDIRKTISSAVANAENNFQY 76

Query: 79  DVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV 124
           D+D L+V EAY GK + MKRF  R + R   I++P+S +T+I+ EV
Sbjct: 77  DIDNLVVKEAYCGKKIVMKRFRPRAKGRAAPILKPWSTVTIILSEV 122


>gi|224138266|ref|XP_002322771.1| predicted protein [Populus trichocarpa]
 gi|222867401|gb|EEF04532.1| predicted protein [Populus trichocarpa]
          Length = 193

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 58/124 (46%), Positives = 81/124 (65%), Gaps = 4/124 (3%)

Query: 4   KRSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRK 63
           +++VSK      +  A+   +++SP+KLNLVAA++RG RV DAL  L+ + KR A  V +
Sbjct: 35  QKAVSK----PEKVQAVLKGIKMSPKKLNLVAALVRGMRVEDALLQLQVTVKRAAKTVFQ 90

Query: 64  TLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            + SA ANA +NH LD DRL+V+EA+VGK  F KR     + + G   RP SRLTV+VRE
Sbjct: 91  VIHSARANATHNHGLDPDRLLVAEAFVGKGFFKKRISYHAKGKCGIRERPESRLTVVVRE 150

Query: 124 VSDE 127
            + E
Sbjct: 151 TTPE 154


>gi|157964801|ref|YP_001499625.1| 50S ribosomal protein L22 [Rickettsia massiliae MTU5]
 gi|215274865|sp|A8F2E2|RL22_RICM5 RecName: Full=50S ribosomal protein L22
 gi|157844577|gb|ABV85078.1| 50S ribosomal protein L22 [Rickettsia massiliae MTU5]
          Length = 121

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 60/112 (53%), Positives = 75/112 (66%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
           N A A A  +RVS +KLNLVAA IR  +VS+AL  L FS KRIA  V+  L SAVANAEN
Sbjct: 9   NFATAQAKSIRVSSRKLNLVAAFIRNMKVSEALVQLTFSPKRIAKVVKDCLQSAVANAEN 68

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           N  LD+DRL++++A VGK++ MKR   R + R  RI + FS L + V E  D
Sbjct: 69  NLGLDIDRLVITKATVGKALVMKRVMPRAKGRATRINKFFSNLYITVTEKED 120


>gi|238650967|ref|YP_002916823.1| 50S ribosomal protein L22 [Rickettsia peacockii str. Rustic]
 gi|259646257|sp|C4K2H4|RL22_RICPU RecName: Full=50S ribosomal protein L22
 gi|238625065|gb|ACR47771.1| 50S ribosomal protein L22 [Rickettsia peacockii str. Rustic]
          Length = 119

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 60/112 (53%), Positives = 75/112 (66%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
           N A A A  +RVS +KLNLVAA IR  +VS+AL  L FS KRIA  V+  L SAVANAEN
Sbjct: 7   NFATAQAKSIRVSSRKLNLVAAFIRNMKVSEALVQLTFSPKRIAKVVKDCLQSAVANAEN 66

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           N  LD+DRL++++A VGK++ MKR   R + R  RI + FS L + V E  D
Sbjct: 67  NLGLDIDRLVITKAIVGKALVMKRVMPRAKGRATRINKFFSNLYITVTEKED 118


>gi|34581374|ref|ZP_00142854.1| 50S ribosomal protein L22 [Rickettsia sibirica 246]
 gi|157828855|ref|YP_001495097.1| 50S ribosomal protein L22 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165933582|ref|YP_001650371.1| 50S ribosomal protein L22 [Rickettsia rickettsii str. Iowa]
 gi|229587004|ref|YP_002845505.1| 50S ribosomal protein L22 [Rickettsia africae ESF-5]
 gi|166221990|sp|A8GT64|RL22_RICRS RecName: Full=50S ribosomal protein L22
 gi|189041961|sp|B0BUQ5|RL22_RICRO RecName: Full=50S ribosomal protein L22
 gi|259646256|sp|C3PPA2|RL22_RICAE RecName: Full=50S ribosomal protein L22
 gi|28262759|gb|EAA26263.1| 50S ribosomal protein L22 [Rickettsia sibirica 246]
 gi|157801336|gb|ABV76589.1| 50S ribosomal protein L22 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165908669|gb|ABY72965.1| LSU ribosomal protein L22P [Rickettsia rickettsii str. Iowa]
 gi|228022054|gb|ACP53762.1| 50S ribosomal protein L22 [Rickettsia africae ESF-5]
          Length = 119

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 60/112 (53%), Positives = 75/112 (66%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
           N A A A  +RVS +KLNLVAA IR  +VS+AL  L FS KRIA  V+  L SAVANAEN
Sbjct: 7   NFATAQAKSIRVSSRKLNLVAAFIRNMKVSEALVQLTFSPKRIAKVVKDCLQSAVANAEN 66

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           N  LD+DRL++++A VGK++ MKR   R + R  RI + FS L + V E  D
Sbjct: 67  NLGLDIDRLVITKATVGKALVMKRVMPRAKGRATRINKFFSNLYITVTEKED 118


>gi|242043384|ref|XP_002459563.1| hypothetical protein SORBIDRAFT_02g006656 [Sorghum bicolor]
 gi|241922940|gb|EER96084.1| hypothetical protein SORBIDRAFT_02g006656 [Sorghum bicolor]
          Length = 200

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 74/110 (67%)

Query: 18  NAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHD 77
            AI   ++ SP+K+NLVA ++RG RV DAL  L+ + KR A  V + + SA ANA +NH 
Sbjct: 44  QAIKKDIKQSPKKVNLVAKLVRGMRVEDALLQLQVTVKRAAKTVYQVIHSARANAAHNHG 103

Query: 78  LDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           LD D+LIV EA+VGK +++KR     + R G +VRP  RLTV+VRE + E
Sbjct: 104 LDPDKLIVEEAFVGKGLYLKRLSYHAKGRCGIMVRPRCRLTVVVREATAE 153


>gi|115438596|ref|NP_001043578.1| Os01g0616500 [Oryza sativa Japonica Group]
 gi|54290412|dbj|BAD61282.1| 50S ribosomal protein L22-like [Oryza sativa Japonica Group]
 gi|113533109|dbj|BAF05492.1| Os01g0616500 [Oryza sativa Japonica Group]
 gi|125526856|gb|EAY74970.1| hypothetical protein OsI_02868 [Oryza sativa Indica Group]
 gi|125571179|gb|EAZ12694.1| hypothetical protein OsJ_02612 [Oryza sativa Japonica Group]
 gi|215706459|dbj|BAG93315.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 278

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 74/110 (67%)

Query: 18  NAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHD 77
            AI   ++ SP+K+NLVA ++RG RV DAL  L+ + KR A  V + + SA ANA +NH 
Sbjct: 122 QAIKKDIKQSPKKVNLVAKLVRGMRVEDALLQLQVTVKRAAKTVYQVIHSARANAAHNHG 181

Query: 78  LDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           LD D+LIV EA+VGK +++KR     + R G +VRP  RLTV+VRE + E
Sbjct: 182 LDPDKLIVEEAFVGKGLYLKRLSYHAKGRCGVMVRPRCRLTVVVREATAE 231


>gi|148284209|ref|YP_001248299.1| 50S ribosomal protein L22 [Orientia tsutsugamushi str. Boryong]
 gi|166221977|sp|A5CCK7|RL22_ORITB RecName: Full=50S ribosomal protein L22
 gi|146739648|emb|CAM79437.1| 50S ribosomal protein L22 [Orientia tsutsugamushi str. Boryong]
          Length = 116

 Score =  103 bits (257), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 73/108 (67%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A   M+++SP+KLNL+  +IR  +VSDA+  L+FS+KR A +V+K L SA+ANAENN 
Sbjct: 8   AKATLRMIKISPRKLNLITGLIRNLKVSDAIMQLKFSKKRAAVDVKKCLQSAIANAENND 67

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV 124
            LD+D L+V EA VGK   MKR   R R +  RI + FS L + V E+
Sbjct: 68  GLDIDNLVVLEAIVGKGSVMKRLVPRARGKAFRIKKFFSNLYITVSEI 115


>gi|116790006|gb|ABK25468.1| unknown [Picea sitchensis]
          Length = 361

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 77/112 (68%), Gaps = 4/112 (3%)

Query: 18  NAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHD 77
            A+   ++ SP+K+NLVAA++RG RV DAL  ++ + KR A  V K + SA ANA +NH 
Sbjct: 202 QAVLKKIKQSPKKVNLVAALVRGMRVEDALLQMQVTVKRAAKTVYKVIHSARANAVHNHG 261

Query: 78  LDVDRLIVSEAYVGKSVFMKR--FHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           LD DRLI+++A+VGK +F K   +H +GR   G  VRP  RLTVIVRE++ E
Sbjct: 262 LDGDRLIIAQAFVGKGLFRKTISYHAKGRS--GIRVRPQCRLTVIVRELTPE 311


>gi|18417177|ref|NP_567805.1| ribosomal protein L22 family  protein [Arabidopsis thaliana]
 gi|21553938|gb|AAM63019.1| unknown [Arabidopsis thaliana]
 gi|107738381|gb|ABF83687.1| At4g28360 [Arabidopsis thaliana]
 gi|110735706|dbj|BAE99833.1| hypothetical protein [Arabidopsis thaliana]
          Length = 271

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 81/128 (63%), Gaps = 4/128 (3%)

Query: 2   SGKRSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEV 61
           SGK    K      +  A+   ++ SP+K+NLVAA++RG RV DAL  L+ + KR A  V
Sbjct: 92  SGKEEEQKIIPKRQKVQAVLKSIKQSPKKVNLVAALVRGMRVEDALIQLQVTVKRAAQTV 151

Query: 62  RKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKR--FHCRGRQRIGRIVRPFSRLTV 119
            + + +A ANA +NH LD DRL+V+EA+VGK +F K+  +H +GR   G I  P  RLTV
Sbjct: 152 YRVIHAARANATHNHGLDPDRLLVAEAFVGKGLFGKKVAYHAKGRS--GIISIPRCRLTV 209

Query: 120 IVREVSDE 127
           IVRE + E
Sbjct: 210 IVRETTPE 217


>gi|189183956|ref|YP_001937741.1| 50S ribosomal protein L22 [Orientia tsutsugamushi str. Ikeda]
 gi|226733492|sp|B3CT10|RL22_ORITI RecName: Full=50S ribosomal protein L22
 gi|189180727|dbj|BAG40507.1| 50S ribosomal protein L22 [Orientia tsutsugamushi str. Ikeda]
          Length = 116

 Score =  102 bits (253), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 73/108 (67%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A   M+++SP+KLNL+  +IR  +VSDA+  L+FS+KR A +V+K L SA+ANAENN 
Sbjct: 8   AKATLRMIKISPRKLNLITGLIRNLKVSDAIMQLKFSKKRAAVDVKKCLQSAIANAENND 67

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV 124
            LD+D L+V +A VGK   MKR   R R +  RI + FS L + V E+
Sbjct: 68  GLDIDNLVVLKAIVGKGSVMKRLVPRARGKAFRIKKFFSNLYITVSEI 115


>gi|225439305|ref|XP_002267832.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|296089316|emb|CBI39088.3| unnamed protein product [Vitis vinifera]
          Length = 271

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 52/114 (45%), Positives = 75/114 (65%)

Query: 14  DNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAE 73
            ++  A+   ++ SP+K+NLVA ++RG RV DAL  L+ + KR +  V + + SA ANA 
Sbjct: 109 PSKVQAVLKGIKQSPKKVNLVAELVRGMRVEDALLQLQLTVKRASKTVYQVIHSARANAT 168

Query: 74  NNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           +NH LD DRL+V+EA+VGK  F KR     + + G  VRP  RLTV+VRE++ E
Sbjct: 169 HNHGLDPDRLLVAEAFVGKGFFKKRVSYHAKGKCGIKVRPECRLTVVVREMTPE 222


>gi|255566195|ref|XP_002524085.1| 50S ribosomal protein L22, putative [Ricinus communis]
 gi|223536653|gb|EEF38295.1| 50S ribosomal protein L22, putative [Ricinus communis]
          Length = 278

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 78/126 (61%)

Query: 2   SGKRSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEV 61
           SGK    K     ++  A+   ++ SP+K+NLVA ++RG RV DAL  L+ + KR A  V
Sbjct: 101 SGKTEEKKAICKQSKVQAVLKNIKQSPKKVNLVAELVRGMRVEDALLQLQVTIKRAAKTV 160

Query: 62  RKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
            + + SA ANA +NH LD DRL+V+EA+VGK  F KR     + R G  VR   RLTV+V
Sbjct: 161 YQVIHSARANATHNHGLDPDRLLVAEAFVGKGNFKKRISYHAKGRAGVKVRAECRLTVVV 220

Query: 122 REVSDE 127
           RE++ E
Sbjct: 221 REITPE 226


>gi|297847626|ref|XP_002891694.1| ribosomal protein L22 family protein [Arabidopsis lyrata subsp.
           lyrata]
 gi|297337536|gb|EFH67953.1| ribosomal protein L22 family protein [Arabidopsis lyrata subsp.
           lyrata]
          Length = 270

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 81/128 (63%), Gaps = 4/128 (3%)

Query: 2   SGKRSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEV 61
           SGK    K      +  A+   ++ SP+K+NLVAA++RG RV DAL  L+ + KR +  V
Sbjct: 92  SGKEEEQKIIPKRQKVQAVLKSIKQSPKKVNLVAALVRGMRVEDALMQLQVTVKRASQTV 151

Query: 62  RKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKR--FHCRGRQRIGRIVRPFSRLTV 119
            + + +A ANA +NH LD DRL+V+EA+VGK +F K+  +H +GR   G I  P  RLTV
Sbjct: 152 YRVIHAARANATHNHGLDPDRLLVAEAFVGKGLFGKKVAYHAKGRS--GIISIPRCRLTV 209

Query: 120 IVREVSDE 127
           IVRE + E
Sbjct: 210 IVRETTPE 217


>gi|330814194|ref|YP_004358433.1| LSU ribosomal protein L22p (L17e) [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327487289|gb|AEA81694.1| LSU ribosomal protein L22p (L17e) [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 128

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 75/112 (66%)

Query: 19  AIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDL 78
           A+ + L+   +K+N +   IRG++V   L DL+F+ KR++ E+ KT+ SAVANAENN+ L
Sbjct: 13  AVFNNLKSGTRKINEILQSIRGRKVDLVLRDLQFNNKRVSKEIIKTIKSAVANAENNNQL 72

Query: 79  DVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEGKV 130
           D+D LI+ EAYVGK + +KRF  R + R   I + FS LT++V E  +  +V
Sbjct: 73  DIDTLIIKEAYVGKGITLKRFRPRAKGRAASIKKHFSNLTIVVSEKKEAAQV 124


>gi|7485901|pir||T04605 hypothetical protein F20O9.30 - Arabidopsis thaliana
          Length = 508

 Score =  100 bits (250), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 57/126 (45%), Positives = 78/126 (61%)

Query: 2   SGKRSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEV 61
           SGK    K      +  A+   ++ SP+K+NLVAA++RG RV DAL  L+ + KR A  V
Sbjct: 243 SGKEEEQKIIPKRQKVQAVLKSIKQSPKKVNLVAALVRGMRVEDALIQLQVTVKRAAQTV 302

Query: 62  RKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
            + + +A ANA +NH LD DRL+V+EA+VGK +F K+     + R G I  P  RLTVIV
Sbjct: 303 YRVIHAARANATHNHGLDPDRLLVAEAFVGKGLFGKKVAYHAKGRSGIISIPRCRLTVIV 362

Query: 122 REVSDE 127
           RE + E
Sbjct: 363 RETTPE 368


>gi|326498105|dbj|BAJ94915.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gi|326503750|dbj|BAJ86381.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 276

 Score =  100 bits (248), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 72/110 (65%)

Query: 18  NAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHD 77
            AI   ++ SP+K+NLVA ++RG RV DAL  L+ + KR A  + + + SA ANA +NH 
Sbjct: 118 QAIKKDIKQSPKKVNLVAKLVRGMRVEDALLQLQVTVKRAAKTLYQVIHSARANAAHNHG 177

Query: 78  LDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           LD D+LIV EA+VGK +++KR     + R G   RP  RLTV+VRE + E
Sbjct: 178 LDADKLIVEEAFVGKGIYLKRLAYHAKGRCGVRERPRCRLTVVVREATAE 227


>gi|117924160|ref|YP_864777.1| 50S ribosomal protein L22P [Magnetococcus sp. MC-1]
 gi|215274829|sp|A0L5X8|RL22_MAGSM RecName: Full=50S ribosomal protein L22
 gi|117607916|gb|ABK43371.1| LSU ribosomal protein L22P [Magnetococcus sp. MC-1]
          Length = 113

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 69/107 (64%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
            EA A     RVSP K+ LV   IRG +V  A+  L FS+KR+AG VR+TL SAVANAE 
Sbjct: 2   QEARATTKYQRVSPYKVRLVIDQIRGMQVESAMNLLAFSKKRVAGVVRQTLKSAVANAEE 61

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           N  LDVD L+VS+AYV +   MKRF  R R R  RI++  S +TV V
Sbjct: 62  NLGLDVDTLVVSQAYVDQGPSMKRFKPRARGRATRILKRTSHITVAV 108


>gi|257866534|ref|ZP_05646187.1| ribosomal protein L22 [Enterococcus casseliflavus EC30]
 gi|257870522|ref|ZP_05650175.1| ribosomal protein L22 [Enterococcus gallinarum EG2]
 gi|257872951|ref|ZP_05652604.1| ribosomal protein L22 [Enterococcus casseliflavus EC10]
 gi|257876138|ref|ZP_05655791.1| ribosomal protein L22 [Enterococcus casseliflavus EC20]
 gi|325567371|ref|ZP_08144038.1| 50S ribosomal protein L22 [Enterococcus casseliflavus ATCC 12755]
 gi|257800492|gb|EEV29520.1| ribosomal protein L22 [Enterococcus casseliflavus EC30]
 gi|257804686|gb|EEV33508.1| ribosomal protein L22 [Enterococcus gallinarum EG2]
 gi|257807115|gb|EEV35937.1| ribosomal protein L22 [Enterococcus casseliflavus EC10]
 gi|257810304|gb|EEV39124.1| ribosomal protein L22 [Enterococcus casseliflavus EC20]
 gi|325158804|gb|EGC70950.1| 50S ribosomal protein L22 [Enterococcus casseliflavus ATCC 12755]
          Length = 115

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 53/107 (49%), Positives = 71/107 (66%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A A  +RVSP+K  LV  +IRGK V++A+A L+F+  + AG + K L SA+ANAENN 
Sbjct: 8   AKATAKTVRVSPRKSRLVIDLIRGKSVAEAIAILKFTPNKAAGIIEKVLMSAIANAENNF 67

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           DLDV+ LIVSEA+V +   MKRF  R +     I +  S +TV+V E
Sbjct: 68  DLDVENLIVSEAFVNEGPTMKRFRPRAKGSASPINKRTSHITVVVSE 114


>gi|227519997|ref|ZP_03950046.1| 50S ribosomal protein L22 [Enterococcus faecalis TX0104]
 gi|227555858|ref|ZP_03985905.1| 50S ribosomal protein L22 [Enterococcus faecalis HH22]
 gi|229546959|ref|ZP_04435684.1| 50S ribosomal protein L22 [Enterococcus faecalis TX1322]
 gi|229550548|ref|ZP_04439273.1| 50S ribosomal protein L22 [Enterococcus faecalis ATCC 29200]
 gi|293382753|ref|ZP_06628678.1| ribosomal protein L22 [Enterococcus faecalis R712]
 gi|293388064|ref|ZP_06632592.1| ribosomal protein L22 [Enterococcus faecalis S613]
 gi|307269092|ref|ZP_07550453.1| ribosomal protein L22 [Enterococcus faecalis TX4248]
 gi|307274176|ref|ZP_07555384.1| ribosomal protein L22 [Enterococcus faecalis TX0855]
 gi|307276401|ref|ZP_07557524.1| ribosomal protein L22 [Enterococcus faecalis TX2134]
 gi|307278611|ref|ZP_07559681.1| ribosomal protein L22 [Enterococcus faecalis TX0860]
 gi|307287009|ref|ZP_07567084.1| ribosomal protein L22 [Enterococcus faecalis TX0109]
 gi|307291650|ref|ZP_07571525.1| ribosomal protein L22 [Enterococcus faecalis TX0411]
 gi|312901117|ref|ZP_07760405.1| ribosomal protein L22 [Enterococcus faecalis TX0470]
 gi|312904679|ref|ZP_07763834.1| ribosomal protein L22 [Enterococcus faecalis TX0635]
 gi|312908648|ref|ZP_07767590.1| ribosomal protein L22 [Enterococcus faecalis DAPTO 512]
 gi|312909204|ref|ZP_07768061.1| ribosomal protein L22 [Enterococcus faecalis DAPTO 516]
 gi|312952612|ref|ZP_07771476.1| ribosomal protein L22 [Enterococcus faecalis TX0102]
 gi|227072545|gb|EEI10508.1| 50S ribosomal protein L22 [Enterococcus faecalis TX0104]
 gi|227175025|gb|EEI55997.1| 50S ribosomal protein L22 [Enterococcus faecalis HH22]
 gi|229304267|gb|EEN70263.1| 50S ribosomal protein L22 [Enterococcus faecalis ATCC 29200]
 gi|229307887|gb|EEN73874.1| 50S ribosomal protein L22 [Enterococcus faecalis TX1322]
 gi|291079913|gb|EFE17277.1| ribosomal protein L22 [Enterococcus faecalis R712]
 gi|291082515|gb|EFE19478.1| ribosomal protein L22 [Enterococcus faecalis S613]
 gi|306497269|gb|EFM66811.1| ribosomal protein L22 [Enterococcus faecalis TX0411]
 gi|306501955|gb|EFM71244.1| ribosomal protein L22 [Enterococcus faecalis TX0109]
 gi|306504671|gb|EFM73871.1| ribosomal protein L22 [Enterococcus faecalis TX0860]
 gi|306506881|gb|EFM76028.1| ribosomal protein L22 [Enterococcus faecalis TX2134]
 gi|306509138|gb|EFM78200.1| ribosomal protein L22 [Enterococcus faecalis TX0855]
 gi|306514572|gb|EFM83126.1| ribosomal protein L22 [Enterococcus faecalis TX4248]
 gi|310625435|gb|EFQ08718.1| ribosomal protein L22 [Enterococcus faecalis DAPTO 512]
 gi|310629400|gb|EFQ12683.1| ribosomal protein L22 [Enterococcus faecalis TX0102]
 gi|310632031|gb|EFQ15314.1| ribosomal protein L22 [Enterococcus faecalis TX0635]
 gi|311290446|gb|EFQ69002.1| ribosomal protein L22 [Enterococcus faecalis DAPTO 516]
 gi|311291789|gb|EFQ70345.1| ribosomal protein L22 [Enterococcus faecalis TX0470]
 gi|315026830|gb|EFT38762.1| ribosomal protein L22 [Enterococcus faecalis TX2137]
 gi|315028870|gb|EFT40802.1| ribosomal protein L22 [Enterococcus faecalis TX4000]
 gi|315031144|gb|EFT43076.1| ribosomal protein L22 [Enterococcus faecalis TX0017]
 gi|315036010|gb|EFT47942.1| ribosomal protein L22 [Enterococcus faecalis TX0027]
 gi|315145341|gb|EFT89357.1| ribosomal protein L22 [Enterococcus faecalis TX2141]
 gi|315147166|gb|EFT91182.1| ribosomal protein L22 [Enterococcus faecalis TX4244]
 gi|315151076|gb|EFT95092.1| ribosomal protein L22 [Enterococcus faecalis TX0012]
 gi|315153604|gb|EFT97620.1| ribosomal protein L22 [Enterococcus faecalis TX0031]
 gi|315156216|gb|EFU00233.1| ribosomal protein L22 [Enterococcus faecalis TX0043]
 gi|315158639|gb|EFU02656.1| ribosomal protein L22 [Enterococcus faecalis TX0312]
 gi|315160733|gb|EFU04750.1| ribosomal protein L22 [Enterococcus faecalis TX0645]
 gi|315165896|gb|EFU09913.1| ribosomal protein L22 [Enterococcus faecalis TX1302]
 gi|315168105|gb|EFU12122.1| ribosomal protein L22 [Enterococcus faecalis TX1341]
 gi|315171455|gb|EFU15472.1| ribosomal protein L22 [Enterococcus faecalis TX1342]
 gi|315172689|gb|EFU16706.1| ribosomal protein L22 [Enterococcus faecalis TX1346]
 gi|315573519|gb|EFU85710.1| ribosomal protein L22 [Enterococcus faecalis TX0309B]
 gi|315579331|gb|EFU91522.1| ribosomal protein L22 [Enterococcus faecalis TX0630]
 gi|315582133|gb|EFU94324.1| ribosomal protein L22 [Enterococcus faecalis TX0309A]
 gi|327534009|gb|AEA92843.1| 50S ribosomal protein L22 [Enterococcus faecalis OG1RF]
 gi|329577744|gb|EGG59170.1| ribosomal protein L22 [Enterococcus faecalis TX1467]
          Length = 117

 Score = 97.1 bits (240), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 52/107 (48%), Positives = 70/107 (65%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A A  +R SP+K  LV  +IRGK V+DA++ L+F+  + AG + K L SAVANAENN 
Sbjct: 10  AKATAKTVRTSPRKARLVIDLIRGKSVADAISILKFTPNKSAGIIEKVLMSAVANAENNF 69

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           DLDV+ L+VSEA+V +   MKRF  R +     I +  S +TV+V E
Sbjct: 70  DLDVESLVVSEAFVNEGPTMKRFRPRAKGSASPINKRTSHITVVVTE 116


>gi|29374856|ref|NP_814009.1| 50S ribosomal protein L22 [Enterococcus faecalis V583]
 gi|255971714|ref|ZP_05422300.1| ribosomal protein L22 [Enterococcus faecalis T1]
 gi|255974714|ref|ZP_05425300.1| ribosomal protein L22 [Enterococcus faecalis T2]
 gi|256618375|ref|ZP_05475221.1| ribosomal protein L22 [Enterococcus faecalis ATCC 4200]
 gi|256762009|ref|ZP_05502589.1| ribosomal protein L22 [Enterococcus faecalis T3]
 gi|256855168|ref|ZP_05560529.1| ribosomal protein L22 [Enterococcus faecalis T8]
 gi|256956857|ref|ZP_05561028.1| ribosomal protein L22 [Enterococcus faecalis DS5]
 gi|256960664|ref|ZP_05564835.1| 50S ribosomal protein L22 [Enterococcus faecalis Merz96]
 gi|256964137|ref|ZP_05568308.1| 50S ribosomal protein L22 [Enterococcus faecalis HIP11704]
 gi|257078527|ref|ZP_05572888.1| 50S ribosomal protein L22 [Enterococcus faecalis JH1]
 gi|257081502|ref|ZP_05575863.1| ribosomal protein L22 [Enterococcus faecalis E1Sol]
 gi|257084150|ref|ZP_05578511.1| 50S ribosomal protein L22 [Enterococcus faecalis Fly1]
 gi|257087977|ref|ZP_05582338.1| ribosomal protein L22 [Enterococcus faecalis D6]
 gi|257088654|ref|ZP_05583015.1| 50S ribosomal protein L22 [Enterococcus faecalis CH188]
 gi|257417581|ref|ZP_05594575.1| ribosomal protein L22 [Enterococcus faecalis AR01/DG]
 gi|257418694|ref|ZP_05595688.1| 50S ribosomal protein L22 [Enterococcus faecalis T11]
 gi|257421505|ref|ZP_05598495.1| 50S ribosomal protein L22 [Enterococcus faecalis X98]
 gi|294781056|ref|ZP_06746407.1| ribosomal protein L22 [Enterococcus faecalis PC1.1]
 gi|300862247|ref|ZP_07108327.1| ribosomal protein L22 [Enterococcus faecalis TUSoD Ef11]
 gi|51316406|sp|Q839F9|RL22_ENTFA RecName: Full=50S ribosomal protein L22
 gi|29342314|gb|AAO80080.1| ribosomal protein L22 [Enterococcus faecalis V583]
 gi|255962732|gb|EET95208.1| ribosomal protein L22 [Enterococcus faecalis T1]
 gi|255967586|gb|EET98208.1| ribosomal protein L22 [Enterococcus faecalis T2]
 gi|256597902|gb|EEU17078.1| ribosomal protein L22 [Enterococcus faecalis ATCC 4200]
 gi|256683260|gb|EEU22955.1| ribosomal protein L22 [Enterococcus faecalis T3]
 gi|256709681|gb|EEU24728.1| ribosomal protein L22 [Enterococcus faecalis T8]
 gi|256947353|gb|EEU63985.1| ribosomal protein L22 [Enterococcus faecalis DS5]
 gi|256951160|gb|EEU67792.1| 50S ribosomal protein L22 [Enterococcus faecalis Merz96]
 gi|256954633|gb|EEU71265.1| 50S ribosomal protein L22 [Enterococcus faecalis HIP11704]
 gi|256986557|gb|EEU73859.1| 50S ribosomal protein L22 [Enterococcus faecalis JH1]
 gi|256989532|gb|EEU76834.1| ribosomal protein L22 [Enterococcus faecalis E1Sol]
 gi|256992180|gb|EEU79482.1| 50S ribosomal protein L22 [Enterococcus faecalis Fly1]
 gi|256996007|gb|EEU83309.1| ribosomal protein L22 [Enterococcus faecalis D6]
 gi|256997466|gb|EEU83986.1| 50S ribosomal protein L22 [Enterococcus faecalis CH188]
 gi|257159409|gb|EEU89369.1| ribosomal protein L22 [Enterococcus faecalis ARO1/DG]
 gi|257160522|gb|EEU90482.1| 50S ribosomal protein L22 [Enterococcus faecalis T11]
 gi|257163329|gb|EEU93289.1| 50S ribosomal protein L22 [Enterococcus faecalis X98]
 gi|294451859|gb|EFG20310.1| ribosomal protein L22 [Enterococcus faecalis PC1.1]
 gi|295112510|emb|CBL31147.1| LSU ribosomal protein L22P [Enterococcus sp. 7L76]
 gi|300848772|gb|EFK76529.1| ribosomal protein L22 [Enterococcus faecalis TUSoD Ef11]
 gi|323479427|gb|ADX78866.1| ribosomal protein L22 [Enterococcus faecalis 62]
          Length = 115

 Score = 97.1 bits (240), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 52/107 (48%), Positives = 70/107 (65%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A A  +R SP+K  LV  +IRGK V+DA++ L+F+  + AG + K L SAVANAENN 
Sbjct: 8   AKATAKTVRTSPRKARLVIDLIRGKSVADAISILKFTPNKSAGIIEKVLMSAVANAENNF 67

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           DLDV+ L+VSEA+V +   MKRF  R +     I +  S +TV+V E
Sbjct: 68  DLDVESLVVSEAFVNEGPTMKRFRPRAKGSASPINKRTSHITVVVTE 114


>gi|69247174|ref|ZP_00604236.1| Ribosomal protein L22, bacterial and organelle form [Enterococcus
           faecium DO]
 gi|257878730|ref|ZP_05658383.1| ribosomal protein L22 [Enterococcus faecium 1,230,933]
 gi|257881371|ref|ZP_05661024.1| ribosomal protein L22 [Enterococcus faecium 1,231,502]
 gi|257885639|ref|ZP_05665292.1| ribosomal protein L22 [Enterococcus faecium 1,231,501]
 gi|257890589|ref|ZP_05670242.1| ribosomal protein L22 [Enterococcus faecium 1,231,410]
 gi|258615206|ref|ZP_05712976.1| 50S ribosomal protein L22 [Enterococcus faecium DO]
 gi|260558292|ref|ZP_05830488.1| ribosomal protein L22 [Enterococcus faecium C68]
 gi|261206998|ref|ZP_05921687.1| ribosomal protein L22 [Enterococcus faecium TC 6]
 gi|289565367|ref|ZP_06445817.1| 50S ribosomal protein L22 [Enterococcus faecium D344SRF]
 gi|293562951|ref|ZP_06677418.1| ribosomal protein L22 [Enterococcus faecium E1162]
 gi|293567926|ref|ZP_06679267.1| ribosomal protein L22 [Enterococcus faecium E1071]
 gi|294615388|ref|ZP_06695261.1| ribosomal protein L22 [Enterococcus faecium E1636]
 gi|294618315|ref|ZP_06697896.1| ribosomal protein L22 [Enterococcus faecium E1679]
 gi|294621083|ref|ZP_06700274.1| ribosomal protein L22 [Enterococcus faecium U0317]
 gi|314937613|ref|ZP_07844939.1| ribosomal protein L22 [Enterococcus faecium TX0133a04]
 gi|314942888|ref|ZP_07849701.1| ribosomal protein L22 [Enterococcus faecium TX0133C]
 gi|314947976|ref|ZP_07851380.1| ribosomal protein L22 [Enterococcus faecium TX0082]
 gi|314950893|ref|ZP_07853962.1| ribosomal protein L22 [Enterococcus faecium TX0133A]
 gi|314991459|ref|ZP_07856936.1| ribosomal protein L22 [Enterococcus faecium TX0133B]
 gi|314995020|ref|ZP_07860140.1| ribosomal protein L22 [Enterococcus faecium TX0133a01]
 gi|68194939|gb|EAN09407.1| Ribosomal protein L22, bacterial and organelle form [Enterococcus
           faecium DO]
 gi|257812958|gb|EEV41716.1| ribosomal protein L22 [Enterococcus faecium 1,230,933]
 gi|257817029|gb|EEV44357.1| ribosomal protein L22 [Enterococcus faecium 1,231,502]
 gi|257821495|gb|EEV48625.1| ribosomal protein L22 [Enterococcus faecium 1,231,501]
 gi|257826949|gb|EEV53575.1| ribosomal protein L22 [Enterococcus faecium 1,231,410]
 gi|260075466|gb|EEW63772.1| ribosomal protein L22 [Enterococcus faecium C68]
 gi|260078626|gb|EEW66328.1| ribosomal protein L22 [Enterococcus faecium TC 6]
 gi|289162857|gb|EFD10707.1| 50S ribosomal protein L22 [Enterococcus faecium D344SRF]
 gi|291291691|gb|ADD91682.1| 50S ribosomal protein L22 [Enterococcus faecium]
 gi|291589511|gb|EFF21318.1| ribosomal protein L22 [Enterococcus faecium E1071]
 gi|291591762|gb|EFF23398.1| ribosomal protein L22 [Enterococcus faecium E1636]
 gi|291595409|gb|EFF26721.1| ribosomal protein L22 [Enterococcus faecium E1679]
 gi|291599319|gb|EFF30345.1| ribosomal protein L22 [Enterococcus faecium U0317]
 gi|291605077|gb|EFF34544.1| ribosomal protein L22 [Enterococcus faecium E1162]
 gi|313590746|gb|EFR69591.1| ribosomal protein L22 [Enterococcus faecium TX0133a01]
 gi|313593939|gb|EFR72784.1| ribosomal protein L22 [Enterococcus faecium TX0133B]
 gi|313596902|gb|EFR75747.1| ribosomal protein L22 [Enterococcus faecium TX0133A]
 gi|313598360|gb|EFR77205.1| ribosomal protein L22 [Enterococcus faecium TX0133C]
 gi|313642990|gb|EFS07570.1| ribosomal protein L22 [Enterococcus faecium TX0133a04]
 gi|313645574|gb|EFS10154.1| ribosomal protein L22 [Enterococcus faecium TX0082]
          Length = 115

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 52/107 (48%), Positives = 70/107 (65%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A A  +R SP+K  LV  +IRGK V+DA++ L+F+  + AG + K L SAVANAENN 
Sbjct: 8   AKATAKTVRTSPRKARLVIDLIRGKSVADAISILKFTPNKSAGIIEKVLMSAVANAENNF 67

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           DLDV+ L+VSEA+V +   MKRF  R +     I +  S +TV+V E
Sbjct: 68  DLDVENLVVSEAFVNEGPTMKRFRPRAKGSASPINKRTSHITVVVSE 114


>gi|320529801|ref|ZP_08030878.1| ribosomal protein L22 [Selenomonas artemidis F0399]
 gi|320137819|gb|EFW29724.1| ribosomal protein L22 [Selenomonas artemidis F0399]
          Length = 112

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 51/109 (46%), Positives = 72/109 (66%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
            E  A A  +R++P+K+ +V  ++RGK V+DALA L+F+ K  A  V K L SAVANAEN
Sbjct: 3   QEVQATAKYIRIAPRKVRIVMNLVRGKSVADALAILKFTPKVGADAVEKVLRSAVANAEN 62

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           N D+DVDRL +S A+V +   +KR H R R +  +I++  S +TV V E
Sbjct: 63  NFDMDVDRLFISSAFVDQGPTLKRIHPRSRGQAFKILKHTSHITVAVNE 111


>gi|315640156|ref|ZP_07895278.1| 50S ribosomal protein L22 [Enterococcus italicus DSM 15952]
 gi|315484133|gb|EFU74607.1| 50S ribosomal protein L22 [Enterococcus italicus DSM 15952]
          Length = 115

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 51/107 (47%), Positives = 71/107 (66%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A A  +RVSP+K  +V  +IRGK V++A+A L+F+  + AG + K L SA+ANAENN 
Sbjct: 8   AKATAKTVRVSPRKSRIVIDLIRGKNVAEAIAILKFTPNKAAGVIEKVLMSAIANAENNF 67

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           DLDV+ L+VSEA+V +   MKRF  R +     I +  S +TV+V E
Sbjct: 68  DLDVENLVVSEAFVNEGPTMKRFRPRAKGSASPINKRTSHITVVVSE 114


>gi|238928150|ref|ZP_04659910.1| ribosomal protein L22 [Selenomonas flueggei ATCC 43531]
 gi|313895415|ref|ZP_07828972.1| ribosomal protein L22 [Selenomonas sp. oral taxon 137 str. F0430]
 gi|238884110|gb|EEQ47748.1| ribosomal protein L22 [Selenomonas flueggei ATCC 43531]
 gi|312976310|gb|EFR41768.1| ribosomal protein L22 [Selenomonas sp. oral taxon 137 str. F0430]
          Length = 113

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 51/109 (46%), Positives = 72/109 (66%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
            E  A A  +R++P+K+ +V  ++RGK V+DALA L+F+ K  A  V K L SAVANAEN
Sbjct: 3   QEVKATAKYIRIAPRKVRIVMNLVRGKSVADALAILKFTPKVGADAVEKVLRSAVANAEN 62

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           N D+DVDRL +S A+V +   +KR H R R +  +I++  S +TV V E
Sbjct: 63  NFDMDVDRLFISSAFVDQGPTLKRIHPRSRGQAFKILKHTSHITVAVNE 111


>gi|22330190|ref|NP_564605.2| ribosomal protein L22 family  protein [Arabidopsis thaliana]
 gi|79319746|ref|NP_001031174.1| ribosomal protein L22 family  protein [Arabidopsis thaliana]
 gi|186490375|ref|NP_001117473.1| ribosomal protein L22 family  protein [Arabidopsis thaliana]
 gi|62321786|dbj|BAD95410.1| chloroplast 50S ribosomal protein L22 [Arabidopsis thaliana]
 gi|109946433|gb|ABG48395.1| At1g52370 [Arabidopsis thaliana]
 gi|110742949|dbj|BAE99369.1| putative chloroplast 50S ribosomal protein L22 [Arabidopsis
           thaliana]
 gi|222424158|dbj|BAH20038.1| AT1G52370 [Arabidopsis thaliana]
 gi|332194673|gb|AEE32794.1| Ribosomal protein L.2/L17e family protein [Arabidopsis thaliana]
 gi|332194674|gb|AEE32795.1| Ribosomal protein L.2/L17e family protein [Arabidopsis thaliana]
 gi|332194675|gb|AEE32796.1| Ribosomal protein L.2/L17e family protein [Arabidopsis thaliana]
          Length = 269

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 56/123 (45%), Positives = 78/123 (63%), Gaps = 4/123 (3%)

Query: 2   SGKRSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEV 61
           SGK    K      +  A+   ++ SP+K+NLVAA++RG RV DAL  L+ + KR +  V
Sbjct: 91  SGKEEEQKIIPKRQKVQAVLKSIKQSPKKVNLVAALVRGMRVEDALMQLQVTVKRASQTV 150

Query: 62  RKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKR--FHCRGRQRIGRIVRPFSRLTV 119
            + + +A ANA +NH LD DRL+V+EA+VGK +F K+  +H +GR   G I  P  RLTV
Sbjct: 151 YRVIHAARANATHNHGLDPDRLLVAEAFVGKGLFGKKVAYHAKGRS--GIISIPRCRLTV 208

Query: 120 IVR 122
           IVR
Sbjct: 209 IVR 211


>gi|292669854|ref|ZP_06603280.1| 50S ribosomal protein L22 [Selenomonas noxia ATCC 43541]
 gi|292648651|gb|EFF66623.1| 50S ribosomal protein L22 [Selenomonas noxia ATCC 43541]
          Length = 112

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 51/109 (46%), Positives = 72/109 (66%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
            E  A A  +R++P+K+ +V  ++RGK V+DALA L+F+ K  A  V K L SAVANAEN
Sbjct: 3   QEVKATAKYIRIAPRKVRIVMNLVRGKSVADALAILKFTPKIGADAVEKVLRSAVANAEN 62

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           N D+DVDRL +S A+V +   +KR H R R +  +I++  S +TV V E
Sbjct: 63  NFDMDVDRLFISSAFVDQGPTLKRIHPRSRGQAFKILKHTSHITVAVNE 111


>gi|227550725|ref|ZP_03980774.1| ribosomal protein L22 [Enterococcus faecium TX1330]
 gi|257888016|ref|ZP_05667669.1| ribosomal protein L22 [Enterococcus faecium 1,141,733]
 gi|257893179|ref|ZP_05672832.1| ribosomal protein L22 [Enterococcus faecium 1,231,408]
 gi|257896365|ref|ZP_05676018.1| ribosomal protein L22 [Enterococcus faecium Com12]
 gi|257899339|ref|ZP_05678992.1| ribosomal protein L22 [Enterococcus faecium Com15]
 gi|293379451|ref|ZP_06625595.1| ribosomal protein L22 [Enterococcus faecium PC4.1]
 gi|293553884|ref|ZP_06674490.1| ribosomal protein L22 [Enterococcus faecium E1039]
 gi|293570689|ref|ZP_06681739.1| ribosomal protein L22 [Enterococcus faecium E980]
 gi|227180186|gb|EEI61158.1| ribosomal protein L22 [Enterococcus faecium TX1330]
 gi|257824070|gb|EEV51002.1| ribosomal protein L22 [Enterococcus faecium 1,141,733]
 gi|257829558|gb|EEV56165.1| ribosomal protein L22 [Enterococcus faecium 1,231,408]
 gi|257832930|gb|EEV59351.1| ribosomal protein L22 [Enterococcus faecium Com12]
 gi|257837251|gb|EEV62325.1| ribosomal protein L22 [Enterococcus faecium Com15]
 gi|291601936|gb|EFF32182.1| ribosomal protein L22 [Enterococcus faecium E1039]
 gi|291609161|gb|EFF38433.1| ribosomal protein L22 [Enterococcus faecium E980]
 gi|292641974|gb|EFF60140.1| ribosomal protein L22 [Enterococcus faecium PC4.1]
          Length = 115

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 51/107 (47%), Positives = 70/107 (65%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A A  +R SP+K  LV  +IRGK V+DA++ L+F+  + AG + K L SAVANAENN 
Sbjct: 8   AKATAKTVRTSPRKARLVIDLIRGKSVADAISILKFTPNKSAGIIEKVLMSAVANAENNF 67

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           DLDV+ L+V+EA+V +   MKRF  R +     I +  S +TV+V E
Sbjct: 68  DLDVENLVVTEAFVNEGPTMKRFRPRAKGSASPINKRTSHITVVVSE 114


>gi|304438367|ref|ZP_07398308.1| 50S ribosomal protein L22 [Selenomonas sp. oral taxon 149 str.
           67H29BP]
 gi|304368733|gb|EFM22417.1| 50S ribosomal protein L22 [Selenomonas sp. oral taxon 149 str.
           67H29BP]
          Length = 112

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 50/109 (45%), Positives = 72/109 (66%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
            E  A A  +R++P+K+ +V  ++RGK V+DALA L+F+ K  A  V K L SA+ANAEN
Sbjct: 3   QEVKATAKYIRIAPRKVRIVMNLVRGKSVADALAILKFTPKVGADAVEKVLRSAIANAEN 62

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           N D+DVDRL +S A+V +   +KR H R R +  +I++  S +TV V E
Sbjct: 63  NFDMDVDRLFISSAFVDQGPTLKRIHPRSRGQAFKILKHTSHITVAVNE 111


>gi|12323131|gb|AAG51551.1|AC037424_16 chloroplast 50S ribosomal protein L22, putative; 25606-24374
           [Arabidopsis thaliana]
          Length = 226

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 56/123 (45%), Positives = 78/123 (63%), Gaps = 4/123 (3%)

Query: 2   SGKRSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEV 61
           SGK    K      +  A+   ++ SP+K+NLVAA++RG RV DAL  L+ + KR +  V
Sbjct: 48  SGKEEEQKIIPKRQKVQAVLKSIKQSPKKVNLVAALVRGMRVEDALMQLQVTVKRASQTV 107

Query: 62  RKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKR--FHCRGRQRIGRIVRPFSRLTV 119
            + + +A ANA +NH LD DRL+V+EA+VGK +F K+  +H +GR   G I  P  RLTV
Sbjct: 108 YRVIHAARANATHNHGLDPDRLLVAEAFVGKGLFGKKVAYHAKGRS--GIISIPRCRLTV 165

Query: 120 IVR 122
           IVR
Sbjct: 166 IVR 168


>gi|317123092|ref|YP_004103095.1| 50S ribosomal protein L22P [Thermaerobacter marianensis DSM 12885]
 gi|315593072|gb|ADU52368.1| LSU ribosomal protein L22P [Thermaerobacter marianensis DSM 12885]
          Length = 113

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 71/108 (65%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  +RVSP+K   V  ++RGK V +AL  L F+ K+ A  V K + SAVANA NN
Sbjct: 2   EARAVARFVRVSPRKARQVIDLVRGKPVGEALTLLRFTPKKAARIVEKVVRSAVANATNN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           HDLD DRL +++AYV +   +KR+  R R R   I++P S +TVIV E
Sbjct: 62  HDLDEDRLYIAKAYVDEGPRLKRWRPRARGRAFPILKPTSHVTVIVAE 109


>gi|239787568|emb|CAX84036.1| 50S ribosomal protein L22 [uncultured bacterium]
          Length = 112

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 56/99 (56%), Positives = 70/99 (70%)

Query: 24  LRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRL 83
           L VSP K+ LV   IRG RV  AL  LEFS+KR+AG VR+TL SA+ANAENN+ LDVD L
Sbjct: 10  LPVSPTKVRLVVDQIRGHRVEHALRTLEFSKKRVAGSVRETLKSAIANAENNYGLDVDTL 69

Query: 84  IVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVR 122
           IV +A V + + MKRF  R R R GR+++  S +T+ VR
Sbjct: 70  IVFQASVDQGLVMKRFRPRARGRAGRVIKRTSHITITVR 108


>gi|168033860|ref|XP_001769432.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162679352|gb|EDQ65801.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 150

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 70/101 (69%), Gaps = 3/101 (2%)

Query: 27  SPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLIVS 86
           SP+K+NLVA ++RG RV DAL  +  S KR A  V   + SA ANA +N  +D DRLIV+
Sbjct: 2   SPKKVNLVAELVRGMRVDDALMQMAVSTKRAAKVV---VTSARANAIHNFGMDKDRLIVA 58

Query: 87  EAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           EA+VGK  ++KR    G+ + G++VRP  RLTV+V+E+S E
Sbjct: 59  EAFVGKDKYLKRLRIHGKGKAGQMVRPRCRLTVVVKELSAE 99


>gi|255076287|ref|XP_002501818.1| predicted protein [Micromonas sp. RCC299]
 gi|226517082|gb|ACO63076.1| predicted protein [Micromonas sp. RCC299]
          Length = 106

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 50/97 (51%), Positives = 62/97 (63%)

Query: 27  SPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLIVS 86
           SP+K N V  +IRG  VSDAL     S K+ A  VRK + SA ANA NNHDLD D+L V+
Sbjct: 10  SPKKFNDVLRVIRGCSVSDALVQCALSPKKYADVVRKVILSAAANATNNHDLDRDKLFVA 69

Query: 87  EAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           EA VGK  F+ R    GR R G++ RP S +T++V E
Sbjct: 70  EAVVGKGTFLPRVSIHGRGRAGKMHRPRSHVTIVVEE 106


>gi|259047550|ref|ZP_05737951.1| 50S ribosomal protein L22 [Granulicatella adiacens ATCC 49175]
 gi|259035741|gb|EEW36996.1| 50S ribosomal protein L22 [Granulicatella adiacens ATCC 49175]
          Length = 118

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 72/107 (67%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A+A  +R++P+K  LV  +IRGK++ DA++ L+F+ +  +  V K L SA+ANAE+N 
Sbjct: 8   AKAVAKTVRIAPRKARLVVDLIRGKKIGDAISILKFTPRSASPIVEKVLMSAIANAEHNF 67

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           DLDV+ L VSEAYV +   MKRF  R +    +I++  S +TV+V E
Sbjct: 68  DLDVENLYVSEAYVNEGPTMKRFRPRAKGSASQILKRTSHITVVVSE 114


>gi|15896378|ref|NP_349727.1| 50S ribosomal protein L22 [Clostridium acetobutylicum ATCC 824]
 gi|51316516|sp|Q97EI3|RL22_CLOAB RecName: Full=50S ribosomal protein L22
 gi|15026194|gb|AAK81067.1|AE007808_20 Ribosomal protein L22 [Clostridium acetobutylicum ATCC 824]
 gi|325510534|gb|ADZ22170.1| 50S ribosomal protein L22 [Clostridium acetobutylicum EA 2018]
          Length = 111

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 71/108 (65%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AIA  +R+SP K+ +V  +IRGK V++A A L+++ K  A  + K L SAVANAENN
Sbjct: 2   EAKAIAKYVRMSPMKVKIVLDLIRGKNVNEAFAILQYTPKDAAVVINKVLKSAVANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            +LD +RL VSEAY G+   +KRF    + R   I +  S +TVIV+E
Sbjct: 62  FNLDGNRLYVSEAYAGQGPTLKRFQPHAQGRAFSIKKRSSHITVIVKE 109


>gi|260584421|ref|ZP_05852168.1| 50S ribosomal protein L22 [Granulicatella elegans ATCC 700633]
 gi|260157939|gb|EEW93008.1| 50S ribosomal protein L22 [Granulicatella elegans ATCC 700633]
          Length = 118

 Score = 94.4 bits (233), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 72/107 (67%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A+A  +R++P+K  LV  +IRGK++ DA++ L+F+ +  +  V K L SA+ANAE+N 
Sbjct: 8   AKAVAKTVRIAPRKARLVVDLIRGKKIGDAISILKFTPRAASPIVEKVLMSAIANAEHNF 67

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           DLDV+ L VSEAYV +   MKRF  R +    +I++  S +TV+V E
Sbjct: 68  DLDVENLYVSEAYVNEGPTMKRFRPRAKGSASQILKRTSHITVVVSE 114


>gi|313903146|ref|ZP_07836540.1| LSU ribosomal protein L22P [Thermaerobacter subterraneus DSM 13965]
 gi|313466648|gb|EFR62168.1| LSU ribosomal protein L22P [Thermaerobacter subterraneus DSM 13965]
          Length = 113

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 70/108 (64%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  +R+SP+K   V  ++RGK V +AL  L F+ KR A  V K + SAVANA NN
Sbjct: 2   EARAVARFVRLSPRKARQVVDLVRGKPVGEALTLLRFTPKRAARIVEKVVRSAVANATNN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           HDLD DRL + +AYV +   +KR+  R R R   I++P S +TVIV E
Sbjct: 62  HDLDEDRLYIVKAYVDEGPRLKRWRPRARGRAFPILKPTSHVTVIVAE 109


>gi|290968239|ref|ZP_06559782.1| ribosomal protein L22 [Megasphaera genomosp. type_1 str. 28L]
 gi|290781721|gb|EFD94306.1| ribosomal protein L22 [Megasphaera genomosp. type_1 str. 28L]
          Length = 111

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 76/108 (70%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  +R++P+K+ +V  +IRGK  ++ALA L+F+ K  +  V KTL SA+ANAE+N
Sbjct: 2   EAKAVAKHIRIAPRKIRIVVDLIRGKDAAEALAILKFTPKVGSRVVEKTLRSAMANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           +D+++D L VSE +V +   MKR H R R +  +I++  S LTV+V+E
Sbjct: 62  NDMNIDNLYVSEIFVDQDATMKRIHPRSRGQAFKILKHSSHLTVVVKE 109


>gi|254517475|ref|ZP_05129531.1| ribosomal protein L22 [Clostridium sp. 7_2_43FAA]
 gi|226911224|gb|EEH96425.1| ribosomal protein L22 [Clostridium sp. 7_2_43FAA]
          Length = 111

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 72/108 (66%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AIA  +R+SP K+ +V  +IRGK + +A A L+++ K  A  + K L SAVANAENN
Sbjct: 2   EARAIAKYVRMSPTKVGVVLDLIRGKNIQEAFAILQYTPKDAAVVINKVLKSAVANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           H++DV+RL V+EA+VG    +KRF      +  RI +  S +T++V+E
Sbjct: 62  HEMDVERLYVAEAFVGAGPTLKRFRPMDHGKAFRINKRTSNITLVVKE 109


>gi|187933359|ref|YP_001884478.1| 50S ribosomal protein L22 [Clostridium botulinum B str. Eklund 17B]
 gi|188590483|ref|YP_001919677.1| 50S ribosomal protein L22 [Clostridium botulinum E3 str. Alaska
           E43]
 gi|251780927|ref|ZP_04823847.1| 50S ribosomal protein L22 [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
 gi|187721512|gb|ACD22733.1| 50S ribosomal protein L22 [Clostridium botulinum B str. Eklund 17B]
 gi|188500764|gb|ACD53900.1| 50S ribosomal protein L22 [Clostridium botulinum E3 str. Alaska
           E43]
 gi|243085242|gb|EES51132.1| 50S ribosomal protein L22 [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
          Length = 111

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 72/108 (66%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AIA  +R+SP K+ ++  +IRGK+V +A A LE++ +  A  ++K L SAVANAENN
Sbjct: 2   EARAIAKYIRMSPMKVRVILDLIRGKQVKEAFAILEYTPREAAVVIKKVLKSAVANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            +L+ D L VSEAYVG+   +KRF      +  RI +  S +TV+V+E
Sbjct: 62  LELNADNLYVSEAYVGEGPILKRFRPMDHGKAFRINKRTSHVTVVVKE 109


>gi|150015048|ref|YP_001307302.1| 50S ribosomal protein L22 [Clostridium beijerinckii NCIMB 8052]
 gi|189041944|sp|A6LPR6|RL22_CLOB8 RecName: Full=50S ribosomal protein L22
 gi|149901513|gb|ABR32346.1| ribosomal protein L22 [Clostridium beijerinckii NCIMB 8052]
          Length = 111

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 47/108 (43%), Positives = 73/108 (67%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AIA  +R+SP K+ ++  +IRGK+V++A A L+++ +  A  + K L SAVANAENN
Sbjct: 2   EARAIAKYIRMSPTKVGVILDLIRGKQVNEAFAILQYTPREAAVVINKVLKSAVANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            +L+ D L VSE +VG+   +KRF    + R  +I++  S +TV+V+E
Sbjct: 62  LELNADNLYVSECFVGQGSTLKRFQPHAQGRAFKILKKTSNITVVVKE 109


>gi|258512665|ref|YP_003186099.1| 50S ribosomal protein L22 [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
 gi|257479391|gb|ACV59710.1| ribosomal protein L22 [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
          Length = 118

 Score = 92.8 bits (229), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 71/107 (66%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A+A  LR++P+K  LV  ++RGK V +ALA L+F+ +  +  V K L SA+ANAENNH
Sbjct: 11  ARAVARYLRIAPRKARLVVDLVRGKNVQEALAILKFTPRAASPLVEKVLRSAIANAENNH 70

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           ++DVD+L + E YV +   +KR+H R + R   I +  S +TV++ E
Sbjct: 71  NMDVDKLYIKEIYVDEGPTLKRWHPRAQGRAFSIFKRTSHITVVLAE 117


>gi|218290001|ref|ZP_03494178.1| ribosomal protein L22 [Alicyclobacillus acidocaldarius LAA1]
 gi|218239986|gb|EED07173.1| ribosomal protein L22 [Alicyclobacillus acidocaldarius LAA1]
          Length = 118

 Score = 92.8 bits (229), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 71/107 (66%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A+A  LR++P+K  LV  ++RGK V +ALA L+F+ +  +  V K L SA+ANAENNH
Sbjct: 11  ARAVARYLRIAPRKARLVVDLVRGKNVQEALAILKFTPRAASPLVEKVLRSAIANAENNH 70

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           ++DVD+L + E YV +   +KR+H R + R   I +  S +TV++ E
Sbjct: 71  NMDVDKLYIKEIYVDEGPTLKRWHPRAQGRAFSIFKRTSHITVVLAE 117


>gi|118443412|ref|YP_877203.1| 50S ribosomal protein L22 [Clostridium novyi NT]
 gi|166220842|sp|A0PXV1|RL22_CLONN RecName: Full=50S ribosomal protein L22
 gi|118133868|gb|ABK60912.1| ribosomal protein L22 [Clostridium novyi NT]
          Length = 111

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 74/108 (68%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AIA  +R+SP+K+ +V  ++RGK VS+A A L+++ K  A  V K L SAVANAENN
Sbjct: 2   EARAIAKYVRMSPRKVRVVLDLVRGKNVSEAFAILKYTPKDAATVVLKVLKSAVANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            +LDV++L ++EAY  +   +KRF  R + R   I++  S +T++V+E
Sbjct: 62  FNLDVNKLYIAEAYANQGPTLKRFKPRAQGRAYSIMKRTSHVTLVVKE 109


>gi|182418809|ref|ZP_02950074.1| ribosomal protein L22 [Clostridium butyricum 5521]
 gi|237666790|ref|ZP_04526775.1| ribosomal protein L22 [Clostridium butyricum E4 str. BoNT E BL5262]
 gi|182377306|gb|EDT74867.1| ribosomal protein L22 [Clostridium butyricum 5521]
 gi|237657989|gb|EEP55544.1| ribosomal protein L22 [Clostridium butyricum E4 str. BoNT E BL5262]
          Length = 111

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 72/108 (66%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AIA  +R+SP K+ +V  +IRGK V++A A L+++ +  A  + K L SAVANAENN
Sbjct: 2   EARAIAKYIRMSPTKVGVVLDLIRGKNVNEAFAILQYTPREAAVVINKVLKSAVANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            +L+ D L VSE +VG+   +KRF    + R  +I++  S +TV+V+E
Sbjct: 62  LELNADNLYVSECFVGQGSTLKRFQPHAQGRAFKILKKTSNITVVVKE 109


>gi|312899048|ref|ZP_07758432.1| ribosomal protein L22 [Megasphaera micronuciformis F0359]
 gi|310619833|gb|EFQ03409.1| ribosomal protein L22 [Megasphaera micronuciformis F0359]
          Length = 111

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 76/108 (70%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AIA  +R++P+K+ +VA ++RGK VS+A+A L+F+ K  +  V K + SA ANAE+N
Sbjct: 2   EARAIAKHVRIAPRKIRIVADLVRGKNVSEAMAILKFTPKVGSKVVEKVIRSAAANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           +D++VD L +SE +V +   MKR H R R +  +I++  S +TV+V+E
Sbjct: 62  NDMNVDALYISEIFVDQDSTMKRIHPRSRGQAFKILKKSSHVTVVVKE 109


>gi|168187809|ref|ZP_02622444.1| ribosomal protein L22 [Clostridium botulinum C str. Eklund]
 gi|169294340|gb|EDS76473.1| ribosomal protein L22 [Clostridium botulinum C str. Eklund]
          Length = 111

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 74/108 (68%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AIA  +R+SP+K+ +V  ++RGK VS+A A L+++ K  A  V K L SAVANAENN
Sbjct: 2   EARAIAKYVRMSPRKVRVVLDLVRGKNVSEAFAILKYTPKDAATVVLKVLKSAVANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            +LDV++L ++EAY  +   +KRF  R + R   I++  S +T++V+E
Sbjct: 62  FNLDVNKLYIAEAYANQGPTLKRFRPRAQGRAYSIMKRTSHVTLVVKE 109


>gi|219666495|ref|YP_002456930.1| 50S ribosomal protein L22 [Desulfitobacterium hafniense DCB-2]
 gi|254800434|sp|B8G1X1|RL22_DESHD RecName: Full=50S ribosomal protein L22
 gi|219536755|gb|ACL18494.1| ribosomal protein L22 [Desulfitobacterium hafniense DCB-2]
          Length = 114

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 52/109 (47%), Positives = 69/109 (63%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
            +A AIA  +R+SP+K+  V  +IRGK VSDALA L+F+ K     V K L SAVANAE+
Sbjct: 2   QQAKAIARYVRISPRKVRQVVDLIRGKNVSDALAILQFTPKGATEPVTKVLNSAVANAEH 61

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           N+D+D D LIV E YV +   +KR   R   R  +I +  S +TV+V E
Sbjct: 62  NYDMDTDALIVKEIYVDEGPTLKRIKPRAMGRADQIRKRTSHITVVVVE 110


>gi|118595330|ref|ZP_01552677.1| ribosomal protein L22 [Methylophilales bacterium HTCC2181]
 gi|118441108|gb|EAV47735.1| ribosomal protein L22 [Methylophilales bacterium HTCC2181]
          Length = 111

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 49/107 (45%), Positives = 68/107 (63%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
           NE +AI   +R+SPQK  LVA MIRGK+V +A+  L FS K+ A  ++K L SA+ANAE+
Sbjct: 3   NEVSAILKGVRISPQKARLVADMIRGKKVDNAINILSFSPKKGADIIKKVLESAIANAEH 62

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           N+  D+D L +   YV K   +KR   R + R G+I +  S +TV V
Sbjct: 63  NNGADIDELKIKTIYVDKGAILKRIRARAKGRAGKIQKQTSHITVTV 109


>gi|187776581|ref|ZP_02993054.1| hypothetical protein CLOSPO_00095 [Clostridium sporogenes ATCC
           15579]
 gi|187775240|gb|EDU39042.1| hypothetical protein CLOSPO_00095 [Clostridium sporogenes ATCC
           15579]
          Length = 111

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 72/108 (66%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AI   +R+SP K+ +V  ++RGK V++A A L+++ K  A  + K L SAVANAENN
Sbjct: 2   EAKAIVRYVRMSPSKIGVVLDLVRGKDVNEAFAILKYTPKDAAEVIYKALKSAVANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            +LDV+ L +SEAYVG+   +KR+    + R  RI +  S LT++V+E
Sbjct: 62  LNLDVNSLYISEAYVGQGPTLKRYQPHAQGRAFRIRKRTSHLTLVVKE 109


>gi|163791671|ref|ZP_02186066.1| 50S ribosomal protein L22 [Carnobacterium sp. AT7]
 gi|159873050|gb|EDP67159.1| 50S ribosomal protein L22 [Carnobacterium sp. AT7]
          Length = 118

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 72/109 (66%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
            EA A A  +R++ +K+ LV  +IRGK + +A++ L+F+ +  +  + K L SA+ANAE+
Sbjct: 6   TEAKATAKTVRIAARKVRLVVDLIRGKSIGEAISILKFTPRGASPAIEKVLMSAIANAEH 65

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           N+DLDV+ L+VSEAYV +   MKRF  R +     I++  S +TV+V E
Sbjct: 66  NYDLDVENLVVSEAYVNEGPTMKRFRPRAKGSAAPILKRTSHITVVVSE 114


>gi|18311382|ref|NP_563316.1| 50S ribosomal protein L22 [Clostridium perfringens str. 13]
 gi|110800033|ref|YP_697089.1| 50S ribosomal protein L22 [Clostridium perfringens ATCC 13124]
 gi|110801821|ref|YP_699658.1| 50S ribosomal protein L22 [Clostridium perfringens SM101]
 gi|168205229|ref|ZP_02631234.1| ribosomal protein L22 [Clostridium perfringens E str. JGS1987]
 gi|168211900|ref|ZP_02637525.1| ribosomal protein L22 [Clostridium perfringens B str. ATCC 3626]
 gi|168215181|ref|ZP_02640806.1| ribosomal protein L22 [Clostridium perfringens CPE str. F4969]
 gi|168216636|ref|ZP_02642261.1| ribosomal protein L22 [Clostridium perfringens NCTC 8239]
 gi|169347010|ref|ZP_02865952.1| ribosomal protein L22 [Clostridium perfringens C str. JGS1495]
 gi|182626926|ref|ZP_02954659.1| ribosomal protein L22 [Clostridium perfringens D str. JGS1721]
 gi|51316499|sp|Q8XHS8|RL22_CLOPE RecName: Full=50S ribosomal protein L22
 gi|123148514|sp|Q0TMQ1|RL22_CLOP1 RecName: Full=50S ribosomal protein L22
 gi|123341527|sp|Q0SQE9|RL22_CLOPS RecName: Full=50S ribosomal protein L22
 gi|18146066|dbj|BAB82106.1| 50S ribosomal protein L22 [Clostridium perfringens str. 13]
 gi|110674680|gb|ABG83667.1| 50S ribosomal protein L22 [Clostridium perfringens ATCC 13124]
 gi|110682322|gb|ABG85692.1| 50S ribosomal protein L22 [Clostridium perfringens SM101]
 gi|169296693|gb|EDS78822.1| ribosomal protein L22 [Clostridium perfringens C str. JGS1495]
 gi|170663270|gb|EDT15953.1| ribosomal protein L22 [Clostridium perfringens E str. JGS1987]
 gi|170710181|gb|EDT22363.1| ribosomal protein L22 [Clostridium perfringens B str. ATCC 3626]
 gi|170713393|gb|EDT25575.1| ribosomal protein L22 [Clostridium perfringens CPE str. F4969]
 gi|177907716|gb|EDT70331.1| ribosomal protein L22 [Clostridium perfringens D str. JGS1721]
 gi|182381202|gb|EDT78681.1| ribosomal protein L22 [Clostridium perfringens NCTC 8239]
          Length = 111

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 72/108 (66%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AIA  +R+SP K+ +V  +IRGK V++A A L+++ +  A  + K L SAVANAENN
Sbjct: 2   EAKAIAKYVRMSPTKVGVVLDLIRGKNVNEAFAILKYTPRDAAEVISKVLKSAVANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           H+LD +RL V+EA+VG    +KRF      +  RI +  S +T++V+E
Sbjct: 62  HELDANRLFVAEAHVGHGPTLKRFRPMDHGKAFRINKRTSNITLVVKE 109


>gi|284049252|ref|YP_003399591.1| ribosomal protein L22 [Acidaminococcus fermentans DSM 20731]
 gi|283953473|gb|ADB48276.1| ribosomal protein L22 [Acidaminococcus fermentans DSM 20731]
          Length = 111

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 74/108 (68%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  +R++P+KL +V  +IRGK V++A A L+F+ K  +  + K L SAVANAE+N
Sbjct: 3   EAKAVAKYIRIAPRKLRIVINLIRGKSVNEAFAILKFTPKVGSEVIEKVLRSAVANAEHN 62

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            D++VD+L+VS A+V +   MKR H R R +  +I++  S +TV V E
Sbjct: 63  FDMNVDKLVVSNAFVDQGPTMKRIHPRSRGQAFKILKRSSHVTVAVSE 110


>gi|328958723|ref|YP_004376109.1| 50S ribosomal protein L22 [Carnobacterium sp. 17-4]
 gi|328675047|gb|AEB31093.1| 50S ribosomal protein L22 [Carnobacterium sp. 17-4]
          Length = 118

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 72/109 (66%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
            EA A A  +R++ +K+ LV  +IRGK + +A++ L+F+ +  +  + K L SA+ANAE+
Sbjct: 6   TEAKATAKTVRIAARKVRLVVDLIRGKSIGEAISILKFTPRGASPAIEKVLMSAIANAEH 65

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           N+DLDV+ L+VSEAYV +   MKRF  R +     I++  S +TV+V E
Sbjct: 66  NYDLDVENLVVSEAYVNEGPTMKRFRPRAKGSAAPILKRTSHITVVVSE 114


>gi|212637959|ref|YP_002314479.1| 50S ribosomal protein L22 [Anoxybacillus flavithermus WK1]
 gi|226733427|sp|B7GJ72|RL22_ANOFW RecName: Full=50S ribosomal protein L22
 gi|212559439|gb|ACJ32494.1| Ribosomal protein L22 [Anoxybacillus flavithermus WK1]
          Length = 113

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 47/108 (43%), Positives = 74/108 (68%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A A+A  +R++P+K  LV  +IRGK+VS+A+A L  + K  +  + K L SAVANAE+N
Sbjct: 2   QAKAVARTVRIAPRKARLVIDLIRGKQVSEAVAILRHTPKAASPIIEKVLKSAVANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           +D+DV++L+V+EAYV +   +KRF  R + R   I +  S +T++V E
Sbjct: 62  YDMDVNKLVVTEAYVNEGPTLKRFRPRAQGRASAINKRTSHITIVVSE 109


>gi|238018628|ref|ZP_04599054.1| hypothetical protein VEIDISOL_00463 [Veillonella dispar ATCC 17748]
 gi|269798545|ref|YP_003312445.1| ribosomal protein L22 [Veillonella parvula DSM 2008]
 gi|282849869|ref|ZP_06259252.1| ribosomal protein L22 [Veillonella parvula ATCC 17745]
 gi|294792799|ref|ZP_06757946.1| ribosomal protein L22 [Veillonella sp. 6_1_27]
 gi|294794553|ref|ZP_06759689.1| ribosomal protein L22 [Veillonella sp. 3_1_44]
 gi|303230135|ref|ZP_07316904.1| ribosomal protein L22 [Veillonella atypica ACS-134-V-Col7a]
 gi|303231177|ref|ZP_07317915.1| ribosomal protein L22 [Veillonella atypica ACS-049-V-Sch6]
 gi|313892919|ref|ZP_07826496.1| ribosomal protein L22 [Veillonella sp. oral taxon 158 str. F0412]
 gi|237865099|gb|EEP66389.1| hypothetical protein VEIDISOL_00463 [Veillonella dispar ATCC 17748]
 gi|269095174|gb|ACZ25165.1| ribosomal protein L22 [Veillonella parvula DSM 2008]
 gi|282580306|gb|EFB85706.1| ribosomal protein L22 [Veillonella parvula ATCC 17745]
 gi|294454883|gb|EFG23256.1| ribosomal protein L22 [Veillonella sp. 3_1_44]
 gi|294456698|gb|EFG25061.1| ribosomal protein L22 [Veillonella sp. 6_1_27]
 gi|302514084|gb|EFL56088.1| ribosomal protein L22 [Veillonella atypica ACS-049-V-Sch6]
 gi|302515196|gb|EFL57169.1| ribosomal protein L22 [Veillonella atypica ACS-134-V-Col7a]
 gi|313442272|gb|EFR60687.1| ribosomal protein L22 [Veillonella sp. oral taxon 158 str. F0412]
          Length = 111

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 47/108 (43%), Positives = 74/108 (68%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AIA  +R++P+K+ +VA ++RGK + +A A L+F+ K  A  V K + SA+ANAE+N
Sbjct: 2   EAKAIARHIRIAPRKIRIVADLVRGKNIGEAFAILKFTPKVGADVVEKVMRSAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            D++VD L VSE +V +   +KR H R R +  +I++  S +TV+V+E
Sbjct: 62  FDMNVDNLYVSEIFVDQGPTLKRIHPRSRGQAFKILKRTSHVTVVVKE 109


>gi|89893222|ref|YP_516709.1| 50S ribosomal protein L22 [Desulfitobacterium hafniense Y51]
 gi|123280216|sp|Q250M7|RL22_DESHY RecName: Full=50S ribosomal protein L22
 gi|89332670|dbj|BAE82265.1| 50S ribosomal protein L22 [Desulfitobacterium hafniense Y51]
          Length = 114

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 51/109 (46%), Positives = 69/109 (63%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
            +A AIA  +R+SP+K+  V  +IRGK VSDALA L+F+ K     V K L SAVANAE+
Sbjct: 2   QQAKAIARYVRISPRKVRQVVDLIRGKNVSDALAILQFTPKGATEPVTKVLQSAVANAEH 61

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           N+++D D LIV E YV +   +KR   R   R  +I +  S +TV+V E
Sbjct: 62  NYEMDTDALIVKEIYVDEGPTLKRIKPRAMGRADQIRKRTSHITVVVVE 110


>gi|253682297|ref|ZP_04863094.1| ribosomal protein L22 [Clostridium botulinum D str. 1873]
 gi|331268418|ref|YP_004394910.1| 50S ribosomal protein L22 [Clostridium botulinum BKT015925]
 gi|253562009|gb|EES91461.1| ribosomal protein L22 [Clostridium botulinum D str. 1873]
 gi|329124968|gb|AEB74913.1| ribosomal protein L22 [Clostridium botulinum BKT015925]
          Length = 111

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 47/108 (43%), Positives = 73/108 (67%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AIA  +R+SP+K+ +V  ++R K V++A A L+++ K  A  + K L SAVANAENN
Sbjct: 2   EARAIAKYVRISPRKIRVVLDLVRNKNVNEAFAILKYTPKDAATVILKVLKSAVANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            +LDV++L V+EAY  +   +KRF  R + R   I++  S +T++V+E
Sbjct: 62  FNLDVNKLYVAEAYANQGPTLKRFRPRAQGRAYSIMKRTSHITLVVKE 109


>gi|56961937|ref|YP_173659.1| 50S ribosomal protein L22 [Bacillus clausii KSM-K16]
 gi|81679088|sp|Q5WLQ7|RL22_BACSK RecName: Full=50S ribosomal protein L22
 gi|56908171|dbj|BAD62698.1| 50S ribosomal protein L22 [Bacillus clausii KSM-K16]
          Length = 114

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 45/108 (41%), Positives = 75/108 (69%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A A+A  +R++P+K+ LV  +IRGK+V +A+A L+ + K  +  V K L SA+ANAE+N
Sbjct: 3   QAKAVAKQVRIAPRKVRLVIDLIRGKQVGEAIAILKHTPKAASPVVEKLLNSAIANAEHN 62

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           ++++ + L++SEAYV + V +KRF  R + R  RI +  S +T++V E
Sbjct: 63  YEMEPNNLVISEAYVNEGVTLKRFRPRAQGRASRINKRTSHITLVVTE 110


>gi|254468562|ref|ZP_05081968.1| ribosomal protein L22 [beta proteobacterium KB13]
 gi|207087372|gb|EDZ64655.1| ribosomal protein L22 [beta proteobacterium KB13]
          Length = 112

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 49/110 (44%), Positives = 67/110 (60%)

Query: 12  MGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVAN 71
           M  NE +AI   +R+SPQK  LVA  +RGK+V +AL  L FS K+ A  ++K + SA+AN
Sbjct: 1   MATNEVSAILRGVRISPQKARLVADQVRGKKVDNALNILTFSPKKGAEIIKKVVESAIAN 60

Query: 72  AENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           AENN+  D+D L V    V K +  KR   R + R GRI++P   + V V
Sbjct: 61  AENNNGADIDELKVKTITVDKGMVFKRIRARAKGRAGRIIKPTCHIKVTV 110


>gi|149184137|ref|ZP_01862467.1| 50S ribosomal protein L22 [Bacillus sp. SG-1]
 gi|148848152|gb|EDL62472.1| 50S ribosomal protein L22 [Bacillus sp. SG-1]
          Length = 113

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 45/108 (41%), Positives = 73/108 (67%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A A+A  +R++P+K+ LV  +IRGK+V +A+A L  + K  +  V K L SA+ANAE+N
Sbjct: 2   QAKAVAKTVRIAPRKVRLVVDLIRGKQVGEAVAILNLTPKAASPVVEKVLKSAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           +D+DV+ L++S+A+V +   MKRF  R   R  +I +  S +T++V E
Sbjct: 62  YDMDVNNLVISDAFVNEGPTMKRFRPRAMGRASQINKRTSHITIVVSE 109


>gi|304315945|ref|YP_003851090.1| ribosomal protein L22 [Thermoanaerobacterium thermosaccharolyticum
           DSM 571]
 gi|302777447|gb|ADL68006.1| ribosomal protein L22 [Thermoanaerobacterium thermosaccharolyticum
           DSM 571]
          Length = 110

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 67/108 (62%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  +R+SPQK  LV  MIRGK V++ALA L+F+  + AG V K L SA+ANAENN
Sbjct: 2   EAKAVAKYVRISPQKAGLVMNMIRGKDVNEALAILKFTPNKAAGIVEKVLKSAIANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
             LD D L V++A   +   MKR   R   R   + R  S +TV+V E
Sbjct: 62  FGLDRDNLYVAKAVADQGPIMKRMMPRAMGRSNLMRRRTSHITVVVNE 109


>gi|23097579|ref|NP_691045.1| 50S ribosomal protein L22 [Oceanobacillus iheyensis HTE831]
 gi|51316856|sp|Q8ETX7|RL22_OCEIH RecName: Full=50S ribosomal protein L22
 gi|22775802|dbj|BAC12080.1| 50S ribosomal protein L22 [Oceanobacillus iheyensis HTE831]
          Length = 113

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 45/108 (41%), Positives = 73/108 (67%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A A+A  +R++P+K+ LV  +IRGK V +A+A L  +++  +  V K L SA+ANAE+N
Sbjct: 2   QAKAVAKSVRIAPRKVRLVVDLIRGKEVGEAIAILNHTQRGASPVVEKVLKSAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           +++D D L++SEA+V +   +KRF  R + R  RI +  S +TV+V E
Sbjct: 62  YEMDADSLVISEAFVNEGATLKRFRPRAQGRASRINKRTSHITVVVTE 109


>gi|153932380|ref|YP_001385791.1| 50S ribosomal protein L22 [Clostridium botulinum A str. ATCC 19397]
 gi|153934971|ref|YP_001389198.1| 50S ribosomal protein L22 [Clostridium botulinum A str. Hall]
 gi|153938830|ref|YP_001392829.1| 50S ribosomal protein L22 [Clostridium botulinum F str. Langeland]
 gi|168178837|ref|ZP_02613501.1| ribosomal protein L22 [Clostridium botulinum NCTC 2916]
 gi|168181869|ref|ZP_02616533.1| 50S ribosomal protein L22 [Clostridium botulinum Bf]
 gi|170760004|ref|YP_001788816.1| 50S ribosomal protein L22 [Clostridium botulinum A3 str. Loch
           Maree]
 gi|226950928|ref|YP_002806019.1| ribosomal protein L22 [Clostridium botulinum A2 str. Kyoto]
 gi|237796937|ref|YP_002864489.1| 50S ribosomal protein L22 [Clostridium botulinum Ba4 str. 657]
 gi|152928424|gb|ABS33924.1| 50S ribosomal protein L22 [Clostridium botulinum A str. ATCC 19397]
 gi|152930885|gb|ABS36384.1| 50S ribosomal protein L22 [Clostridium botulinum A str. Hall]
 gi|152934726|gb|ABS40224.1| 50S ribosomal protein L22 [Clostridium botulinum F str. Langeland]
 gi|169406993|gb|ACA55404.1| 50S ribosomal protein L22 [Clostridium botulinum A3 str. Loch
           Maree]
 gi|182670086|gb|EDT82062.1| ribosomal protein L22 [Clostridium botulinum NCTC 2916]
 gi|182674770|gb|EDT86731.1| 50S ribosomal protein L22 [Clostridium botulinum Bf]
 gi|226842734|gb|ACO85400.1| ribosomal protein L22 [Clostridium botulinum A2 str. Kyoto]
 gi|229262250|gb|ACQ53283.1| 50S ribosomal protein L22 [Clostridium botulinum Ba4 str. 657]
 gi|295320809|gb|ADG01187.1| 50S ribosomal protein L22 [Clostridium botulinum F str. 230613]
 gi|322807801|emb|CBZ05376.1| LSU ribosomal protein L22p (L17e) [Clostridium botulinum H04402
           065]
          Length = 111

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 72/108 (66%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AI   +R+SP K+ +V  ++RGK V++A A L+++ K  A  + K L SAVANAENN
Sbjct: 2   EAKAIVRYVRMSPSKIGVVLDLVRGKDVNEAFAILKYTPKDAAEVIYKALKSAVANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            +LDV+ L +SEA+VG+   +KR+    + R  RI +  S LT++V+E
Sbjct: 62  LNLDVNSLYISEAHVGQGPTLKRYQPHAQGRAFRIRKRTSHLTLVVKE 109


>gi|227499190|ref|ZP_03929325.1| 50S ribosomal protein L22 [Acidaminococcus sp. D21]
 gi|226904637|gb|EEH90555.1| 50S ribosomal protein L22 [Acidaminococcus sp. D21]
          Length = 111

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 73/108 (67%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  +R++P+KL +V  +IRGK V++A A L+++ K  +  + K L SAVANAE+N
Sbjct: 3   EAKAVAKYIRIAPRKLRIVINLIRGKSVNEAFAILKYTPKVGSEVIEKVLRSAVANAEHN 62

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            D++VD L+VS A+V +   MKR H R R +  +I++  S +TV V E
Sbjct: 63  FDMNVDNLVVSSAFVDQGPTMKRIHPRSRGQAFKILKRSSHVTVAVSE 110


>gi|253577184|ref|ZP_04854504.1| 50S ribosomal protein L22 [Paenibacillus sp. oral taxon 786 str.
           D14]
 gi|251843428|gb|EES71456.1| 50S ribosomal protein L22 [Paenibacillus sp. oral taxon 786 str.
           D14]
          Length = 110

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 47/108 (43%), Positives = 71/108 (65%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A  +R++P+K  LV  +IRGK+V DA+A L  + K  +  V K L SA+ANAE+N
Sbjct: 2   EAKAHARSIRIAPRKAQLVVDLIRGKQVGDAIAILRHTPKAASPIVEKLLNSAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           + +DV++L++++AYV +   MKRF  R   R  RI +  S +T++V E
Sbjct: 62  YSMDVNKLVITQAYVNQGPTMKRFRPRAMGRASRINKRTSHITLVVSE 109


>gi|170289178|ref|YP_001739416.1| ribosomal protein L22 [Thermotoga sp. RQ2]
 gi|281412734|ref|YP_003346813.1| ribosomal protein L22 [Thermotoga naphthophila RKU-10]
 gi|215274878|sp|B1LBN5|RL22_THESQ RecName: Full=50S ribosomal protein L22
 gi|170176681|gb|ACB09733.1| ribosomal protein L22 [Thermotoga sp. RQ2]
 gi|281373837|gb|ADA67399.1| ribosomal protein L22 [Thermotoga naphthophila RKU-10]
          Length = 159

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 67/112 (59%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  +R+SP+K   +A  IRGK V +A   L FS K+ A  + K L SAVANAENN
Sbjct: 30  EAKAVARYIRISPRKARAIANTIRGKSVEEAFQILAFSPKKAARIMEKVLKSAVANAENN 89

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
             L V+ L VSE YV     MKR   RGR R   I +  S +TV+VR+ S E
Sbjct: 90  FGLSVENLYVSECYVNDGPRMKRIWPRGRGRADIIQKRMSHITVVVRDRSKE 141


>gi|313884456|ref|ZP_07818217.1| ribosomal protein L22 [Eremococcus coleocola ACS-139-V-Col8]
 gi|312620240|gb|EFR31668.1| ribosomal protein L22 [Eremococcus coleocola ACS-139-V-Col8]
          Length = 118

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 70/107 (65%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A A  +R++P+K+ LV  +IRGK V +A+A L+F+ K  +  V K L SA+ANAE+N+
Sbjct: 8   ATATAKTVRIAPRKVRLVVDLIRGKSVGEAIAILKFTPKAGSPVVEKVLMSAIANAEHNY 67

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           DLD++ L VSEAYV +   +KR+  R +     I +  S +TV+V E
Sbjct: 68  DLDLENLYVSEAYVNEGPTLKRYRPRAKGSASAINKRTSHITVVVSE 114


>gi|215274934|sp|Q2GH51|RL22_EHRCR RecName: Full=50S ribosomal protein L22
          Length = 114

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 66/100 (66%)

Query: 24  LRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRL 83
           L+ +P KLNLVA +IRGK VS A+  L+F RK+ AG + K L SAVANA+ N+++D+D L
Sbjct: 13  LKSTPSKLNLVADLIRGKDVSVAMMYLKFCRKKSAGYISKVLKSAVANAQANYNIDLDNL 72

Query: 84  IVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            V E  VGKS  ++R H R R +  R+ + +  + + + E
Sbjct: 73  YVKEVLVGKSFSLRRIHARARGKACRVYKHYGNVIIKLFE 112


>gi|224477215|ref|YP_002634821.1| 50S ribosomal protein L22 [Staphylococcus carnosus subsp. carnosus
           TM300]
 gi|254800459|sp|B9DM42|RL22_STACT RecName: Full=50S ribosomal protein L22
 gi|222421822|emb|CAL28636.1| 50S ribosomal protein L22 [Staphylococcus carnosus subsp. carnosus
           TM300]
          Length = 117

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 73/114 (64%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  +R++P+K+ LV  +IRGK V +A+A L+ + K  +  V K L SA+ANAE+N
Sbjct: 2   EAKAVARTIRIAPRKVRLVLDLIRGKNVGEAIAILKLTNKASSPVVEKLLMSALANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEGK 129
           +D++ D L+V EAY  +   +KRF  R + R   I +  S +T++V +  +E K
Sbjct: 62  YDMNTDELVVKEAYANEGPTLKRFRPRAQGRASAINKRTSHITIVVSDGKEEAK 115


>gi|251799637|ref|YP_003014368.1| ribosomal protein L22 [Paenibacillus sp. JDR-2]
 gi|247547263|gb|ACT04282.1| ribosomal protein L22 [Paenibacillus sp. JDR-2]
          Length = 111

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 46/108 (42%), Positives = 73/108 (67%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A+ +R++P+K  LVA +IRGK+V +A+A L  + K  +  + K L SA+ANAE+N
Sbjct: 3   EAKAHANFVRIAPRKAQLVADLIRGKQVGEAIAILRHTPKSASPILEKLLNSAIANAEHN 62

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           + LDV++L++++A+V +   MKRF  R   R  RI +  S +T++V E
Sbjct: 63  YQLDVNKLVITQAFVNQGPTMKRFRPRAMGRASRINKRTSHITLVVSE 110


>gi|88657665|ref|YP_507232.1| 50S ribosomal protein L22 [Ehrlichia chaffeensis str. Arkansas]
 gi|88599122|gb|ABD44591.1| ribosomal protein L22 [Ehrlichia chaffeensis str. Arkansas]
          Length = 110

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 66/100 (66%)

Query: 24  LRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRL 83
           L+ +P KLNLVA +IRGK VS A+  L+F RK+ AG + K L SAVANA+ N+++D+D L
Sbjct: 9   LKSTPSKLNLVADLIRGKDVSVAMMYLKFCRKKSAGYISKVLKSAVANAQANYNIDLDNL 68

Query: 84  IVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            V E  VGKS  ++R H R R +  R+ + +  + + + E
Sbjct: 69  YVKEVLVGKSFSLRRIHARARGKACRVYKHYGNVIIKLFE 108


>gi|227202712|dbj|BAH56829.1| AT4G28360 [Arabidopsis thaliana]
          Length = 197

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 47/105 (44%), Positives = 68/105 (64%), Gaps = 2/105 (1%)

Query: 2   SGKRSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEV 61
           SGK    K      +  A+   ++ SP+K+NLVAA++RG RV DAL  L+ + KR A  V
Sbjct: 92  SGKEEEQKIIPKRQKVQAVLKSIKQSPKKVNLVAALVRGMRVEDALIQLQVTVKRAAQTV 151

Query: 62  RKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKR--FHCRGR 104
            + + +A ANA +NH LD DRL+V+EA+VGK +F K+  +H +GR
Sbjct: 152 YRVIHAARANATHNHGLDPDRLLVAEAFVGKGLFGKKVAYHAKGR 196


>gi|239618260|ref|YP_002941582.1| ribosomal protein L22 [Kosmotoga olearia TBF 19.5.1]
 gi|239507091|gb|ACR80578.1| ribosomal protein L22 [Kosmotoga olearia TBF 19.5.1]
          Length = 153

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 68/114 (59%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  +R+SP+K   V   IRGK V +A   LEFS K+ A  V K L SAVANAENN
Sbjct: 28  EARAVARYIRISPRKARAVVNAIRGKSVGEAFQILEFSPKKAARIVSKVLRSAVANAENN 87

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEGK 129
             L+VD L VS A V     MKR   RGR R   + + FS +T++VR+   E +
Sbjct: 88  FGLNVDTLYVSHAVVDDGPRMKRLWPRGRGRADILQKRFSHITIVVRDSEKETQ 141


>gi|148270427|ref|YP_001244887.1| 50S ribosomal protein L22 [Thermotoga petrophila RKU-1]
 gi|215274877|sp|A5IM88|RL22_THEP1 RecName: Full=50S ribosomal protein L22
 gi|147735971|gb|ABQ47311.1| LSU ribosomal protein L22P [Thermotoga petrophila RKU-1]
          Length = 159

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 67/112 (59%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  +R+SP+K   +A  IRGK V +A   L FS K+ A  + K L SAVANAENN
Sbjct: 30  EAKAVARYIRISPRKARAIANTIRGKSVEEAFQILAFSPKKAARIMEKVLKSAVANAENN 89

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
             L V+ L VSE YV     MKR   RGR R   I +  S +T++VR+ S E
Sbjct: 90  FGLSVENLYVSECYVNDGPRMKRIWPRGRGRADIIQKRMSHITIVVRDRSKE 141


>gi|116748995|ref|YP_845682.1| 50S ribosomal protein L22 [Syntrophobacter fumaroxidans MPOB]
 gi|166222007|sp|A0LIJ5|RL22_SYNFM RecName: Full=50S ribosomal protein L22
 gi|116698059|gb|ABK17247.1| LSU ribosomal protein L22P [Syntrophobacter fumaroxidans MPOB]
          Length = 110

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 68/108 (62%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A++  LRVSP K  LVA ++RGK+VSDAL  L+F+ K+    + KTL SAVANAEN 
Sbjct: 2   EVRAVSKFLRVSPHKARLVADLVRGKKVSDALTILKFTPKKSGRFINKTLRSAVANAENT 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
             +DV+ L V   +V K   +KR+  R   R  +I++  S +T+I+ E
Sbjct: 62  KSMDVETLFVKSIFVDKGPQLKRWRPRAMGRATKILKGSSHITIILAE 109


>gi|15644243|ref|NP_229295.1| 50S ribosomal protein L22 [Thermotoga maritima MSB8]
 gi|6226688|sp|P38511|RL22_THEMA RecName: Full=50S ribosomal protein L22
 gi|4982059|gb|AAD36561.1|AE001798_26 ribosomal protein L22 [Thermotoga maritima MSB8]
          Length = 159

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 67/112 (59%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  +R+SP+K   +A  IRGK V +A   L FS K+ A  + K L SAVANAENN
Sbjct: 30  EARAVAKYIRISPRKARAIANTIRGKSVEEAFQILAFSPKKAARIMEKVLKSAVANAENN 89

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
             L V+ L VSE YV     MKR   RGR R   I +  S +TV+VR+ S E
Sbjct: 90  FGLSVENLYVSECYVNDGPRMKRIWPRGRGRADIIQKRMSHITVVVRDRSRE 141


>gi|313680510|ref|YP_004058249.1| LSU ribosomal protein l22p [Oceanithermus profundus DSM 14977]
 gi|313153225|gb|ADR37076.1| LSU ribosomal protein L22P [Oceanithermus profundus DSM 14977]
          Length = 112

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 68/108 (62%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  +R+SP+K+ LV  +IRGK   +A   L+++ KR A  VRK L SAVANA NN
Sbjct: 2   EAKAVAKYIRMSPRKVRLVVDLIRGKSADEADQILKYTNKRAAHAVRKVLKSAVANAVNN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           HDL  D+L+V  AYV +   +KR   R R R   I +  S +TVIV E
Sbjct: 62  HDLLEDQLVVKAAYVDEGPTLKRILPRARGRADIIKKRTSHITVIVEE 109


>gi|229823530|ref|ZP_04449599.1| hypothetical protein GCWU000282_00828 [Catonella morbi ATCC 51271]
 gi|229786974|gb|EEP23088.1| hypothetical protein GCWU000282_00828 [Catonella morbi ATCC 51271]
          Length = 118

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 71/107 (66%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A+A  +R++P+K+ LV  +IRGK+V +A+A L+F+ K  A  V K L SA+ANA++N+
Sbjct: 8   AKAVARTVRIAPRKVRLVLDLIRGKKVGEAIAILKFTPKAGAPIVEKVLMSAIANADHNY 67

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           DLD++ L VSEA+  +   MKRF  R +     I +  S +TV+V E
Sbjct: 68  DLDLENLYVSEAFANEGPTMKRFRPRAKGSASPINKRTSHITVVVSE 114


>gi|225175669|ref|ZP_03729663.1| ribosomal protein L22 [Dethiobacter alkaliphilus AHT 1]
 gi|225168998|gb|EEG77798.1| ribosomal protein L22 [Dethiobacter alkaliphilus AHT 1]
          Length = 113

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 46/113 (40%), Positives = 73/113 (64%), Gaps = 1/113 (0%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  +R+SP+K  LV   IRG+   +A+A L+ +  + A  + K L SAVANAE+N
Sbjct: 2   EAKAVAKYIRMSPRKARLVVDQIRGRNAQEAMAILKMTPNKPAEPIYKVLHSAVANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           ++++ D L V++A+V +   +KRF  R R    RI +P S +T+++RE + EG
Sbjct: 62  YEMNKDNLYVAQAFVDQGPVLKRFRPRARGMASRIRKPTSHITIVLRE-NKEG 113


>gi|251812052|ref|ZP_04826525.1| 50S ribosomal protein L22 [Staphylococcus epidermidis BCM-HMP0060]
 gi|251804386|gb|EES57043.1| 50S ribosomal protein L22 [Staphylococcus epidermidis BCM-HMP0060]
          Length = 117

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/114 (38%), Positives = 73/114 (64%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  +R++P+K+ LV  +IRGK+  +A+A L+ + K  +  + K L SA+ANAE+N
Sbjct: 2   EAKAVARTIRIAPRKVRLVLDLIRGKKAGEAIAILKLTNKASSPVIEKVLMSALANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEGK 129
           +D++ D L+V EAY  +   +KRF  R + R   I +  S +T++V +  +E K
Sbjct: 62  YDMNTDELVVKEAYANEGPTLKRFRPRAQGRASAINKRTSHITIVVSDGKEEAK 115


>gi|205372064|ref|ZP_03224881.1| 50S ribosomal protein L22 [Bacillus coahuilensis m4-4]
          Length = 113

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 45/108 (41%), Positives = 75/108 (69%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A A+A  +R++P+K+ LVA +IRGK+V +A+A L+ + K  +  V K L SA+ANAE+N
Sbjct: 2   QAKAVARTVRIAPRKVRLVADLIRGKQVGEAIAILKHTPKAASPVVEKVLNSALANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           +++D++ L+VSEA+V +   +KRF  R   R  +I +  S +T++V E
Sbjct: 62  YNMDLENLVVSEAFVNEGPTLKRFRPRAMGRASQINKRTSHITIVVSE 109


>gi|16801837|ref|NP_472105.1| 50S ribosomal protein L22 [Listeria innocua Clip11262]
 gi|16804665|ref|NP_466150.1| 50S ribosomal protein L22 [Listeria monocytogenes EGD-e]
 gi|46908799|ref|YP_015188.1| 50S ribosomal protein L22 [Listeria monocytogenes str. 4b F2365]
 gi|116873993|ref|YP_850774.1| 50S ribosomal protein L22 [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|217966174|ref|YP_002351852.1| ribosomal protein L22 [Listeria monocytogenes HCC23]
 gi|224499300|ref|ZP_03667649.1| 50S ribosomal protein L22 [Listeria monocytogenes Finland 1988]
 gi|224503579|ref|ZP_03671886.1| 50S ribosomal protein L22 [Listeria monocytogenes FSL R2-561]
 gi|226225172|ref|YP_002759279.1| ribosomal protein L22 [Listeria monocytogenes Clip81459]
 gi|254825012|ref|ZP_05230013.1| ribosomal protein L22 [Listeria monocytogenes FSL J1-194]
 gi|254829076|ref|ZP_05233763.1| rplV [Listeria monocytogenes FSL N3-165]
 gi|254830941|ref|ZP_05235596.1| 50S ribosomal protein L22 [Listeria monocytogenes 10403S]
 gi|254854167|ref|ZP_05243515.1| ribosomal protein L22 [Listeria monocytogenes FSL R2-503]
 gi|254899922|ref|ZP_05259846.1| 50S ribosomal protein L22 [Listeria monocytogenes J0161]
 gi|254912872|ref|ZP_05262884.1| 50S ribosomal protein L22 [Listeria monocytogenes J2818]
 gi|254931103|ref|ZP_05264462.1| ribosomal protein L22 [Listeria monocytogenes HPB2262]
 gi|254937252|ref|ZP_05268949.1| rplV [Listeria monocytogenes F6900]
 gi|254991849|ref|ZP_05274039.1| 50S ribosomal protein L22 [Listeria monocytogenes FSL J2-064]
 gi|255017223|ref|ZP_05289349.1| 50S ribosomal protein L22 [Listeria monocytogenes FSL F2-515]
 gi|255023226|ref|ZP_05295212.1| 50S ribosomal protein L22 [Listeria monocytogenes FSL J1-208]
 gi|255026654|ref|ZP_05298640.1| 50S ribosomal protein L22 [Listeria monocytogenes FSL J2-003]
 gi|255519645|ref|ZP_05386882.1| 50S ribosomal protein L22 [Listeria monocytogenes FSL J1-175]
 gi|284800487|ref|YP_003412352.1| 50S ribosomal protein L22 [Listeria monocytogenes 08-5578]
 gi|284993673|ref|YP_003415441.1| 50S ribosomal protein L22 [Listeria monocytogenes 08-5923]
 gi|289435893|ref|YP_003465765.1| hypothetical protein lse_2532 [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|290891812|ref|ZP_06554809.1| ribosomal protein L22 [Listeria monocytogenes FSL J2-071]
 gi|300763622|ref|ZP_07073620.1| ribosomal protein L22 [Listeria monocytogenes FSL N1-017]
 gi|315283843|ref|ZP_07871903.1| ribosomal protein L22 [Listeria marthii FSL S4-120]
 gi|51316259|sp|Q71WF1|RL22_LISMF RecName: Full=50S ribosomal protein L22
 gi|51316303|sp|Q7ANU3|RL22_LISIN RecName: Full=50S ribosomal protein L22
 gi|51316509|sp|Q927L2|RL22_LISMO RecName: Full=50S ribosomal protein L22
 gi|123458738|sp|A0ALW3|RL22_LISW6 RecName: Full=50S ribosomal protein L22
 gi|254800444|sp|B8DB13|RL22_LISMH RecName: Full=50S ribosomal protein L22
 gi|259646251|sp|C1KZH5|RL22_LISMC RecName: Full=50S ribosomal protein L22
 gi|16412115|emb|CAD00705.1| ribosomal protein L22 [Listeria monocytogenes EGD-e]
 gi|16415312|emb|CAC98002.1| ribosomal protein L22 [Listeria innocua Clip11262]
 gi|46882072|gb|AAT05365.1| ribosomal protein L22 [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|116742871|emb|CAK21995.1| ribosomal protein L22 [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|217335444|gb|ACK41238.1| ribosomal protein L22 [Listeria monocytogenes HCC23]
 gi|225877634|emb|CAS06348.1| ribosomal protein L22 [Listeria monocytogenes serotype 4b str. CLIP
           80459]
 gi|258601486|gb|EEW14811.1| rplV [Listeria monocytogenes FSL N3-165]
 gi|258607559|gb|EEW20167.1| ribosomal protein L22 [Listeria monocytogenes FSL R2-503]
 gi|258609858|gb|EEW22466.1| rplV [Listeria monocytogenes F6900]
 gi|284056049|gb|ADB66990.1| 50S ribosomal protein L22 [Listeria monocytogenes 08-5578]
 gi|284059140|gb|ADB70079.1| 50S ribosomal protein L22 [Listeria monocytogenes 08-5923]
 gi|289172137|emb|CBH28683.1| rplV [Listeria seeligeri serovar 1/2b str. SLCC3954]
 gi|290558406|gb|EFD91923.1| ribosomal protein L22 [Listeria monocytogenes FSL J2-071]
 gi|293582650|gb|EFF94682.1| ribosomal protein L22 [Listeria monocytogenes HPB2262]
 gi|293590871|gb|EFF99205.1| 50S ribosomal protein L22 [Listeria monocytogenes J2818]
 gi|293594253|gb|EFG02014.1| ribosomal protein L22 [Listeria monocytogenes FSL J1-194]
 gi|300515899|gb|EFK42948.1| ribosomal protein L22 [Listeria monocytogenes FSL N1-017]
 gi|307572216|emb|CAR85395.1| rplV [Listeria monocytogenes L99]
 gi|313606533|gb|EFR83355.1| ribosomal protein L22 [Listeria monocytogenes FSL F2-208]
 gi|313612513|gb|EFR86595.1| ribosomal protein L22 [Listeria marthii FSL S4-120]
 gi|313622221|gb|EFR92743.1| ribosomal protein L22 [Listeria innocua FSL J1-023]
 gi|313636117|gb|EFS01989.1| ribosomal protein L22 [Listeria seeligeri FSL S4-171]
 gi|328468112|gb|EGF39118.1| 50S ribosomal protein L22 [Listeria monocytogenes 1816]
 gi|328469800|gb|EGF40717.1| 50S ribosomal protein L22 [Listeria monocytogenes 220]
          Length = 118

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 74/110 (67%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A+A  +R++P+K  +V  +IRGK+V +A+A L+++ +  +  + K L SA+ANAE+N+
Sbjct: 8   AKAVAKTVRIAPRKARIVIDLIRGKQVGEAIAILKYTPRSASPIIEKVLKSAIANAEHNY 67

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           DLD++ L+V EA+V +   +KRF  R + R   I +  S +TV+V EV +
Sbjct: 68  DLDINNLVVEEAFVDEGPTLKRFRPRAQGRASAINKRTSHITVVVSEVKE 117


>gi|330839321|ref|YP_004413901.1| ribosomal protein L22 [Selenomonas sputigena ATCC 35185]
 gi|329747085|gb|AEC00442.1| ribosomal protein L22 [Selenomonas sputigena ATCC 35185]
          Length = 110

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 46/108 (42%), Positives = 71/108 (65%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A  +R++P+K+ +V  +IRGK +++A A L+F+ K  A  + K L SAV+NAENN
Sbjct: 2   EAKATAKYVRIAPRKVRVVMDLIRGKNIAEAFAILKFTPKIGADVIEKVLKSAVSNAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            D++VD+L +  AYV +   +KR H R R +  +I++  S +TV V E
Sbjct: 62  FDMNVDKLYIKTAYVDQGPTLKRIHPRSRGQAFKILKRTSHVTVAVEE 109


>gi|220930970|ref|YP_002507878.1| ribosomal protein L22 [Halothermothrix orenii H 168]
 gi|254800441|sp|B8D0C9|RL22_HALOH RecName: Full=50S ribosomal protein L22
 gi|219992280|gb|ACL68883.1| ribosomal protein L22 [Halothermothrix orenii H 168]
          Length = 113

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 47/108 (43%), Positives = 69/108 (63%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  +RVSP+K   V  +IRGK + +AL  L+ + K+ +  + K L SA+ANAENN
Sbjct: 2   EARAVAKYVRVSPRKARQVIDLIRGKEIGEALGILKHTPKKASSIIEKVLNSAIANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           HD+ V+ L VS+AYV +   MKR+  R   + G I +  S +T++V E
Sbjct: 62  HDMMVEDLYVSKAYVDEGPTMKRYRARAMGQAGLIRKRTSHITIVVSE 109


>gi|121534640|ref|ZP_01666461.1| ribosomal protein L22 [Thermosinus carboxydivorans Nor1]
 gi|121306660|gb|EAX47581.1| ribosomal protein L22 [Thermosinus carboxydivorans Nor1]
          Length = 110

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 47/108 (43%), Positives = 72/108 (66%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  +R++P+K+ +V  +IRGK V +A A L+ + K  +  V K L SAVANAE+N
Sbjct: 2   EARAVAKYIRIAPRKVRIVIDLIRGKNVGEAFAILKHTPKVASEVVAKVLKSAVANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            D++ D L V+EAYV +   +KR H R R +  +I++  S +TV+V+E
Sbjct: 62  FDMNADNLYVAEAYVDQGPTLKRIHPRSRGQAFKILKRTSHVTVVVKE 109


>gi|261409516|ref|YP_003245757.1| 50S ribosomal protein L22 [Paenibacillus sp. Y412MC10]
 gi|261285979|gb|ACX67950.1| ribosomal protein L22 [Paenibacillus sp. Y412MC10]
          Length = 110

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 70/108 (64%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A  +R++P+K  LV  +IRGK+V +A+A L  + K  +  V K L SA+ANAE+N
Sbjct: 2   EAKAHARSIRIAPRKAQLVVDLIRGKQVGEAIAILRHTPKAASPVVEKLLNSAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           + LDV +L+V++AYV +   MKRF  R   R  RI +  S +T++V E
Sbjct: 62  YSLDVTKLVVTQAYVNQGPTMKRFRPRAMGRASRINKRTSHITLVVAE 109


>gi|297582455|ref|YP_003698235.1| 50S ribosomal protein L22 [Bacillus selenitireducens MLS10]
 gi|297140912|gb|ADH97669.1| ribosomal protein L22 [Bacillus selenitireducens MLS10]
          Length = 113

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 44/108 (40%), Positives = 74/108 (68%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  +R++P+K+ LV  +IRGK V +A++ L  + K+ +  V K L SA+ANAE+N
Sbjct: 2   EAKAVAKQVRIAPRKVRLVIDLIRGKEVGEAISILNHTPKKASPVVEKLLNSAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           ++++ D L+VS+A+V + V +KRF  R + R  RI +  S +T+++ E
Sbjct: 62  YEMEPDNLVVSQAFVDEGVTLKRFRPRAQGRASRINKRTSHITLVLTE 109


>gi|15925235|ref|NP_372769.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|15927825|ref|NP_375358.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           N315]
 gi|21283893|ref|NP_646981.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus MW2]
 gi|49484461|ref|YP_041685.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|49487027|ref|YP_044248.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|57650829|ref|YP_187044.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus COL]
 gi|82751834|ref|YP_417575.1| 50S ribosomal protein L22 [Staphylococcus aureus RF122]
 gi|87160513|ref|YP_494834.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|88196157|ref|YP_500974.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus NCTC
           8325]
 gi|148268685|ref|YP_001247628.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus JH9]
 gi|150394750|ref|YP_001317425.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus JH1]
 gi|151222359|ref|YP_001333181.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus str.
           Newman]
 gi|156980560|ref|YP_001442819.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus Mu3]
 gi|221140153|ref|ZP_03564646.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus str.
           JKD6009]
 gi|242371892|ref|ZP_04817466.1| 50S ribosomal protein L22 [Staphylococcus epidermidis M23864:W1]
 gi|253317005|ref|ZP_04840218.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus str.
           CF-Marseille]
 gi|253729911|ref|ZP_04864076.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253734346|ref|ZP_04868511.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|255007025|ref|ZP_05145626.2| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           Mu50-omega]
 gi|257423730|ref|ZP_05600159.1| ribosomal protein L22 [Staphylococcus aureus subsp. aureus 55/2053]
 gi|257426408|ref|ZP_05602810.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257429047|ref|ZP_05605434.1| LSU ribosomal protein L22P [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257431693|ref|ZP_05608056.1| LSU ribosomal protein L22P [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257434654|ref|ZP_05610705.1| LSU ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           M876]
 gi|257794591|ref|ZP_05643570.1| 50S ribosomal protein L22 [Staphylococcus aureus A9781]
 gi|258408807|ref|ZP_05681091.1| 50S ribosomal protein L22 [Staphylococcus aureus A9763]
 gi|258422406|ref|ZP_05685318.1| LSU ribosomal protein L22 [Staphylococcus aureus A9719]
 gi|258422692|ref|ZP_05685597.1| LSU ribosomal protein L22 [Staphylococcus aureus A9635]
 gi|258439795|ref|ZP_05690541.1| ribosomal protein L22 [Staphylococcus aureus A9299]
 gi|258442649|ref|ZP_05691209.1| 50S ribosomal protein L22 [Staphylococcus aureus A8115]
 gi|258446652|ref|ZP_05694807.1| 50S ribosomal protein L22 [Staphylococcus aureus A6300]
 gi|258450230|ref|ZP_05698322.1| ribosomal protein L22 [Staphylococcus aureus A6224]
 gi|258450760|ref|ZP_05698819.1| 50S ribosomal protein L22 [Staphylococcus aureus A5948]
 gi|258455398|ref|ZP_05703358.1| 50S ribosomal protein L22 [Staphylococcus aureus A5937]
 gi|262048509|ref|ZP_06021393.1| 50S ribosomal protein L22 [Staphylococcus aureus D30]
 gi|262052034|ref|ZP_06024245.1| 50S ribosomal protein L22 [Staphylococcus aureus 930918-3]
 gi|269203878|ref|YP_003283147.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           ED98]
 gi|282893683|ref|ZP_06301915.1| 50S ribosomal protein L22 [Staphylococcus aureus A8117]
 gi|282902148|ref|ZP_06310041.1| ribosomal protein L22 [Staphylococcus aureus subsp. aureus C160]
 gi|282906588|ref|ZP_06314436.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282909558|ref|ZP_06317369.1| ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282915094|ref|ZP_06322871.1| ribosomal protein L22 [Staphylococcus aureus subsp. aureus M899]
 gi|282917590|ref|ZP_06325342.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           D139]
 gi|282920820|ref|ZP_06328538.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           C427]
 gi|282922114|ref|ZP_06329810.1| 50S ribosomal protein L22 [Staphylococcus aureus A9765]
 gi|282925725|ref|ZP_06333373.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           C101]
 gi|282926791|ref|ZP_06334418.1| 50S ribosomal protein L22 [Staphylococcus aureus A10102]
 gi|283767337|ref|ZP_06340252.1| large subunit ribosomal protein L22 [Staphylococcus aureus subsp.
           aureus H19]
 gi|283959023|ref|ZP_06376464.1| ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|284025271|ref|ZP_06379669.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus 132]
 gi|289550148|ref|YP_003471052.1| LSU ribosomal protein L22p (L17e) [Staphylococcus lugdunensis
           HKU09-01]
 gi|293497498|ref|ZP_06665352.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           58-424]
 gi|293511073|ref|ZP_06669770.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           M809]
 gi|293549679|ref|ZP_06672351.1| ribosomal protein L22 [Staphylococcus aureus subsp. aureus M1015]
 gi|294848778|ref|ZP_06789523.1| 50S ribosomal protein L22 [Staphylococcus aureus A9754]
 gi|295404921|ref|ZP_06814734.1| 50S ribosomal protein L22 [Staphylococcus aureus A8819]
 gi|295428828|ref|ZP_06821452.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|296275964|ref|ZP_06858471.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus MR1]
 gi|297209942|ref|ZP_06926338.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|297243979|ref|ZP_06927869.1| 50S ribosomal protein L22 [Staphylococcus aureus A8796]
 gi|297589686|ref|ZP_06948327.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus MN8]
 gi|300910954|ref|ZP_07128404.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|304379429|ref|ZP_07362164.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|315659222|ref|ZP_07912086.1| 50S ribosomal protein L22 [Staphylococcus lugdunensis M23590]
 gi|51316729|sp|Q7A079|RL22_STAAW RecName: Full=50S ribosomal protein L22
 gi|51316730|sp|Q7A460|RL22_STAAN RecName: Full=50S ribosomal protein L22
 gi|51316907|sp|Q99S26|RL22_STAAM RecName: Full=50S ribosomal protein L22
 gi|56749500|sp|Q6G776|RL22_STAAS RecName: Full=50S ribosomal protein L22
 gi|56749547|sp|Q6GEI8|RL22_STAAR RecName: Full=50S ribosomal protein L22
 gi|81693963|sp|Q5HDW3|RL22_STAAC RecName: Full=50S ribosomal protein L22
 gi|109893240|sp|Q2FEP4|RL22_STAA3 RecName: Full=50S ribosomal protein L22
 gi|109893241|sp|Q2YYQ1|RL22_STAAB RecName: Full=50S ribosomal protein L22
 gi|123098006|sp|Q2FW11|RL22_STAA8 RecName: Full=50S ribosomal protein L22
 gi|166222000|sp|A7X5F6|RL22_STAA1 RecName: Full=50S ribosomal protein L22
 gi|172049043|sp|A6QJ87|RL22_STAAE RecName: Full=50S ribosomal protein L22
 gi|189041969|sp|A6U3X0|RL22_STAA2 RecName: Full=50S ribosomal protein L22
 gi|189041970|sp|A5IV29|RL22_STAA9 RecName: Full=50S ribosomal protein L22
 gi|13702045|dbj|BAB43337.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           N315]
 gi|14248018|dbj|BAB58407.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|21205335|dbj|BAB96029.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus MW2]
 gi|49242590|emb|CAG41311.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|49245470|emb|CAG43947.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|57285015|gb|AAW37109.1| ribosomal protein L22 [Staphylococcus aureus subsp. aureus COL]
 gi|82657365|emb|CAI81806.1| 50S ribosomal protein L22 [Staphylococcus aureus RF122]
 gi|87126487|gb|ABD21001.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|87203715|gb|ABD31525.1| ribosomal protein L22 [Staphylococcus aureus subsp. aureus NCTC
           8325]
 gi|147741754|gb|ABQ50052.1| LSU ribosomal protein L22P [Staphylococcus aureus subsp. aureus
           JH9]
 gi|149947202|gb|ABR53138.1| ribosomal protein L22 [Staphylococcus aureus subsp. aureus JH1]
 gi|150375159|dbj|BAF68419.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus str.
           Newman]
 gi|156722695|dbj|BAF79112.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus Mu3]
 gi|242350399|gb|EES42000.1| 50S ribosomal protein L22 [Staphylococcus epidermidis M23864:W1]
 gi|253726358|gb|EES95087.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253727663|gb|EES96392.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|257272748|gb|EEV04850.1| ribosomal protein L22 [Staphylococcus aureus subsp. aureus 55/2053]
 gi|257276039|gb|EEV07490.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257279528|gb|EEV10115.1| LSU ribosomal protein L22P [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257282572|gb|EEV12704.1| LSU ribosomal protein L22P [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257285250|gb|EEV15366.1| LSU ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           M876]
 gi|257788563|gb|EEV26903.1| 50S ribosomal protein L22 [Staphylococcus aureus A9781]
 gi|257840490|gb|EEV64950.1| 50S ribosomal protein L22 [Staphylococcus aureus A9763]
 gi|257841837|gb|EEV66274.1| LSU ribosomal protein L22 [Staphylococcus aureus A9719]
 gi|257847103|gb|EEV71112.1| LSU ribosomal protein L22 [Staphylococcus aureus A9635]
 gi|257847571|gb|EEV71573.1| ribosomal protein L22 [Staphylococcus aureus A9299]
 gi|257851770|gb|EEV75704.1| 50S ribosomal protein L22 [Staphylococcus aureus A8115]
 gi|257854720|gb|EEV77668.1| 50S ribosomal protein L22 [Staphylococcus aureus A6300]
 gi|257856322|gb|EEV79231.1| ribosomal protein L22 [Staphylococcus aureus A6224]
 gi|257861543|gb|EEV84345.1| 50S ribosomal protein L22 [Staphylococcus aureus A5948]
 gi|257862609|gb|EEV85377.1| 50S ribosomal protein L22 [Staphylococcus aureus A5937]
 gi|259160089|gb|EEW45122.1| 50S ribosomal protein L22 [Staphylococcus aureus 930918-3]
 gi|259163367|gb|EEW47925.1| 50S ribosomal protein L22 [Staphylococcus aureus D30]
 gi|262076168|gb|ACY12141.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           ED98]
 gi|269941834|emb|CBI50244.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           TW20]
 gi|282312554|gb|EFB42958.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           C101]
 gi|282315235|gb|EFB45619.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           C427]
 gi|282318552|gb|EFB48910.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           D139]
 gi|282320815|gb|EFB51149.1| ribosomal protein L22 [Staphylococcus aureus subsp. aureus M899]
 gi|282326537|gb|EFB56839.1| ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282329487|gb|EFB59008.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282591242|gb|EFB96315.1| 50S ribosomal protein L22 [Staphylococcus aureus A10102]
 gi|282593582|gb|EFB98575.1| 50S ribosomal protein L22 [Staphylococcus aureus A9765]
 gi|282596607|gb|EFC01566.1| ribosomal protein L22 [Staphylococcus aureus subsp. aureus C160]
 gi|282763741|gb|EFC03869.1| 50S ribosomal protein L22 [Staphylococcus aureus A8117]
 gi|283461216|gb|EFC08300.1| large subunit ribosomal protein L22 [Staphylococcus aureus subsp.
           aureus H19]
 gi|283471467|emb|CAQ50678.1| ribosomal protein L22 [Staphylococcus aureus subsp. aureus ST398]
 gi|283788615|gb|EFC27442.1| ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|285817907|gb|ADC38394.1| 50S ribosomal protein L22 [Staphylococcus aureus 04-02981]
 gi|289179680|gb|ADC86925.1| LSU ribosomal protein L22p (L17e) [Staphylococcus lugdunensis
           HKU09-01]
 gi|290918726|gb|EFD95802.1| ribosomal protein L22 [Staphylococcus aureus subsp. aureus M1015]
 gi|291096429|gb|EFE26687.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           58-424]
 gi|291466060|gb|EFF08589.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           M809]
 gi|294824157|gb|EFG40581.1| 50S ribosomal protein L22 [Staphylococcus aureus A9754]
 gi|294969866|gb|EFG45884.1| 50S ribosomal protein L22 [Staphylococcus aureus A8819]
 gi|295127177|gb|EFG56819.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|296885615|gb|EFH24552.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|297178757|gb|EFH38002.1| 50S ribosomal protein L22 [Staphylococcus aureus A8796]
 gi|297578197|gb|EFH96910.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus MN8]
 gi|300887934|gb|EFK83129.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|302333881|gb|ADL24074.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           JKD6159]
 gi|302752118|gb|ADL66295.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus str.
           JKD6008]
 gi|304341961|gb|EFM07865.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|312830594|emb|CBX35436.1| ribosomal protein L22 [Staphylococcus aureus subsp. aureus ECT-R 2]
 gi|315129675|gb|EFT85666.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           CGS03]
 gi|315193497|gb|EFU23893.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           CGS00]
 gi|315198225|gb|EFU28556.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           CGS01]
 gi|315495647|gb|EFU83978.1| 50S ribosomal protein L22 [Staphylococcus lugdunensis M23590]
 gi|320140217|gb|EFW32076.1| ribosomal protein L22 [Staphylococcus aureus subsp. aureus MRSA131]
 gi|320143487|gb|EFW35268.1| ribosomal protein L22 [Staphylococcus aureus subsp. aureus MRSA177]
 gi|323440075|gb|EGA97790.1| 50S ribosomal protein L22 [Staphylococcus aureus O11]
 gi|323442749|gb|EGB00375.1| 50S ribosomal protein L22 [Staphylococcus aureus O46]
 gi|329314928|gb|AEB89341.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           T0131]
 gi|329723634|gb|EGG60163.1| ribosomal protein L22 [Staphylococcus aureus subsp. aureus 21172]
 gi|329730309|gb|EGG66699.1| ribosomal protein L22 [Staphylococcus aureus subsp. aureus 21193]
 gi|329732018|gb|EGG68373.1| ribosomal protein L22 [Staphylococcus aureus subsp. aureus 21189]
          Length = 117

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 44/114 (38%), Positives = 73/114 (64%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  +R++P+K+ LV  +IRGK  ++A+A L+ + K  +  + K L SA+ANAE+N
Sbjct: 2   EAKAVARTIRIAPRKVRLVLDLIRGKNAAEAIAILKLTNKASSPVIEKVLMSALANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEGK 129
           +D++ D L+V EAY  +   +KRF  R + R   I +  S +T++V +  +E K
Sbjct: 62  YDMNTDELVVKEAYANEGPTLKRFRPRAQGRASAINKRTSHITIVVSDGKEEAK 115


>gi|282882552|ref|ZP_06291173.1| ribosomal protein L22 [Peptoniphilus lacrimalis 315-B]
 gi|300814581|ref|ZP_07094832.1| ribosomal protein L22 [Peptoniphilus sp. oral taxon 836 str. F0141]
 gi|281297694|gb|EFA90169.1| ribosomal protein L22 [Peptoniphilus lacrimalis 315-B]
 gi|300511200|gb|EFK38449.1| ribosomal protein L22 [Peptoniphilus sp. oral taxon 836 str. F0141]
          Length = 111

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 68/108 (62%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AIA  +R+SP K+N +   IRGK+V +AL+ L+F+ K+ A E+ K L SAVANAENN
Sbjct: 2   EAKAIAKYVRISPLKVNYICDEIRGKQVDEALSILKFTNKKGAYELYKVLHSAVANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            +LD   L V +AY      MKRFH + +     I++  S + V+V E
Sbjct: 62  LNLDRSLLYVKKAYANDGPTMKRFHPKAKGMAYPILKRSSHIGVVVAE 109


>gi|289579137|ref|YP_003477764.1| ribosomal protein L22 [Thermoanaerobacter italicus Ab9]
 gi|289528850|gb|ADD03202.1| ribosomal protein L22 [Thermoanaerobacter italicus Ab9]
          Length = 111

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 69/108 (63%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AIA  +R+SP+K+ LV  +IRGK V +AL  L F+ KR +G V K L SA+ANAENN
Sbjct: 2   EARAIARYVRISPRKVRLVLNLIRGKHVDEALTILRFTPKRASGIVAKVLKSAIANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           H ++ D L V++A   +   MKR   R R R   + +  S +T++VRE
Sbjct: 62  HGMNRDNLYVAKAVADEGPTMKRIFPRARGRADIMRKRTSHITIVVRE 109


>gi|222150450|ref|YP_002559603.1| 50S ribosomal protein L22 [Macrococcus caseolyticus JCSC5402]
 gi|254800445|sp|B9E9J6|RL22_MACCJ RecName: Full=50S ribosomal protein L22
 gi|222119572|dbj|BAH16907.1| 50S ribosomal protein L22 [Macrococcus caseolyticus JCSC5402]
          Length = 124

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 44/106 (41%), Positives = 71/106 (66%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  +R++P+K+ LV  +IRGK V++A+A L+ + K  +  V K L SA+ANAE+N
Sbjct: 2   EAKAVARTIRIAPRKVRLVLDLIRGKEVAEAIAILKLTNKASSPVVEKLLMSALANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           +D+++D L+V EAY  +   +KRF  R + R   I +  S +T++V
Sbjct: 62  YDMNIDSLVVKEAYANEGPTLKRFRPRAQGRASAINKRTSHITIVV 107


>gi|73661977|ref|YP_300758.1| 50S ribosomal protein L22 [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
 gi|82581581|sp|Q49ZG3|RL22_STAS1 RecName: Full=50S ribosomal protein L22
 gi|72494492|dbj|BAE17813.1| 50S ribosomal protein L22 [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
          Length = 117

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 71/114 (62%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  +R++P+K+ LV  +IRGK   +A+A L+   K  +  V K L SA+ANAE+N
Sbjct: 2   EAKAVAKTIRIAPRKVRLVLDLIRGKSAGEAIAILKLKNKASSPVVEKLLMSALANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEGK 129
           +D++ D LIV EAY  +   +KRF  R + R   I +  S +T++V +  +E K
Sbjct: 62  YDMNTDELIVKEAYANEGPTLKRFRPRAQGRASAINKRTSHITIVVSDGKEEAK 115


>gi|148381416|ref|YP_001255957.1| ribosomal protein L22 [Clostridium botulinum A str. ATCC 3502]
 gi|148290900|emb|CAL85036.1| 50S ribosomal protein L22 [Clostridium botulinum A str. ATCC 3502]
          Length = 111

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 47/108 (43%), Positives = 71/108 (65%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AI   +R+SP K+ +V  ++RGK V++A A L+++ K  A  + K L SAVANAENN
Sbjct: 2   EAKAIVRYVRMSPSKIGVVLDLVRGKDVNEAFAILKYTPKDAAEVIYKALKSAVANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            +LDV+ L +SE +VG+   +KR+    + R  RI +  S LT++V+E
Sbjct: 62  LNLDVNSLYISEVHVGQGPTLKRYQPHAQGRAFRIRKRTSHLTLVVKE 109


>gi|138893790|ref|YP_001124243.1| 50S ribosomal protein L22 [Geobacillus thermodenitrificans NG80-2]
 gi|196251019|ref|ZP_03149701.1| ribosomal protein L22 [Geobacillus sp. G11MC16]
 gi|166199468|sp|A4IJJ4|RL22_GEOTN RecName: Full=50S ribosomal protein L22
 gi|134265303|gb|ABO65498.1| Ribosomal protein L22 [Geobacillus thermodenitrificans NG80-2]
 gi|196209491|gb|EDY04268.1| ribosomal protein L22 [Geobacillus sp. G11MC16]
          Length = 113

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 45/108 (41%), Positives = 71/108 (65%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A A+A  +R++P+K  LV  +IRGK+V +A A L  + K  +  + K L SAVANAE+N
Sbjct: 2   QAKAVARTVRIAPRKARLVIDLIRGKKVGEAFAILRHTPKAASPIIEKVLKSAVANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           +D+D++ L+VS+AYV +   +KRF  R R +   I +  S +T++V E
Sbjct: 62  YDMDINNLVVSQAYVNEGPTLKRFRPRARGQASAINKRTSHITIVVSE 109


>gi|126654429|ref|ZP_01726169.1| 50S ribosomal protein L22 [Bacillus sp. B14905]
 gi|169830025|ref|YP_001700183.1| 50S ribosomal protein L22 [Lysinibacillus sphaericus C3-41]
 gi|299541937|ref|ZP_07052260.1| 50S ribosomal protein L22 [Lysinibacillus fusiformis ZC1]
 gi|215274828|sp|B1HMX5|RL22_LYSSC RecName: Full=50S ribosomal protein L22
 gi|126589116|gb|EAZ83313.1| 50S ribosomal protein L22 [Bacillus sp. B14905]
 gi|168994513|gb|ACA42053.1| 50S ribosomal protein L22 [Lysinibacillus sphaericus C3-41]
 gi|298725675|gb|EFI66316.1| 50S ribosomal protein L22 [Lysinibacillus fusiformis ZC1]
          Length = 114

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 72/109 (66%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
            +A AIA  +R++P+K+ LV  +IRGK+V +A+A L  + K  +  V K L SAVANAE+
Sbjct: 2   TQAKAIARTVRIAPRKVRLVVDLIRGKQVGEAVAILRHTPKAASPVVEKVLKSAVANAEH 61

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           N+DLD++ L+VSE +V +   +KRF  R + R   I +  S +T++V E
Sbjct: 62  NYDLDINSLVVSEVFVDEGPTLKRFRPRAQGRASAINKRTSHITLVVSE 110


>gi|91774640|ref|YP_544396.1| 50S ribosomal protein L22P [Methylobacillus flagellatus KT]
 gi|123078975|sp|Q1H4N2|RL22_METFK RecName: Full=50S ribosomal protein L22
 gi|91708627|gb|ABE48555.1| LSU ribosomal protein L22P [Methylobacillus flagellatus KT]
          Length = 109

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 67/106 (63%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E +A+   + +SPQK  LVA ++RGK+V  AL  L F+ K+ A  ++K + SA+ANAE+N
Sbjct: 2   EVSAVLRGVHLSPQKARLVADLVRGKKVDQALNILAFTPKKGAEVIKKVVESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L V+  YV K + +KR   R + R GRI++P   +TV V
Sbjct: 62  EGADIDELKVTSIYVDKGLVLKRIRARAKGRAGRIIKPTCHITVTV 107


>gi|190571551|ref|YP_001975909.1| ribosomal protein L22 [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213018953|ref|ZP_03334760.1| ribosomal protein L22 [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|226734751|sp|B3CN31|RL22_WOLPP RecName: Full=50S ribosomal protein L22
 gi|190357823|emb|CAQ55279.1| ribosomal protein L22 [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212995062|gb|EEB55703.1| ribosomal protein L22 [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 116

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 70/104 (67%)

Query: 21  ASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDV 80
           + +LR +P+KLNLVA ++R K+VS A   L F  K+ AG + K L SA+ANA+NN+ L+V
Sbjct: 12  SKVLRSTPRKLNLVADLVRNKKVSFANVQLRFCEKKAAGFIMKVLNSAIANAQNNYGLNV 71

Query: 81  DRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV 124
           D L + E  +GKS+ ++R + +   R  R+ + +S +T+ ++E+
Sbjct: 72  DNLYIKEILIGKSLTLRRVYPKAMGRANRMSKFYSNITIKLKEI 115


>gi|315222815|ref|ZP_07864701.1| ribosomal protein L22 [Streptococcus anginosus F0211]
 gi|315188118|gb|EFU21847.1| ribosomal protein L22 [Streptococcus anginosus F0211]
          Length = 114

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 51/107 (47%), Positives = 67/107 (62%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A+A  +RVSP+K  LV   IRGK V+DA+A L+F+  + AG V K L SA+ANAENN 
Sbjct: 7   AKAMARTVRVSPRKSRLVLDNIRGKDVADAIAILKFTPNKAAGIVEKVLNSAIANAENNF 66

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            L+   L+VSEAY  +   MKRF  R +     I +  S +TV+V E
Sbjct: 67  GLEKANLVVSEAYANEGPTMKRFRPRAKGSASPINKRTSHITVVVAE 113


>gi|223042454|ref|ZP_03612503.1| ribosomal protein L22 [Staphylococcus capitis SK14]
 gi|314934292|ref|ZP_07841651.1| ribosomal protein L22 [Staphylococcus caprae C87]
 gi|222444117|gb|EEE50213.1| ribosomal protein L22 [Staphylococcus capitis SK14]
 gi|313652222|gb|EFS15985.1| ribosomal protein L22 [Staphylococcus caprae C87]
          Length = 117

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 43/114 (37%), Positives = 73/114 (64%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  +R++P+K+ LV  +IRGK  ++A+A L+ + K  +  + K L SA+ANAE+N
Sbjct: 2   EAKAVARTIRIAPRKVRLVLDLIRGKNAAEAIAILKLTNKASSPVIEKVLMSALANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEGK 129
           +D++ D L++ EAY  +   +KRF  R + R   I +  S +T++V +  +E K
Sbjct: 62  YDMNTDELVIKEAYANEGPTLKRFRPRAQGRASAINKRTSHITIVVSDGKEEAK 115


>gi|73667223|ref|YP_303239.1| 50S ribosomal protein L22 [Ehrlichia canis str. Jake]
 gi|123732197|sp|Q3YRL4|RL22_EHRCJ RecName: Full=50S ribosomal protein L22
 gi|72394364|gb|AAZ68641.1| LSU ribosomal protein L22P [Ehrlichia canis str. Jake]
          Length = 114

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 69/108 (63%), Gaps = 2/108 (1%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA  I   LR +P KLNLVA +IRGK VS A+  L+F +K+ AG + K L SAVANA+ N
Sbjct: 7   EAKGIG--LRSTPSKLNLVADLIRGKDVSVAMMYLKFCKKKSAGYISKVLKSAVANAQAN 64

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           +++D+D L V E  VGKS  ++R H R R +  R+ + +  + + + E
Sbjct: 65  YNVDLDNLYVKEVLVGKSFSLRRVHARARGKACRVHKHYGNVIIKLFE 112


>gi|27468737|ref|NP_765374.1| 50S ribosomal protein L22 [Staphylococcus epidermidis ATCC 12228]
 gi|57867712|ref|YP_189389.1| 50S ribosomal protein L22 [Staphylococcus epidermidis RP62A]
 gi|70725808|ref|YP_252722.1| 50S ribosomal protein L22 [Staphylococcus haemolyticus JCSC1435]
 gi|228474834|ref|ZP_04059565.1| ribosomal protein L22 [Staphylococcus hominis SK119]
 gi|239636228|ref|ZP_04677232.1| ribosomal protein L22 [Staphylococcus warneri L37603]
 gi|242243952|ref|ZP_04798395.1| 50S ribosomal protein L22 [Staphylococcus epidermidis W23144]
 gi|282875347|ref|ZP_06284220.1| ribosomal protein L22 [Staphylococcus epidermidis SK135]
 gi|293368438|ref|ZP_06615062.1| 50S ribosomal protein L22 [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|314935837|ref|ZP_07843189.1| ribosomal protein L22 [Staphylococcus hominis subsp. hominis C80]
 gi|51316836|sp|Q8CRG5|RL22_STAES RecName: Full=50S ribosomal protein L22
 gi|81673588|sp|Q5HM04|RL22_STAEQ RecName: Full=50S ribosomal protein L22
 gi|82581580|sp|Q4L8A9|RL22_STAHJ RecName: Full=50S ribosomal protein L22
 gi|27316285|gb|AAO05460.1|AE016750_65 50S ribosomal protein L22 [Staphylococcus epidermidis ATCC 12228]
 gi|57638370|gb|AAW55158.1| ribosomal protein L22 [Staphylococcus epidermidis RP62A]
 gi|68446532|dbj|BAE04116.1| 50S ribosomal protein L22 [Staphylococcus haemolyticus JCSC1435]
 gi|228271497|gb|EEK12865.1| ribosomal protein L22 [Staphylococcus hominis SK119]
 gi|239598244|gb|EEQ80737.1| ribosomal protein L22 [Staphylococcus warneri L37603]
 gi|242232585|gb|EES34897.1| 50S ribosomal protein L22 [Staphylococcus epidermidis W23144]
 gi|281296112|gb|EFA88633.1| ribosomal protein L22 [Staphylococcus epidermidis SK135]
 gi|291317396|gb|EFE57818.1| 50S ribosomal protein L22 [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|313656402|gb|EFS20142.1| ribosomal protein L22 [Staphylococcus hominis subsp. hominis C80]
 gi|319400619|gb|EFV88844.1| ribosomal protein L22 [Staphylococcus epidermidis FRI909]
 gi|329731233|gb|EGG67603.1| ribosomal protein L22 [Staphylococcus epidermidis VCU144]
 gi|329736466|gb|EGG72734.1| ribosomal protein L22 [Staphylococcus epidermidis VCU028]
 gi|329737007|gb|EGG73262.1| ribosomal protein L22 [Staphylococcus epidermidis VCU045]
 gi|330685118|gb|EGG96782.1| ribosomal protein L22 [Staphylococcus epidermidis VCU121]
          Length = 117

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 44/114 (38%), Positives = 72/114 (63%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  +R++P+K+ LV  +IRGK   +A+A L+ + K  +  + K L SA+ANAE+N
Sbjct: 2   EAKAVARTIRIAPRKVRLVLDLIRGKNAGEAIAILKLTNKASSPVIEKVLMSALANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEGK 129
           +D++ D L+V EAY  +   +KRF  R + R   I +  S +T++V +  +E K
Sbjct: 62  YDMNTDELVVKEAYANEGPTLKRFRPRAQGRASAINKRTSHITIVVSDGKEEAK 115


>gi|253998019|ref|YP_003050082.1| 50S ribosomal protein L22 [Methylovorus sp. SIP3-4]
 gi|253984698|gb|ACT49555.1| ribosomal protein L22 [Methylovorus sp. SIP3-4]
          Length = 109

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 67/106 (63%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           + +A+   + +SPQK  LVA +IRGK+V  AL  L F+ K+ A  ++K + SA+ANAE+N
Sbjct: 2   QVSAVLKGVHLSPQKARLVADLIRGKKVDYALNILNFTPKKGAEIIKKVVESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L V+  YV K + +KR   R + R GRI++P   +TV V
Sbjct: 62  EGADIDELKVTSIYVDKGIVLKRIRARAKGRAGRIIKPTCHITVTV 107


>gi|15674076|ref|NP_268251.1| 50S ribosomal protein L22 [Lactococcus lactis subsp. lactis Il1403]
 gi|116513049|ref|YP_811956.1| 50S ribosomal protein L22 [Lactococcus lactis subsp. cremoris SK11]
 gi|125625138|ref|YP_001033621.1| 50S ribosomal protein L22 [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|281492754|ref|YP_003354734.1| 50S ribosomal protein L22P [Lactococcus lactis subsp. lactis KF147]
 gi|51316518|sp|Q9CDW7|RL22_LACLA RecName: Full=50S ribosomal protein L22
 gi|123025117|sp|Q02W29|RL22_LACLS RecName: Full=50S ribosomal protein L22
 gi|166199505|sp|A2RNQ0|RL22_LACLM RecName: Full=50S ribosomal protein L22
 gi|12725148|gb|AAK06192.1|AE006438_6 50S ribosomal protein L22 [Lactococcus lactis subsp. lactis Il1403]
 gi|116108703|gb|ABJ73843.1| LSU ribosomal protein L22P [Lactococcus lactis subsp. cremoris
           SK11]
 gi|124493946|emb|CAL98941.1| 50S ribosomal protein L22 [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|281376406|gb|ADA65892.1| LSU ribosomal protein L22P [Lactococcus lactis subsp. lactis KF147]
 gi|300071946|gb|ADJ61346.1| 50S ribosomal protein L22 [Lactococcus lactis subsp. cremoris
           NZ9000]
          Length = 115

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 67/107 (62%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A A  +RVSP+K  LV  +IRGKRV+DA+A L+F+  + A EV   L SA+ANAENN 
Sbjct: 7   AKATAKTVRVSPRKTRLVIDLIRGKRVADAIAILKFTPTKAAVEVENVLNSAIANAENNF 66

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            L+   L+VSE ++ +   MKRF  R +     I +  + +TV+V E
Sbjct: 67  GLEKANLVVSETFINEGPTMKRFRPRAKGSASPINKRTAHITVVVAE 113


>gi|259502536|ref|ZP_05745438.1| 50S ribosomal protein L22 [Lactobacillus antri DSM 16041]
 gi|312870503|ref|ZP_07730622.1| ribosomal protein L22 [Lactobacillus oris PB013-T2-3]
 gi|259169488|gb|EEW53983.1| 50S ribosomal protein L22 [Lactobacillus antri DSM 16041]
 gi|311093965|gb|EFQ52290.1| ribosomal protein L22 [Lactobacillus oris PB013-T2-3]
          Length = 115

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 52/114 (45%), Positives = 70/114 (61%), Gaps = 2/114 (1%)

Query: 12  MGDN--EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           M +N   A A A M+RV  +K+ LV   IRGK V++A A L+F+ +  A +V+K L SAV
Sbjct: 1   MAENITSAKATAKMVRVPARKVRLVLDAIRGKSVAEAFAILKFTSRGAASDVQKVLNSAV 60

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           ANAENN DLD   L+VSEAY  +   +KRF  R +     I +  S +TV+V E
Sbjct: 61  ANAENNFDLDRASLVVSEAYANEGPTLKRFRPRAKGSASPINKRTSHITVVVTE 114


>gi|319940055|ref|ZP_08014409.1| 50S ribosomal protein L22 [Streptococcus anginosus 1_2_62CV]
 gi|319810769|gb|EFW07096.1| 50S ribosomal protein L22 [Streptococcus anginosus 1_2_62CV]
          Length = 114

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 50/107 (46%), Positives = 67/107 (62%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A+A  +RVSP+K  LV   IRGK V+DA+A L+F+  + AG + K L SA+ANAENN 
Sbjct: 7   AKAMARTVRVSPRKSRLVLDNIRGKDVADAIAILKFTPNKAAGIIEKVLNSAIANAENNF 66

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            L+   L+VSEAY  +   MKRF  R +     I +  S +TV+V E
Sbjct: 67  GLEKANLVVSEAYANEGPTMKRFRPRAKGSASPINKRTSHITVVVAE 113


>gi|322386349|ref|ZP_08059979.1| 50S ribosomal protein L22 [Streptococcus cristatus ATCC 51100]
 gi|321269573|gb|EFX52503.1| 50S ribosomal protein L22 [Streptococcus cristatus ATCC 51100]
          Length = 114

 Score = 87.0 bits (214), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 49/107 (45%), Positives = 67/107 (62%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A+A  +RVSP+K  LV   IRGK V+DA+A L+F+  + AG + K L SA+ANAENN 
Sbjct: 7   AKAMARTVRVSPRKTRLVLDNIRGKNVADAIAILKFTPNKAAGIIEKVLISAIANAENNF 66

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            L+   L+VSEA+  +   MKRF  R +     I +  S +TV+V E
Sbjct: 67  GLEKANLVVSEAFANEGPTMKRFRPRAKGSASPINKRTSHITVVVAE 113


>gi|323141361|ref|ZP_08076252.1| ribosomal protein L22 [Phascolarctobacterium sp. YIT 12067]
 gi|322414110|gb|EFY04938.1| ribosomal protein L22 [Phascolarctobacterium sp. YIT 12067]
          Length = 110

 Score = 86.7 bits (213), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 71/108 (65%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AIA  +R++P+KL +V  +IRGK V +A A L+++ K  +  + K L SAVANAE+N
Sbjct: 2   EAKAIAKYIRIAPRKLRIVINLIRGKSVGEAFAILKYTPKVGSEVIEKVLRSAVANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            D++VD LIVS   V +   MKR H R R +  +I++  S +TV V+E
Sbjct: 62  FDMNVDNLIVSYCAVDQGPTMKRIHPRSRGQAFKILKRSSHVTVAVKE 109


>gi|326407627|gb|ADZ64698.1| 50S ribosomal protein L22 [Lactococcus lactis subsp. lactis CV56]
          Length = 115

 Score = 86.7 bits (213), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 67/107 (62%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A A  +RVSP+K  LV  +IRGKRV+DA+A L+F+  + A EV   L SA+ANAENN 
Sbjct: 7   AKATAKTVRVSPRKTRLVIDLIRGKRVADAIAILKFTPTKAAVEVENVLKSAIANAENNF 66

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            L+   L+VSE ++ +   MKRF  R +     I +  + +TV+V E
Sbjct: 67  GLEKANLVVSETFINEGPTMKRFRPRAKGSASPINKRTAHITVVVAE 113


>gi|288554730|ref|YP_003426665.1| 50S ribosomal protein L22 [Bacillus pseudofirmus OF4]
 gi|288545890|gb|ADC49773.1| 50S ribosomal protein L22 [Bacillus pseudofirmus OF4]
          Length = 113

 Score = 86.7 bits (213), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 45/108 (41%), Positives = 73/108 (67%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A A+A  +R++P+K+ LV  +IRGK+V +A+A L  + K  +  V K L SA+ANAE+N
Sbjct: 2   QAKAVAKQVRIAPRKVRLVVDLIRGKQVGEAIAILRHTPKAGSPVVEKLLNSAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           ++++ + L++SEAYV + V +KRF  R   R  RI +  S +T++V E
Sbjct: 62  YEMEPNNLVISEAYVDEGVTLKRFRPRAMGRASRINKRTSHITLVVTE 109


>gi|297545324|ref|YP_003677626.1| ribosomal protein L22 [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
 gi|296843099|gb|ADH61615.1| ribosomal protein L22 [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
          Length = 111

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 69/108 (63%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AIA  +R+SP+K+ LV  +IRGK V +AL  L F+ KR +G V K L SA+ANAENN
Sbjct: 2   EARAIARYVRISPRKVRLVLNLIRGKHVDEALTILRFTPKRASGIVAKVLKSAIANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           H ++ D L V++A   +   MKR   R R R   + +  S +T++V+E
Sbjct: 62  HGMNRDNLYVAKAVADEGPTMKRIFPRARGRADIMRKRTSHITIVVKE 109


>gi|315649694|ref|ZP_07902778.1| ribosomal protein L22 [Paenibacillus vortex V453]
 gi|315274882|gb|EFU38258.1| ribosomal protein L22 [Paenibacillus vortex V453]
          Length = 110

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 47/108 (43%), Positives = 70/108 (64%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A  +R++P+K  LV  +IRGK+V +A+A L  + K  +  + K L SA+ANAE+N
Sbjct: 2   EAKAHARSIRIAPRKAQLVVDLIRGKQVGEAIAILRHTPKAASPVLEKLLNSAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           + LDV +L+V++AYV +   MKRF  R   R  RI +  S +T++V E
Sbjct: 62  YSLDVTKLVVTQAYVNQGPTMKRFRPRAMGRASRINKRTSHITLVVAE 109


>gi|299820960|ref|ZP_07052849.1| 50S ribosomal protein L22 [Listeria grayi DSM 20601]
 gi|299817981|gb|EFI85216.1| 50S ribosomal protein L22 [Listeria grayi DSM 20601]
          Length = 118

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 74/110 (67%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A ++A  +R++P+K  +V  +IRGK++ +A+A L+++ +  +  + K L SA+ANAE+N+
Sbjct: 8   AKSVAKTVRIAPRKARIVIDLIRGKQIGEAIAILKYTPRAASPIIEKVLKSAIANAEHNY 67

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           DLDV+ L+VSEA+V +   +KRF  R +     I +  S +TV+V EV +
Sbjct: 68  DLDVNSLVVSEAFVDEGPTLKRFRPRAKGSASPINKRTSHITVVVSEVKE 117


>gi|323706455|ref|ZP_08118016.1| ribosomal protein L22 [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323534175|gb|EGB23965.1| ribosomal protein L22 [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 110

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 67/108 (62%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  +R+SPQK  L+  +IRGK V++ALA L+F+  + AG V K L SA+ANAENN
Sbjct: 2   EAKAVAKYVRISPQKAGLIMNLIRGKDVNEALAILKFTPNKAAGIVEKVLKSAIANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
             LD D L V++A   +   MKR   R   R   + R  S +TV+V E
Sbjct: 62  LGLDRDNLYVAKAVADQGPIMKRMMPRAMGRSNLMRRRTSHITVVVDE 109


>gi|221632973|ref|YP_002522196.1| 50S ribosomal protein L22 [Thermomicrobium roseum DSM 5159]
 gi|254800467|sp|B9KZY2|RL22_THERP RecName: Full=50S ribosomal protein L22
 gi|221155905|gb|ACM05032.1| ribosomal protein L22 [Thermomicrobium roseum DSM 5159]
          Length = 118

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 68/113 (60%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A+   +RVSPQK  +V  +IRGK + DALA L+   ++ A    K L SA ANAE+N
Sbjct: 2   EVRAMVREVRVSPQKARMVIDVIRGKPLRDALAVLQVLPQKTAPIALKLLRSAAANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           +DLD DRL V   YV +    KR+    R R+GR  R  S +TVI+ E+ ++G
Sbjct: 62  YDLDPDRLYVKRIYVDEGPRYKRWQPHARGRVGRKWRRTSHITVILDELPEKG 114


>gi|239825698|ref|YP_002948322.1| 50S ribosomal protein L22 [Geobacillus sp. WCH70]
 gi|259646249|sp|C5D3S2|RL22_GEOSW RecName: Full=50S ribosomal protein L22
 gi|239805991|gb|ACS23056.1| ribosomal protein L22 [Geobacillus sp. WCH70]
          Length = 113

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/108 (41%), Positives = 71/108 (65%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A A+A  +R++P+K  LV  +IRGK V +A+A L  + K  +  + K L SAVANAE+N
Sbjct: 2   QAKAVARTVRIAPRKARLVIDLIRGKEVGEAVAILRHTPKAASPIIEKVLKSAVANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           +D+DV++L+++EAYV +   +KRF  R   R   I +  S +T++V E
Sbjct: 62  YDMDVNKLVITEAYVDEGPTLKRFRPRAMGRASAINKRTSHITIVVSE 109


>gi|322410863|gb|EFY01771.1| 50S ribosomal protein L22 [Streptococcus dysgalactiae subsp.
           dysgalactiae ATCC 27957]
          Length = 114

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 68/107 (63%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A+A  +RVSP+K  LV  +IRGKRV+DA+A L+F+  + A  + KTL SA+ANAENN 
Sbjct: 7   AKAMARTVRVSPRKTRLVLDLIRGKRVADAIAILKFTPNKAARVIEKTLNSAIANAENNF 66

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            L+   L+VSE +  +   MKRF  R +     I +  + +TV+V E
Sbjct: 67  GLEKANLVVSETFANEGPTMKRFRPRAKGSASPINKRTTHVTVVVSE 113


>gi|198282642|ref|YP_002218963.1| 50S ribosomal protein L22 [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218665094|ref|YP_002424835.1| ribosomal protein L22 [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|226733404|sp|B7J472|RL22_ACIF2 RecName: Full=50S ribosomal protein L22
 gi|226733420|sp|B5ELY4|RL22_ACIF5 RecName: Full=50S ribosomal protein L22
 gi|198247163|gb|ACH82756.1| ribosomal protein L22 [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218517307|gb|ACK77893.1| ribosomal protein L22 [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 111

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 69/109 (63%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +++A+   L++SPQK  LVA ++RG+ V  AL  L F+ K+ A  +RK L SA+ANAENN
Sbjct: 2   KSSAVLKGLQMSPQKARLVADLVRGQPVGKALEILRFTTKKAALPIRKCLESAIANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV 124
              DVD L+V +  +     +KRF  R + R  RI++  S +TV+V EV
Sbjct: 62  EGADVDALVVEQIMIDGGAVLKRFAARAKGRGSRILKRTSHITVVVAEV 110


>gi|34764033|ref|ZP_00144919.1| LSU ribosomal protein L22P [Fusobacterium nucleatum subsp.
           vincentii ATCC 49256]
 gi|27886197|gb|EAA23487.1| LSU ribosomal protein L22P [Fusobacterium nucleatum subsp.
           vincentii ATCC 49256]
          Length = 121

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 52/122 (42%), Positives = 73/122 (59%), Gaps = 3/122 (2%)

Query: 6   SVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTL 65
           S+ K+  G  EA AI   +R+SP+K  LVA ++RGK   +AL  LEF+ K+ A  ++KTL
Sbjct: 2   SIEKKEDGLVEAKAITRFVRLSPRKARLVADLVRGKSALEALDILEFTNKKAARVIKKTL 61

Query: 66  CSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVS 125
            SA+ANA NN  +D D+L+VS   V +   +KR   R   R   I +P + +TV    VS
Sbjct: 62  SSAIANATNNFKMDEDKLVVSTIMVNQGPVLKRVMPRAMGRADIIRKPTAHITV---AVS 118

Query: 126 DE 127
           DE
Sbjct: 119 DE 120


>gi|229917353|ref|YP_002885999.1| 50S ribosomal protein L22 [Exiguobacterium sp. AT1b]
 gi|259646247|sp|C4KZP1|RL22_EXISA RecName: Full=50S ribosomal protein L22
 gi|229468782|gb|ACQ70554.1| ribosomal protein L22 [Exiguobacterium sp. AT1b]
          Length = 110

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/108 (41%), Positives = 72/108 (66%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A A A+M+R++P+K  LV  +IRGK+V +AL+ L  + K  +  V K L SA+ANAE+N
Sbjct: 2   QAKASANMVRLAPRKARLVVDLIRGKQVGEALSVLAHTNKAASPVVEKVLKSAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           +D++++ L+V+EAYV +   +KRF  R   R  RI +  S + ++V E
Sbjct: 62  YDMNIENLVVTEAYVNEGPTLKRFRPRAMGRASRINKRTSHIHIVVTE 109


>gi|437928|emb|CAA79782.1| ribosomal protein L22 [Thermotoga maritima]
          Length = 159

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 66/112 (58%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  +R+SP+K   +A  IRGK V +A   L FS K+ A  + K L S VANAENN
Sbjct: 30  EARAVAKYIRISPRKARAIANTIRGKSVEEAFQILAFSPKKAARIMEKVLKSRVANAENN 89

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
             L V+ L VSE YV     MKR   RGR R   I +  S +TV+VR+ S E
Sbjct: 90  FGLSVENLYVSECYVNDGPRMKRIWPRGRGRADIIQKRMSHITVVVRDRSRE 141


>gi|297618379|ref|YP_003703538.1| ribosomal protein L22 [Syntrophothermus lipocalidus DSM 12680]
 gi|297146216|gb|ADI02973.1| ribosomal protein L22 [Syntrophothermus lipocalidus DSM 12680]
          Length = 113

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 67/108 (62%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  LRVSP K   VA ++RGK   +A+A L ++ K+ A  + K L SA+ANAENN
Sbjct: 2   EARAVAKYLRVSPFKARQVADLVRGKNAQEAMAILRYTNKKGAPLIAKVLKSAMANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            D+DVD L V+E YV +   +KR   R   R   + R  S +TV+V+E
Sbjct: 62  FDMDVDALYVAEIYVNEGPSLKRLKPRAYGRADVMKRRTSHITVVVKE 109


>gi|227530210|ref|ZP_03960259.1| ribosomal protein L22 [Lactobacillus vaginalis ATCC 49540]
 gi|227349885|gb|EEJ40176.1| ribosomal protein L22 [Lactobacillus vaginalis ATCC 49540]
          Length = 115

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 52/114 (45%), Positives = 70/114 (61%), Gaps = 2/114 (1%)

Query: 12  MGDN--EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           M +N   A A A M+RVS +K+ LV   IRGK V++A A L+F+ +  A +V K L SAV
Sbjct: 1   MAENITSAKATAKMVRVSARKVRLVLDAIRGKSVAEAFAILKFTPRGAASDVEKVLNSAV 60

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           ANAENN DLD   L+VSEA+  +   +KRF  R +     I +  S +TV+V E
Sbjct: 61  ANAENNFDLDRASLVVSEAFANEGPTLKRFRPRAKGSASPINKRTSHITVVVTE 114


>gi|312866532|ref|ZP_07726749.1| ribosomal protein L22 [Streptococcus downei F0415]
 gi|311097963|gb|EFQ56190.1| ribosomal protein L22 [Streptococcus downei F0415]
          Length = 114

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 67/107 (62%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A+A  +RVSP+K  LV  +IRGK V+DA+A L+F+  + AG V K L SA+ANAENN 
Sbjct: 7   AKAMARTVRVSPRKTRLVLDLIRGKNVADAIAILKFTPNKAAGVVEKVLNSAIANAENNF 66

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            L+   L+VSE +  +   MKRF  R +     I +  + +TV+V E
Sbjct: 67  GLEKANLVVSETFANEGPTMKRFRPRAKGSASPINKRTTHVTVVVAE 113


>gi|282911805|ref|ZP_06319601.1| ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282323501|gb|EFB53817.1| ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|298695501|gb|ADI98723.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           ED133]
 gi|312437344|gb|ADQ76415.1| 50S ribosomal protein L22 [Staphylococcus aureus subsp. aureus
           TCH60]
          Length = 114

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 72/113 (63%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  +R++P+K+ LV  +IRGK  ++A+A L+ + K  +  + K L SA+ANAE+N
Sbjct: 2   EAKAVARTIRIAPRKVRLVLDLIRGKNAAEAIAILKLTNKASSPVIEKVLMSALANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           +D++ D L+V EAY  +   +KRF  R + R   I +  S +T++V +  +E 
Sbjct: 62  YDMNTDELVVKEAYANEGPTLKRFRPRAQGRASAINKRTSHITIVVSDGKEEA 114


>gi|327438283|dbj|BAK14648.1| ribosomal protein L22 [Solibacillus silvestris StLB046]
          Length = 114

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 72/109 (66%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
            +A AIA  +R++P+K+ LV  +IRGK++ +A+A L  + K  +  V K L SAVANAE+
Sbjct: 2   TQAKAIARTVRIAPRKVRLVVDLIRGKQIGEAVAILRHTPKAASPVVEKVLKSAVANAEH 61

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           N++LDV+ L+VSE +V +   +KRF  R + R   I +  S +T++V E
Sbjct: 62  NYELDVNNLVVSEIFVDEGPTLKRFRPRAQGRASAINKRTSHITIVVSE 110


>gi|148544691|ref|YP_001272061.1| 50S ribosomal protein L22 [Lactobacillus reuteri DSM 20016]
 gi|184154044|ref|YP_001842385.1| 50S ribosomal protein L22 [Lactobacillus reuteri JCM 1112]
 gi|194466948|ref|ZP_03072935.1| ribosomal protein L22 [Lactobacillus reuteri 100-23]
 gi|227363814|ref|ZP_03847921.1| ribosomal protein L22 [Lactobacillus reuteri MM2-3]
 gi|227543618|ref|ZP_03973667.1| ribosomal protein L22 [Lactobacillus reuteri CF48-3A]
 gi|300909353|ref|ZP_07126814.1| 50S ribosomal protein L22 [Lactobacillus reuteri SD2112]
 gi|325683025|ref|ZP_08162541.1| 50S ribosomal protein L22 [Lactobacillus reuteri MM4-1A]
 gi|166986973|sp|A5VLK0|RL22_LACRD RecName: Full=50S ribosomal protein L22
 gi|226733479|sp|B2G8X3|RL22_LACRJ RecName: Full=50S ribosomal protein L22
 gi|148531725|gb|ABQ83724.1| LSU ribosomal protein L22P [Lactobacillus reuteri DSM 20016]
 gi|183225388|dbj|BAG25905.1| 50S ribosomal protein L22 [Lactobacillus reuteri JCM 1112]
 gi|194453984|gb|EDX42881.1| ribosomal protein L22 [Lactobacillus reuteri 100-23]
 gi|227071171|gb|EEI09487.1| ribosomal protein L22 [Lactobacillus reuteri MM2-3]
 gi|227186458|gb|EEI66529.1| ribosomal protein L22 [Lactobacillus reuteri CF48-3A]
 gi|300893218|gb|EFK86577.1| 50S ribosomal protein L22 [Lactobacillus reuteri SD2112]
 gi|324977375|gb|EGC14326.1| 50S ribosomal protein L22 [Lactobacillus reuteri MM4-1A]
          Length = 115

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 52/114 (45%), Positives = 70/114 (61%), Gaps = 2/114 (1%)

Query: 12  MGDN--EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           M +N   A A A M+RVS +K+ LV   IRGK V++A A L+F+ +  A +V K L SAV
Sbjct: 1   MAENITSAKATAKMVRVSARKVRLVLDAIRGKSVAEAFAILKFTPRGAASDVEKVLKSAV 60

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           ANAENN DLD   L+VSEA+  +   +KRF  R +     I +  S +TV+V E
Sbjct: 61  ANAENNFDLDRASLVVSEAFANEGPTLKRFRPRAKGSASPINKRTSHITVVVTE 114


>gi|312144242|ref|YP_003995688.1| ribosomal protein L22 [Halanaerobium sp. 'sapolanicus']
 gi|311904893|gb|ADQ15334.1| ribosomal protein L22 [Halanaerobium sp. 'sapolanicus']
          Length = 113

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 70/108 (64%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  LR++ +K  LV  +I+GK V+ A+A L+ + K+ A  V K L SAVANAENN
Sbjct: 2   EAKAVAKHLRITARKARLVTDLIKGKDVNTAVAILKNTPKKAAKMVEKVLNSAVANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           HD+ VD LIV EA+V +   MKR+  R + +   I +  S +TV++ +
Sbjct: 62  HDMFVDDLIVKEAFVNEGPTMKRWKPRAQGQASPIKKRTSHITVVLSD 109


>gi|229542198|ref|ZP_04431258.1| ribosomal protein L22 [Bacillus coagulans 36D1]
 gi|229326618|gb|EEN92293.1| ribosomal protein L22 [Bacillus coagulans 36D1]
          Length = 113

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 72/108 (66%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A A+A  +R++P+K  LV  +IRGK+V +AL+ L+F+ K  +  + K L SA+ANAE+N
Sbjct: 2   QAKAVAKTVRIAPRKARLVIDLIRGKQVGEALSILKFTPKAASPVIEKVLNSAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           +D+D + L+V +AYV +   +KRF  R   R  +I +  S +T++V +
Sbjct: 62  YDMDANDLVVEKAYVDEGPTLKRFRPRAMGRASQINKRTSHITIVVSD 109


>gi|319942178|ref|ZP_08016494.1| 50S ribosomal protein L22 [Sutterella wadsworthensis 3_1_45B]
 gi|319804231|gb|EFW01123.1| 50S ribosomal protein L22 [Sutterella wadsworthensis 3_1_45B]
          Length = 111

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 70/106 (66%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  AI   +R+S QK  LVA +IRG++V  AL+ LEF++KR AG VRK L SA+ANAE+N
Sbjct: 2   ETTAIVRGVRLSAQKGRLVADLIRGQQVGRALSILEFTQKRAAGIVRKCLESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L+V++ +V K+  ++RF  R + R  RI +  S + + V
Sbjct: 62  FGADIDALVVTKIHVEKAATLRRFGARAKGRGTRINKQTSHIYITV 107


>gi|220935487|ref|YP_002514386.1| ribosomal protein L22 [Thioalkalivibrio sp. HL-EbGR7]
 gi|254800468|sp|B8GV53|RL22_THISH RecName: Full=50S ribosomal protein L22
 gi|219996797|gb|ACL73399.1| ribosomal protein L22 [Thioalkalivibrio sp. HL-EbGR7]
          Length = 115

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 62/99 (62%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R+SPQK  LVA  IRG  V  AL +L FS K+ A  V+K L SA+ANAE+N   DVD L 
Sbjct: 13  RISPQKCRLVADQIRGMPVERALQELTFSPKKGAAIVKKVLESAIANAEHNEGADVDELK 72

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           VS+ Y+ +   +KR H R + R  RI++  S +TV V E
Sbjct: 73  VSQIYIDQGPTLKRIHARAKGRANRILKRTSHITVAVGE 111


>gi|313888785|ref|ZP_07822446.1| ribosomal protein L22 [Peptoniphilus harei ACS-146-V-Sch2b]
 gi|312845154|gb|EFR32554.1| ribosomal protein L22 [Peptoniphilus harei ACS-146-V-Sch2b]
          Length = 111

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 68/108 (62%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A AIA  +R+SP K+N + A IRGK V +AL+ L+F+ KR A E+ K L SAVANAENN
Sbjct: 2   QAQAIAKYVRISPLKVNYICAEIRGKSVDEALSILKFTNKRGAHELYKVLHSAVANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            +LD   L V +AY  +   MKRF  + +     I++  S + V+V E
Sbjct: 62  LNLDRGDLYVKKAYANEGPTMKRFRPKAKGMAYPILKRSSHIGVVVAE 109


>gi|150392155|ref|YP_001322204.1| ribosomal protein L22 [Alkaliphilus metalliredigens QYMF]
 gi|166986963|sp|A6TWH7|RL22_ALKMQ RecName: Full=50S ribosomal protein L22
 gi|149952017|gb|ABR50545.1| ribosomal protein L22 [Alkaliphilus metalliredigens QYMF]
          Length = 110

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/108 (42%), Positives = 70/108 (64%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AIA  +R++P+K+ +V  ++RGK+V +ALA L+ + K  +  V K + SAVANAENN
Sbjct: 2   EARAIAKFVRIAPRKVKIVVDLVRGKQVDEALAILKHTPKGASPVVIKLIQSAVANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           H++D ++L VSE Y  +   MKRF  R   R   I +  S + ++V+E
Sbjct: 62  HEMDREQLFVSEVYANQGPTMKRFRPRAMGRATTIRKRTSHIGIVVKE 109


>gi|104773547|ref|YP_618527.1| 50S ribosomal protein L22 [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC 11842]
 gi|116513544|ref|YP_812450.1| 50S ribosomal protein L22 [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC BAA-365]
 gi|300812335|ref|ZP_07092770.1| ribosomal protein L22 [Lactobacillus delbrueckii subsp. bulgaricus
           PB2003/044-T3-4]
 gi|313123116|ref|YP_004033375.1| 50S ribosomal protein l22 [Lactobacillus delbrueckii subsp.
           bulgaricus ND02]
 gi|122275686|sp|Q04C10|RL22_LACDB RecName: Full=50S ribosomal protein L22
 gi|123378518|sp|Q1GBL3|RL22_LACDA RecName: Full=50S ribosomal protein L22
 gi|103422628|emb|CAI97236.1| 50S ribosomal protein L22 [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC 11842]
 gi|116092859|gb|ABJ58012.1| LSU ribosomal protein L22P [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC BAA-365]
 gi|300496640|gb|EFK31727.1| ribosomal protein L22 [Lactobacillus delbrueckii subsp. bulgaricus
           PB2003/044-T3-4]
 gi|312279679|gb|ADQ60398.1| 50S ribosomal protein L22 [Lactobacillus delbrueckii subsp.
           bulgaricus ND02]
 gi|325125180|gb|ADY84510.1| 50S ribosomal protein L22 [Lactobacillus delbrueckii subsp.
           bulgaricus 2038]
 gi|325684725|gb|EGD26879.1| 50S ribosomal protein L22 [Lactobacillus delbrueckii subsp. lactis
           DSM 20072]
          Length = 117

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 49/110 (44%), Positives = 71/110 (64%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A A  +R++P+K  LV  +IRGK V++ALA L+F+ K  +  V K L SAVANAE+N+
Sbjct: 8   ARAEARTVRIAPRKARLVVDLIRGKSVAEALAILKFTPKAASPIVEKVLRSAVANAEHNY 67

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           DL+   L VSEAYV +   +KRF  R +     I++  S + V+V E++D
Sbjct: 68  DLESANLYVSEAYVNEGATLKRFRPRAKGSASPIMKRTSHVVVVVSELND 117


>gi|78484645|ref|YP_390570.1| ribosomal protein L22 [Thiomicrospira crunogena XCL-2]
 gi|109893251|sp|Q31IX7|RL22_THICR RecName: Full=50S ribosomal protein L22
 gi|78362931|gb|ABB40896.1| LSU ribosomal protein L22P [Thiomicrospira crunogena XCL-2]
          Length = 110

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 61/97 (62%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R+SPQK  LVA +IRGK V  A+  L FS K+ +  + K L SA+ANAENN   D+D L 
Sbjct: 11  RISPQKARLVADLIRGKDVETAVNILAFSDKKASELMSKVLNSAIANAENNEGADIDELK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           V+EAYV +   MKR   R + R  RI++  S +TV V
Sbjct: 71  VTEAYVNEGPIMKRMRARAKGRGNRILKRISHITVTV 107


>gi|158319548|ref|YP_001512055.1| ribosomal protein L22 [Alkaliphilus oremlandii OhILAs]
 gi|166986964|sp|A8MLE5|RL22_ALKOO RecName: Full=50S ribosomal protein L22
 gi|158139747|gb|ABW18059.1| ribosomal protein L22 [Alkaliphilus oremlandii OhILAs]
          Length = 110

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/108 (42%), Positives = 68/108 (62%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AI   +R++P+K   V  ++RGK+V +ALA L+++ K  A  V K + SAVANAENN
Sbjct: 2   EAKAIVRYVRIAPRKAQQVVDLVRGKKVDEALAILKYTPKAAAPIVEKLVKSAVANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           + +D+DRL +SE Y  +   MKRF  R   R   I +  S + V+++E
Sbjct: 62  NGMDIDRLYISEIYANQGPTMKRFRPRAMGRATTIRKRTSHIEVVLKE 109


>gi|125716990|ref|YP_001034123.1| 50S ribosomal protein L22 [Streptococcus sanguinis SK36]
 gi|323350945|ref|ZP_08086603.1| 50S ribosomal protein L22 [Streptococcus sanguinis VMC66]
 gi|166222004|sp|A3CK68|RL22_STRSV RecName: Full=50S ribosomal protein L22
 gi|125496907|gb|ABN43573.1| 50S ribosomal protein L22, putative [Streptococcus sanguinis SK36]
 gi|322122927|gb|EFX94633.1| 50S ribosomal protein L22 [Streptococcus sanguinis VMC66]
 gi|324989997|gb|EGC21938.1| 50S ribosomal protein L22 [Streptococcus sanguinis SK353]
 gi|324991820|gb|EGC23745.1| 50S ribosomal protein L22 [Streptococcus sanguinis SK405]
 gi|324996290|gb|EGC28198.1| 50S ribosomal protein L22 [Streptococcus sanguinis SK678]
 gi|325686410|gb|EGD28440.1| 50S ribosomal protein L22 [Streptococcus sanguinis SK72]
 gi|325689226|gb|EGD31232.1| 50S ribosomal protein L22 [Streptococcus sanguinis SK115]
 gi|325695805|gb|EGD37702.1| 50S ribosomal protein L22 [Streptococcus sanguinis SK150]
 gi|325697981|gb|EGD39864.1| 50S ribosomal protein L22 [Streptococcus sanguinis SK160]
 gi|327458436|gb|EGF04792.1| 50S ribosomal protein L22 [Streptococcus sanguinis SK1]
 gi|327463718|gb|EGF10034.1| 50S ribosomal protein L22 [Streptococcus sanguinis SK1057]
 gi|327467340|gb|EGF12840.1| 50S ribosomal protein L22 [Streptococcus sanguinis SK330]
 gi|327471737|gb|EGF17178.1| 50S ribosomal protein L22 [Streptococcus sanguinis SK408]
 gi|327490458|gb|EGF22240.1| 50S ribosomal protein L22 [Streptococcus sanguinis SK1058]
 gi|328945212|gb|EGG39366.1| 50S ribosomal protein L22 [Streptococcus sanguinis SK1087]
          Length = 114

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 49/107 (45%), Positives = 67/107 (62%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A+A  +RVSP+K  LV   IRGK V+DA+A L+F+  + AG + K L SA+ANAENN 
Sbjct: 7   AKAMARTVRVSPRKSRLVLDNIRGKNVADAIAILKFTPNKAAGIIEKVLNSAIANAENNF 66

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            L+   L+VSEA+  +   MKRF  R +     I +  S +TV+V E
Sbjct: 67  GLEKANLVVSEAFANEGPTMKRFRPRAKGSASPINKRTSHITVVVAE 113


>gi|15612702|ref|NP_241005.1| 50S ribosomal protein L22 [Bacillus halodurans C-125]
 gi|7674248|sp|Q9Z9K9|RL22_BACHD RecName: Full=50S ribosomal protein L22
 gi|4512409|dbj|BAA75276.1| rplV homologue (identity of 87% to B. subtilis ) [Bacillus
           halodurans]
 gi|10172751|dbj|BAB03858.1| 50S ribosomal protein L22 [Bacillus halodurans C-125]
          Length = 113

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 73/108 (67%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A A+A  +R++P+K  LV  +IRGK+V +A+A L+ + K  +  + K L SA+ANAE+N
Sbjct: 2   QAKAVAKQVRIAPRKARLVIDLIRGKQVGEAIAILKHTPKAASPIIEKVLNSAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           ++++ + L++SEA+V + V +KRF  R   R  RI +  S +T++V E
Sbjct: 62  YEMEPNNLVISEAFVDEGVTLKRFRPRAMGRASRINKRTSHITIVVTE 109


>gi|24380364|ref|NP_722319.1| 50S ribosomal protein L22 [Streptococcus mutans UA159]
 gi|290581284|ref|YP_003485676.1| 50S ribosomal protein L22 [Streptococcus mutans NN2025]
 gi|51316845|sp|Q8DS19|RL22_STRMU RecName: Full=50S ribosomal protein L22
 gi|24378383|gb|AAN59625.1|AE015024_17 50S ribosomal protein L22 [Streptococcus mutans UA159]
 gi|254998183|dbj|BAH88784.1| 50S ribosomal protein L22 [Streptococcus mutans NN2025]
          Length = 114

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 49/107 (45%), Positives = 67/107 (62%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A+A  +RVSP+K  LV  +IRGK V+DA+A L+F+  + A  V KTL SAVANAENN 
Sbjct: 7   AKAMARTVRVSPRKTRLVLDLIRGKNVADAIAILKFTPNKAARIVEKTLNSAVANAENNF 66

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            L+   L+VSE +  +   MKRF  R +     I +  + +TV+V E
Sbjct: 67  GLEKANLVVSETFANEGPTMKRFRPRAKGSASPINKRTTHVTVVVEE 113


>gi|169830441|ref|YP_001716423.1| ribosomal protein L22 [Candidatus Desulforudis audaxviator MP104C]
 gi|226733454|sp|B1I1J3|RL22_DESAP RecName: Full=50S ribosomal protein L22
 gi|169637285|gb|ACA58791.1| ribosomal protein L22 [Candidatus Desulforudis audaxviator MP104C]
          Length = 113

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 66/106 (62%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  +R+SP K   V  ++RGK V +ALA L F+ +R AG V K + SA ANAE+N
Sbjct: 2   EAKAVARYIRLSPAKAREVVGLVRGKSVDEALAILRFTPQRAAGAVAKVIKSAAANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           +D+D  RL+V++ YV +   +KRF  R   R   I    S +TVIV
Sbjct: 62  NDMDRTRLVVAKVYVDQGPSLKRFRPRAYGRANVIKHRTSHITVIV 107


>gi|116334264|ref|YP_795791.1| 50S ribosomal protein L22 [Lactobacillus brevis ATCC 367]
 gi|122269054|sp|Q03PW2|RL22_LACBA RecName: Full=50S ribosomal protein L22
 gi|116099611|gb|ABJ64760.1| LSU ribosomal protein L22P [Lactobacillus brevis ATCC 367]
          Length = 118

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 51/112 (45%), Positives = 71/112 (63%), Gaps = 1/112 (0%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A A  +R++ +K+ LV  +IRGK V++ALA L+F+ +  +  V K L SAVANAENN 
Sbjct: 8   AQATAKTVRIAARKVRLVIDLIRGKSVAEALAILQFTPRGASPVVAKVLNSAVANAENNF 67

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           DLD   L+VSEAYV +   +KRF  R +     I +  S +TV+V E  +EG
Sbjct: 68  DLDRQDLVVSEAYVNEGPTLKRFRPRAKGSASPINKRTSHITVVVSE-KEEG 118


>gi|302876529|ref|YP_003845162.1| 50S ribosomal protein L22 [Clostridium cellulovorans 743B]
 gi|307687202|ref|ZP_07629648.1| 50S ribosomal protein L22 [Clostridium cellulovorans 743B]
 gi|302579386|gb|ADL53398.1| ribosomal protein L22 [Clostridium cellulovorans 743B]
          Length = 111

 Score = 85.5 bits (210), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 70/108 (64%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AIA  +R+SP K+N+V  +IRGK V++A A L+++ K  A  V K L SAVANAENN
Sbjct: 2   EAKAIARYIRMSPTKVNIVLDLIRGKNVNEAFAILQYTPKDAAVVVNKLLKSAVANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            +L  + L VS+A+ G+   +KRF    + R   I +  S +T++V+E
Sbjct: 62  LNLSRENLYVSDAHTGQGPTLKRFRPHAQGRAFSIKKRTSHITLVVKE 109


>gi|15674292|ref|NP_268465.1| 50S ribosomal protein L22 [Streptococcus pyogenes M1 GAS]
 gi|19745246|ref|NP_606382.1| 50S ribosomal protein L22 [Streptococcus pyogenes MGAS8232]
 gi|21909581|ref|NP_663849.1| 50S ribosomal protein L22 [Streptococcus pyogenes MGAS315]
 gi|28894959|ref|NP_801309.1| 50S ribosomal protein L22 [Streptococcus pyogenes SSI-1]
 gi|71902714|ref|YP_279517.1| 50S ribosomal protein L22 [Streptococcus pyogenes MGAS6180]
 gi|71909863|ref|YP_281413.1| 50S ribosomal protein L22 [Streptococcus pyogenes MGAS5005]
 gi|94987680|ref|YP_595781.1| 50S ribosomal protein L22 [Streptococcus pyogenes MGAS9429]
 gi|94989560|ref|YP_597660.1| 50S ribosomal protein L22 [Streptococcus pyogenes MGAS10270]
 gi|94991550|ref|YP_599649.1| 50S ribosomal protein L22 [Streptococcus pyogenes MGAS2096]
 gi|94993448|ref|YP_601546.1| 50S ribosomal protein L22 [Streptococcus pyogenes MGAS10750]
 gi|139472932|ref|YP_001127647.1| 50S ribosomal protein L22 [Streptococcus pyogenes str. Manfredo]
 gi|195977213|ref|YP_002122457.1| 50S ribosomal protein L22 [Streptococcus equi subsp. zooepidemicus
           MGCS10565]
 gi|209558632|ref|YP_002285104.1| 50S ribosomal protein L22 [Streptococcus pyogenes NZ131]
 gi|225867670|ref|YP_002743618.1| 50S ribosomal protein L22 [Streptococcus equi subsp. zooepidemicus]
 gi|225869541|ref|YP_002745488.1| 50S ribosomal protein L22 [Streptococcus equi subsp. equi 4047]
 gi|251781520|ref|YP_002995821.1| 50S ribosomal protein L22 [Streptococcus dysgalactiae subsp.
           equisimilis GGS_124]
 gi|306828255|ref|ZP_07461515.1| 50S ribosomal protein L22 [Streptococcus pyogenes ATCC 10782]
 gi|50400915|sp|Q7CFL3|RL22_STRP3 RecName: Full=50S ribosomal protein L22
 gi|50400916|sp|Q7CNQ0|RL22_STRP8 RecName: Full=50S ribosomal protein L22
 gi|76363878|sp|P0C0D3|RL22_STRPY RecName: Full=50S ribosomal protein L22
 gi|81171139|sp|P0C0D4|RL22_STRP1 RecName: Full=50S ribosomal protein L22
 gi|109893243|sp|Q48VU4|RL22_STRPM RecName: Full=50S ribosomal protein L22
 gi|122986960|sp|Q1JE53|RL22_STRPB RecName: Full=50S ribosomal protein L22
 gi|123258082|sp|Q1JJ57|RL22_STRPD RecName: Full=50S ribosomal protein L22
 gi|123382233|sp|Q1J909|RL22_STRPF RecName: Full=50S ribosomal protein L22
 gi|123382567|sp|Q1JP12|RL22_STRPC RecName: Full=50S ribosomal protein L22
 gi|166222002|sp|A2RC19|RL22_STRPG RecName: Full=50S ribosomal protein L22
 gi|226733514|sp|B4U505|RL22_STREM RecName: Full=50S ribosomal protein L22
 gi|226733520|sp|B5XJ41|RL22_STRPZ RecName: Full=50S ribosomal protein L22
 gi|254800460|sp|C0M7R4|RL22_STRE4 RecName: Full=50S ribosomal protein L22
 gi|259646258|sp|C0MCB5|RL22_STRS7 RecName: Full=50S ribosomal protein L22
 gi|13621373|gb|AAK33187.1| 50S ribosomal protein L22 [Streptococcus pyogenes M1 GAS]
 gi|19747340|gb|AAL96881.1| 50S ribosomal protein L22 [Streptococcus pyogenes MGAS8232]
 gi|21903762|gb|AAM78652.1| 50S ribosomal protein L22 [Streptococcus pyogenes MGAS315]
 gi|28475249|emb|CAD67590.1| ribosomal protein L22 [Streptococcus pyogenes]
 gi|28810204|dbj|BAC63142.1| 50S ribosomal protein L22 [Streptococcus pyogenes SSI-1]
 gi|71801809|gb|AAX71162.1| LSU ribosomal protein L22P [Streptococcus pyogenes MGAS6180]
 gi|71852645|gb|AAZ50668.1| LSU ribosomal protein L22P [Streptococcus pyogenes MGAS5005]
 gi|94541188|gb|ABF31237.1| LSU ribosomal protein L22P [Streptococcus pyogenes MGAS9429]
 gi|94543068|gb|ABF33116.1| LSU ribosomal protein L22P [Streptococcus pyogenes MGAS10270]
 gi|94545058|gb|ABF35105.1| LSU ribosomal protein L22P [Streptococcus pyogenes MGAS2096]
 gi|94546956|gb|ABF37002.1| LSU ribosomal protein L22P [Streptococcus pyogenes MGAS10750]
 gi|134271178|emb|CAM29391.1| 50S ribosomal protein L22 [Streptococcus pyogenes str. Manfredo]
 gi|195973918|gb|ACG61444.1| 50S ribosomal protein L22 [Streptococcus equi subsp. zooepidemicus
           MGCS10565]
 gi|209539833|gb|ACI60409.1| LSU ribosomal protein L22p (L17e) [Streptococcus pyogenes NZ131]
 gi|225698945|emb|CAW91976.1| 50S ribosomal protein L22 [Streptococcus equi subsp. equi 4047]
 gi|225700946|emb|CAW97654.1| 50S ribosomal protein L22 [Streptococcus equi subsp. zooepidemicus]
 gi|242390148|dbj|BAH80607.1| 50S ribosomal protein L22 [Streptococcus dysgalactiae subsp.
           equisimilis GGS_124]
 gi|304429566|gb|EFM32615.1| 50S ribosomal protein L22 [Streptococcus pyogenes ATCC 10782]
 gi|323126316|gb|ADX23613.1| 50S ribosomal protein L22 [Streptococcus dysgalactiae subsp.
           equisimilis ATCC 12394]
          Length = 114

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 68/107 (63%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A+A  +RVSP+K  LV  +IRGK+V+DA+A L+F+  + A  + KTL SA+ANAENN 
Sbjct: 7   AKAMARTVRVSPRKTRLVLDLIRGKKVADAIAILKFTPNKAARVIEKTLNSAIANAENNF 66

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            L+   L+VSE +  +   MKRF  R +     I +  + +TV+V E
Sbjct: 67  GLEKANLVVSETFANEGPTMKRFRPRAKGSASPINKRTTHVTVVVSE 113


>gi|50913444|ref|YP_059416.1| 50S ribosomal protein L22 [Streptococcus pyogenes MGAS10394]
 gi|73914088|sp|Q5XED0|RL22_STRP6 RecName: Full=50S ribosomal protein L22
 gi|50902518|gb|AAT86233.1| LSU ribosomal protein L22P [Streptococcus pyogenes MGAS10394]
          Length = 114

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 68/107 (63%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A+A  +RVSP+K  LV  +IRGK+V+DA+A L+F+  + A  + KTL SA+ANAENN 
Sbjct: 7   AKAMARTVRVSPRKTRLVLDLIRGKKVADAIAILKFTPNKAARVIEKTLNSAIANAENNF 66

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            L+   L+VSE +  +   MKRF  R +     I +  + +TV+V E
Sbjct: 67  GLEKANLVVSETFANEGPTMKRFRPRAKGSASPINKRTTHVTVVVSE 113


>gi|228478127|ref|ZP_04062738.1| ribosomal protein L22 [Streptococcus salivarius SK126]
 gi|228250307|gb|EEK09560.1| ribosomal protein L22 [Streptococcus salivarius SK126]
          Length = 114

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 49/107 (45%), Positives = 67/107 (62%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A+A  +RVSP+K  LV  +IRGK V+DA+A L+F+  + A  V KTL SA+ANAENN 
Sbjct: 7   AKAMARTVRVSPRKTRLVLDLIRGKNVADAIAILKFTPNKAARIVEKTLNSAIANAENNF 66

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            L+   L+VSE +  +   MKRF  R +     I +  + +TVIV E
Sbjct: 67  GLEKANLVVSETFANEGPTMKRFRPRAKGSASPINKRTTHVTVIVSE 113


>gi|157150683|ref|YP_001451230.1| 50S ribosomal protein L22 [Streptococcus gordonii str. Challis
           substr. CH1]
 gi|262283578|ref|ZP_06061343.1| ribosomal protein L22 [Streptococcus sp. 2_1_36FAA]
 gi|189041971|sp|A8AZM0|RL22_STRGC RecName: Full=50S ribosomal protein L22
 gi|157075477|gb|ABV10160.1| ribosomal protein L22 [Streptococcus gordonii str. Challis substr.
           CH1]
 gi|262260635|gb|EEY79336.1| ribosomal protein L22 [Streptococcus sp. 2_1_36FAA]
          Length = 114

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 67/107 (62%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A+A  +RVSP+K  L+   IRGK V+DA+A L+F+  + AG + K L SA+ANAENN 
Sbjct: 7   AKAMARTVRVSPRKSRLILDNIRGKNVADAIAILKFTPNKAAGIIEKVLNSAIANAENNF 66

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            L+   L+VSEA+  +   MKRF  R +     I +  S +TV+V E
Sbjct: 67  GLEKANLVVSEAFANEGPTMKRFRPRAKGSASPINKRTSHITVVVAE 113


>gi|302804035|ref|XP_002983770.1| hypothetical protein SELMODRAFT_118775 [Selaginella moellendorffii]
 gi|300148607|gb|EFJ15266.1| hypothetical protein SELMODRAFT_118775 [Selaginella moellendorffii]
          Length = 208

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 73/116 (62%), Gaps = 3/116 (2%)

Query: 19  AIASMLR---VSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
            + +MLR    SP+K+NLVA ++RG RV+DAL  +    KR A  V K L SA ANA +N
Sbjct: 47  TVRAMLREIPQSPKKMNLVAKVVRGMRVNDALIQMSVLIKRAASTVYKVLHSARANAVHN 106

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEGKVV 131
           +  D ++LIV EA+VGK  ++KR     R R G   +   RLTV++RE++ + +++
Sbjct: 107 YGFDAEKLIVDEAFVGKGKYLKRIWPHARGRFGIREKKRCRLTVLLREMTPKEEIL 162


>gi|302817614|ref|XP_002990482.1| hypothetical protein SELMODRAFT_131770 [Selaginella moellendorffii]
 gi|300141650|gb|EFJ08359.1| hypothetical protein SELMODRAFT_131770 [Selaginella moellendorffii]
          Length = 208

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 73/116 (62%), Gaps = 3/116 (2%)

Query: 19  AIASMLR---VSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
            + +MLR    SP+K+NLVA ++RG RV+DAL  +    KR A  V K L SA ANA +N
Sbjct: 47  TVRAMLREIPQSPKKMNLVAKVVRGMRVNDALIQMSVLIKRAASTVYKVLHSARANAVHN 106

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEGKVV 131
           +  D ++LIV EA+VGK  ++KR     R R G   +   RLTV++RE++ + +++
Sbjct: 107 YGFDAEKLIVDEAFVGKGKYLKRIWPHARGRFGIREKKRCRLTVLLREMTPKEEIL 162


>gi|297623279|ref|YP_003704713.1| 50S ribosomal protein L22 [Truepera radiovictrix DSM 17093]
 gi|297164459|gb|ADI14170.1| ribosomal protein L22 [Truepera radiovictrix DSM 17093]
          Length = 112

 Score = 84.7 bits (208), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 69/108 (63%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A  +MLRV+PQK  LVA +IRGKRVS+A + L F+ +R A  + K L SA ANA NN
Sbjct: 2   EARAHLTMLRVTPQKTRLVADLIRGKRVSEAESILRFTPRRPAQPLLKLLQSAKANAVNN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           HD+  D L+V++  V +   MKR+  R R R   + +  S +T+++ E
Sbjct: 62  HDMFEDNLVVAKIMVNEGPVMKRYLPRARGRADLLRKRTSHVTIVLEE 109


>gi|222152270|ref|YP_002561445.1| 50S ribosomal protein L22 [Streptococcus uberis 0140J]
 gi|254800463|sp|B9DSV5|RL22_STRU0 RecName: Full=50S ribosomal protein L22
 gi|222113081|emb|CAR40447.1| 50S ribosomal protein L22 [Streptococcus uberis 0140J]
          Length = 114

 Score = 84.7 bits (208), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 68/107 (63%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A+A  +RVSP+K  LV  +IRGK+V+DA+A L+F+  + A  + KTL SA+ANAENN 
Sbjct: 7   AKAMARTVRVSPRKTRLVLDLIRGKKVADAIAILKFTPNKAARVIEKTLNSAIANAENNF 66

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            L+   L+VSE +  +   MKRF  R +     I +  + +TV+V E
Sbjct: 67  GLEKANLVVSETFANEGPTMKRFRPRAKGSASPINKRTTHVTVVVAE 113


>gi|227509936|ref|ZP_03939985.1| 50S ribosomal protein L22 [Lactobacillus brevis subsp. gravesensis
           ATCC 27305]
 gi|227512869|ref|ZP_03942918.1| 50S ribosomal protein L22 [Lactobacillus buchneri ATCC 11577]
 gi|227522997|ref|ZP_03953046.1| 50S ribosomal protein L22 [Lactobacillus hilgardii ATCC 8290]
 gi|227083869|gb|EEI19181.1| 50S ribosomal protein L22 [Lactobacillus buchneri ATCC 11577]
 gi|227089815|gb|EEI25127.1| 50S ribosomal protein L22 [Lactobacillus hilgardii ATCC 8290]
 gi|227190542|gb|EEI70609.1| 50S ribosomal protein L22 [Lactobacillus brevis subsp. gravesensis
           ATCC 27305]
          Length = 118

 Score = 84.7 bits (208), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 49/112 (43%), Positives = 71/112 (63%), Gaps = 1/112 (0%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A A  +R++ +K+ LV  +IRGK V++A A L+F+ +  +  V K L SAVANAENN 
Sbjct: 8   AKATAKTVRIAARKVRLVIDLIRGKSVAEAAAILDFTPRGASPVVSKVLKSAVANAENNF 67

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           DLD + L+VSEAYV +   +KRF  R +     I +  S +T++V E  +EG
Sbjct: 68  DLDSENLVVSEAYVNEGATLKRFRPRAKGSASPINKRTSHITIVVSE-KEEG 118


>gi|167465558|ref|ZP_02330647.1| 50S ribosomal protein L22 [Paenibacillus larvae subsp. larvae
           BRL-230010]
 gi|322381121|ref|ZP_08055124.1| 50S ribosomal protein L22-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
 gi|321154697|gb|EFX46968.1| 50S ribosomal protein L22-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
          Length = 110

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 46/108 (42%), Positives = 69/108 (63%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A A A+ +R++P+K+ LV  +IRGK V +A+A L  + K  +  V K L SA+ANAE+N
Sbjct: 2   QAKAAANHVRIAPRKVQLVIDLIRGKAVGEAIAILRHTPKAASPVVEKLLNSAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           H LD ++L++SE YV +   MKRF  R      RI +  S +T++V E
Sbjct: 62  HSLDPNKLVISEIYVNQGPTMKRFRPRAMGCASRINKRTSHITLVVSE 109


>gi|172056145|ref|YP_001812605.1| 50S ribosomal protein L22 [Exiguobacterium sibiricum 255-15]
 gi|226733466|sp|B1YGV5|RL22_EXIS2 RecName: Full=50S ribosomal protein L22
 gi|171988666|gb|ACB59588.1| ribosomal protein L22 [Exiguobacterium sibiricum 255-15]
          Length = 110

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 71/108 (65%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           ++ A A+M+R++P+K  LV  +IRGK++ +AL+ L ++ K     V K L SA+ANAE+N
Sbjct: 2   QSKASANMVRIAPRKARLVVDLIRGKQIGEALSILAYTNKAATPIVEKVLKSAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            D++++ L+V+EAYV +   +KRF  R   R  RI +  S + ++V E
Sbjct: 62  FDMNIENLVVTEAYVNEGPTLKRFRPRAMGRASRINKRTSHVHIVVSE 109


>gi|295401915|ref|ZP_06811878.1| ribosomal protein L22 [Geobacillus thermoglucosidasius C56-YS93]
 gi|312109266|ref|YP_003987582.1| ribosomal protein L22 [Geobacillus sp. Y4.1MC1]
 gi|294976045|gb|EFG51660.1| ribosomal protein L22 [Geobacillus thermoglucosidasius C56-YS93]
 gi|311214367|gb|ADP72971.1| ribosomal protein L22 [Geobacillus sp. Y4.1MC1]
          Length = 113

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 45/108 (41%), Positives = 69/108 (63%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  +R++P+K  LV  +IRGK V +A A L  + K  +  + K L SAVANAE+N
Sbjct: 2   EAKAVARTVRIAPRKARLVIDLIRGKEVGEAFAILRHTPKAASPIIEKVLKSAVANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           +D+DV+ L++++AYV +   +KRF  R   R   I +  S +T++V E
Sbjct: 62  YDMDVNNLVITKAYVDEGPTLKRFRPRAMGRASAINKRTSHITIVVSE 109


>gi|150020850|ref|YP_001306204.1| 50S ribosomal protein L22 [Thermosipho melanesiensis BI429]
 gi|215274875|sp|A6LLL8|RL22_THEM4 RecName: Full=50S ribosomal protein L22
 gi|149793371|gb|ABR30819.1| ribosomal protein L22 [Thermosipho melanesiensis BI429]
          Length = 149

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 64/108 (59%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  +R+SP+K   VA  IRGK VS+A   LEFS K+ A  ++  L SAVANA NN
Sbjct: 30  EARAVAKYIRISPRKARSVANSIRGKNVSEAFTILEFSPKKAARIIKNVLKSAVANAVNN 89

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           H L+ + L V   YV     MKR   RGR     I +  S +TVIVR+
Sbjct: 90  HGLNEENLYVYTCYVNDGPRMKRLWPRGRGSADIIQKRMSHITVIVRD 137


>gi|222099972|ref|YP_002534540.1| 50S ribosomal protein L22 [Thermotoga neapolitana DSM 4359]
 gi|221572362|gb|ACM23174.1| 50S ribosomal protein L22 [Thermotoga neapolitana DSM 4359]
          Length = 164

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 66/112 (58%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  +R+SP+K   VA  IRGK V +A   L FS K+ A  + K L SAVANAENN
Sbjct: 35  EARAVAKYIRISPRKARAVANTIRGKSVEEAFRILAFSPKKAARIIEKVLRSAVANAENN 94

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
             LD   L V+E YV     +KR   RGR R   I +  S +TV+VR+ + E
Sbjct: 95  FGLDAANLYVAECYVNDGPRLKRIWPRGRGRADIIKKRMSHITVVVRDRTRE 146


>gi|28212172|ref|NP_783116.1| 50S ribosomal protein L22 [Clostridium tetani E88]
 gi|51316442|sp|Q890P2|RL22_CLOTE RecName: Full=50S ribosomal protein L22
 gi|28204616|gb|AAO37053.1| LSU ribosomal protein L22P [Clostridium tetani E88]
          Length = 111

 Score = 84.3 bits (207), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 46/108 (42%), Positives = 70/108 (64%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AIA  +R+SP+K+ +V  ++RGK V++A A L ++ +  A  + K L SAVANAENN
Sbjct: 2   EAKAIAKYVRMSPRKVGVVLDLVRGKDVNEAFAILNYTPREAAVVINKVLKSAVANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            +LD  RL V+EAY  +   +KR+    + R  RI +  S +T++V+E
Sbjct: 62  LELDPSRLYVAEAYACQGPTLKRYQPHAQGRAFRINKRTSHVTLVVKE 109


>gi|55821900|ref|YP_140342.1| 50S ribosomal protein L22 [Streptococcus thermophilus LMG 18311]
 gi|55823816|ref|YP_142257.1| 50S ribosomal protein L22 [Streptococcus thermophilus CNRZ1066]
 gi|116628593|ref|YP_821212.1| 50S ribosomal protein L22 [Streptococcus thermophilus LMD-9]
 gi|312862363|ref|ZP_07722606.1| ribosomal protein L22 [Streptococcus vestibularis F0396]
 gi|322374050|ref|ZP_08048584.1| ribosomal protein L22 [Streptococcus sp. C150]
 gi|322515872|ref|ZP_08068814.1| 50S ribosomal protein L22 [Streptococcus vestibularis ATCC 49124]
 gi|81676491|sp|Q5LXR6|RL22_STRT1 RecName: Full=50S ribosomal protein L22
 gi|81676644|sp|Q5M2B8|RL22_STRT2 RecName: Full=50S ribosomal protein L22
 gi|122266813|sp|Q03IF6|RL22_STRTD RecName: Full=50S ribosomal protein L22
 gi|55737885|gb|AAV61527.1| 50S ribosomal protein L22 [Streptococcus thermophilus LMG 18311]
 gi|55739801|gb|AAV63442.1| 50S ribosomal protein L22 [Streptococcus thermophilus CNRZ1066]
 gi|116101870|gb|ABJ67016.1| LSU ribosomal protein L22P [Streptococcus thermophilus LMD-9]
 gi|311102006|gb|EFQ60206.1| ribosomal protein L22 [Streptococcus vestibularis F0396]
 gi|312279254|gb|ADQ63911.1| 50S ribosomal protein L22 [Streptococcus thermophilus ND03]
 gi|321277016|gb|EFX54087.1| ribosomal protein L22 [Streptococcus sp. C150]
 gi|322125659|gb|EFX96986.1| 50S ribosomal protein L22 [Streptococcus vestibularis ATCC 49124]
          Length = 114

 Score = 84.3 bits (207), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 67/107 (62%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A+A  +RVSP+K  LV  +IRGK V+DA+A L+F+  + A  V KTL SA+ANAENN 
Sbjct: 7   AKAMARTVRVSPRKTRLVLDLIRGKNVADAIAILKFTPNKAARIVEKTLNSAIANAENNF 66

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            L+   L+VSE +  +   MKRF  R +     I +  + +TV+V E
Sbjct: 67  GLEKANLVVSETFANEGPTMKRFRPRAKGSASPINKRTTHVTVVVSE 113


>gi|300857241|ref|YP_003782225.1| 50S ribosomal protein L22 [Clostridium ljungdahlii DSM 13528]
 gi|300437356|gb|ADK17123.1| 50S ribosomal protein L22 [Clostridium ljungdahlii DSM 13528]
          Length = 111

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 69/108 (63%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AIA  +R+S  K+ +V  ++RGK V++A A L+++ +  A  V K L SAVANAENN
Sbjct: 2   EAKAIARYVRMSSMKVGVVLNLVRGKNVNEAFAILKYTPRDAAVVVNKVLKSAVANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            DLD D L VSEAY  +   +KRF    + R  RI +  S +T++V+E
Sbjct: 62  LDLDKDNLYVSEAYACEGPTLKRFQPHAQGRAFRINKRSSHITLVVKE 109


>gi|293375394|ref|ZP_06621675.1| ribosomal protein L22 [Turicibacter sanguinis PC909]
 gi|325844488|ref|ZP_08168215.1| ribosomal protein L22 [Turicibacter sp. HGF1]
 gi|292645947|gb|EFF63976.1| ribosomal protein L22 [Turicibacter sanguinis PC909]
 gi|325489162|gb|EGC91546.1| ribosomal protein L22 [Turicibacter sp. HGF1]
          Length = 111

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 46/108 (42%), Positives = 70/108 (64%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  +R++P+K  LV  +IRGK+V +A A L+ + K  +  V K L SA+ANAE+N
Sbjct: 2   EAKAMARTVRIAPRKARLVIDLIRGKQVGEAYAILKHTPKAASPIVEKVLKSAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            +LD++ L V EAYV +   +KRF  R + R  +I +  S +T++V E
Sbjct: 62  LNLDINSLYVKEAYVNEGTTLKRFRPRAQGRASQINKRTSHITIVVAE 109


>gi|22536248|ref|NP_687099.1| 50S ribosomal protein L22 [Streptococcus agalactiae 2603V/R]
 gi|25010138|ref|NP_734533.1| 50S ribosomal protein L22 [Streptococcus agalactiae NEM316]
 gi|76787677|ref|YP_328789.1| 50S ribosomal protein L22 [Streptococcus agalactiae A909]
 gi|76798213|ref|ZP_00780463.1| ribosomal protein L22 [Streptococcus agalactiae 18RS21]
 gi|77406108|ref|ZP_00783182.1| ribosomal protein L22 [Streptococcus agalactiae H36B]
 gi|77409633|ref|ZP_00786306.1| ribosomal protein L22 [Streptococcus agalactiae COH1]
 gi|77412268|ref|ZP_00788584.1| ribosomal protein L22 [Streptococcus agalactiae CJB111]
 gi|77414583|ref|ZP_00790726.1| ribosomal protein L22 [Streptococcus agalactiae 515]
 gi|313889557|ref|ZP_07823202.1| ribosomal protein L22 [Streptococcus pseudoporcinus SPIN 20026]
 gi|51316848|sp|Q8E2C7|RL22_STRA5 RecName: Full=50S ribosomal protein L22
 gi|51316850|sp|Q8E7T4|RL22_STRA3 RecName: Full=50S ribosomal protein L22
 gi|109893242|sp|Q3K3W4|RL22_STRA1 RecName: Full=50S ribosomal protein L22
 gi|22533068|gb|AAM98971.1|AE014194_16 ribosomal protein L22 [Streptococcus agalactiae 2603V/R]
 gi|23094489|emb|CAD45708.1| ribosomal protein L22 [Streptococcus agalactiae NEM316]
 gi|76562734|gb|ABA45318.1| ribosomal protein L22 [Streptococcus agalactiae A909]
 gi|76586422|gb|EAO62930.1| ribosomal protein L22 [Streptococcus agalactiae 18RS21]
 gi|77159381|gb|EAO70549.1| ribosomal protein L22 [Streptococcus agalactiae 515]
 gi|77161658|gb|EAO72653.1| ribosomal protein L22 [Streptococcus agalactiae CJB111]
 gi|77171756|gb|EAO74952.1| ribosomal protein L22 [Streptococcus agalactiae COH1]
 gi|77175289|gb|EAO78084.1| ribosomal protein L22 [Streptococcus agalactiae H36B]
 gi|313122066|gb|EFR45160.1| ribosomal protein L22 [Streptococcus pseudoporcinus SPIN 20026]
 gi|319743990|gb|EFV96370.1| 50S ribosomal protein L22 [Streptococcus agalactiae ATCC 13813]
          Length = 114

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 67/107 (62%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A+A  +RVSP+K  LV  +IRGK V+DA+A L+F+  + A  + KTL SA+ANAENN 
Sbjct: 7   AKAMARTVRVSPRKTRLVLDLIRGKNVADAIAILKFTPNKAARVIEKTLNSAIANAENNF 66

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            L+   L+VSE +  +   MKRF  R +     I +  + +TV+V E
Sbjct: 67  GLEKANLVVSETFANEGPTMKRFRPRAKGSASPINKRTTHVTVVVSE 113


>gi|146329359|ref|YP_001210146.1| 50S ribosomal protein L22 [Dichelobacter nodosus VCS1703A]
 gi|166220845|sp|A5EX77|RL22_DICNV RecName: Full=50S ribosomal protein L22
 gi|146232829|gb|ABQ13807.1| 50S ribosomal protein L22 [Dichelobacter nodosus VCS1703A]
          Length = 110

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 63/99 (63%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R+S QK  LVA  IRGK V+DA+  L FS+K+ A  + K L SA+ANAENN   D+D L 
Sbjct: 11  RISAQKARLVADQIRGKHVNDAVEILTFSQKKAAAIILKVLNSAIANAENNEGADIDELH 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           V+E  VG+ + MKRF  R + R  RI +  S + V V+E
Sbjct: 71  VAEIQVGEGMTMKRFRARAKGRGNRICKRTSNIFVRVQE 109


>gi|304438902|ref|ZP_07398825.1| 50S ribosomal protein L22 [Peptoniphilus duerdenii ATCC BAA-1640]
 gi|304372568|gb|EFM26151.1| 50S ribosomal protein L22 [Peptoniphilus duerdenii ATCC BAA-1640]
          Length = 111

 Score = 84.3 bits (207), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 65/108 (60%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AIA  +R+SP K++ +   IRGK V +A A L F+ KR A E+ K L SAVANAENN
Sbjct: 2   EARAIAKYIRISPLKVHYICDEIRGKSVEEAKAILMFTPKRGAKELLKVLNSAVANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            +LD D L V EAY      MKRF  + +     I++  S + V+V E
Sbjct: 62  LNLDADDLYVKEAYANDGPTMKRFRPKAKGMAYPILKRSSHIGVVVAE 109


>gi|295694842|ref|YP_003588080.1| ribosomal protein L22 [Bacillus tusciae DSM 2912]
 gi|295410444|gb|ADG04936.1| ribosomal protein L22 [Bacillus tusciae DSM 2912]
          Length = 113

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 68/108 (62%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  +R+SP+K  LV  +IRGK V +ALA L+ + K  +  V K L SAVANAE+N
Sbjct: 2   EATAVARYIRISPRKARLVVDLIRGKSVGEALAILKHTPKAASPVVEKVLRSAVANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           +D+DV+RL +S+  V     +KRF    + R   I +  S +TV+V E
Sbjct: 62  YDMDVERLYISKICVDPGPTLKRFQPHAQGRAFPIHKRTSHITVVVSE 109


>gi|56418646|ref|YP_145964.1| 50S ribosomal protein L22 [Geobacillus kaustophilus HTA426]
 gi|261417612|ref|YP_003251294.1| 50S ribosomal protein L22 [Geobacillus sp. Y412MC61]
 gi|297528487|ref|YP_003669762.1| ribosomal protein L22 [Geobacillus sp. C56-T3]
 gi|319765270|ref|YP_004130771.1| ribosomal protein L22 [Geobacillus sp. Y412MC52]
 gi|81675972|sp|Q5L418|RL22_GEOKA RecName: Full=50S ribosomal protein L22
 gi|56378488|dbj|BAD74396.1| 50S ribosomal protein L22 [Geobacillus kaustophilus HTA426]
 gi|261374069|gb|ACX76812.1| ribosomal protein L22 [Geobacillus sp. Y412MC61]
 gi|297251739|gb|ADI25185.1| ribosomal protein L22 [Geobacillus sp. C56-T3]
 gi|317110136|gb|ADU92628.1| ribosomal protein L22 [Geobacillus sp. Y412MC52]
          Length = 113

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 44/108 (40%), Positives = 69/108 (63%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A A+A  +R++P+K  LV  +IRGK V +A A L  + K  +  + K L SAVANAE+N
Sbjct: 2   QAKAVARTVRIAPRKARLVIDLIRGKEVGEAFAILRHTPKAASPIIEKVLKSAVANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           +D+DV+ L++++AYV +   +KRF  R   R   I +  S +T++V E
Sbjct: 62  YDMDVNNLVITQAYVDEGPTLKRFRPRAMGRASAINKRTSHITIVVSE 109


>gi|301057473|ref|ZP_07198569.1| ribosomal protein L22 [delta proteobacterium NaphS2]
 gi|300448401|gb|EFK12070.1| ribosomal protein L22 [delta proteobacterium NaphS2]
          Length = 111

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 70/110 (63%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A+A  +R+SPQK+ L+ + +RG++V DAL  L F+ ++ A  ++K + SAVANA+ N
Sbjct: 2   EIKAVARFVRISPQKIRLIMSQVRGEKVEDALGLLTFAPQKGAKILKKLVDSAVANAQEN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVS 125
            D+DVD L +S+ Y  +    KR+  R   R  +I++  S LTV++ E S
Sbjct: 62  SDMDVDNLYISKIYADEGPTHKRWRPRALGRATKILKRTSHLTVVLDEKS 111


>gi|309789662|ref|ZP_07684243.1| ribosomal protein L22 [Oscillochloris trichoides DG6]
 gi|308228398|gb|EFO82045.1| ribosomal protein L22 [Oscillochloris trichoides DG6]
          Length = 131

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 70/115 (60%), Gaps = 4/115 (3%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  AI   +R+SP K+ LV  ++RG +V  AL+ L++  ++ A EV +T+ SA ANAE+N
Sbjct: 20  EVKAITRYVRISPLKVRLVMDVVRGMKVDRALSTLQYMPQKAAREVARTIKSAAANAEHN 79

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEGKV 130
            D+D D L++++ Y  +   +KRF  R R     I +P + +TVIV    D+G+ 
Sbjct: 80  FDMDPDDLVITQIYADQGPVLKRFMPRARGMANHIRKPTTHITVIV----DDGQT 130


>gi|253995723|ref|YP_003047787.1| 50S ribosomal protein L22 [Methylotenera mobilis JLW8]
 gi|297537536|ref|YP_003673305.1| 50S ribosomal protein L22 [Methylotenera sp. 301]
 gi|253982402|gb|ACT47260.1| ribosomal protein L22 [Methylotenera mobilis JLW8]
 gi|297256883|gb|ADI28728.1| ribosomal protein L22 [Methylotenera sp. 301]
          Length = 109

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 44/106 (41%), Positives = 66/106 (62%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           + +AI   + +SPQK  LVA ++RGK+V  AL  L F+ K+ A  ++K + SA+ANAE+N
Sbjct: 2   QVSAILKGVHLSPQKARLVADLVRGKKVDHALNILNFTPKKGAEIIKKVVESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           +  D+D L V+  YV K + +KR   R + R GRI +P   + V V
Sbjct: 62  NGADIDELKVTSIYVDKGIVLKRIRPRAKGRAGRITKPTCHIHVTV 107


>gi|326803038|ref|YP_004320856.1| ribosomal protein L22 [Aerococcus urinae ACS-120-V-Col10a]
 gi|326651505|gb|AEA01688.1| ribosomal protein L22 [Aerococcus urinae ACS-120-V-Col10a]
          Length = 118

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 68/111 (61%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A A  +R+  +K  LV  +IR K V +A+A L+ + +  +  + K L SAVANAE+N 
Sbjct: 8   AKATAKTVRIPARKARLVIDLIRNKSVGEAIAILKNTPRAASPVIEKVLMSAVANAEHNS 67

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           DLDV +L VSEAYV +   MKRF  R +    RI +  S +TV+V+E  +E
Sbjct: 68  DLDVTKLYVSEAYVNEGPTMKRFRPRAKGAASRINKRTSHITVVVKEAEEE 118


>gi|329116054|ref|ZP_08244771.1| ribosomal protein L22 [Streptococcus parauberis NCFD 2020]
 gi|326906459|gb|EGE53373.1| ribosomal protein L22 [Streptococcus parauberis NCFD 2020]
          Length = 114

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 67/107 (62%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A+A  +RVSP+K  LV  +IRGK V+DA+A L+F+  + A  + KTL SA+ANAENN 
Sbjct: 7   AKAMARTVRVSPRKTRLVLDLIRGKNVADAIAILKFTPNKAARVIEKTLNSAIANAENNF 66

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            L+   L+VSE +  +   MKRF  R +     I +  + +TV+V E
Sbjct: 67  GLEKANLVVSETFANEGPTMKRFRPRAKGSASPINKRTTHVTVVVAE 113


>gi|304405611|ref|ZP_07387270.1| ribosomal protein L22 [Paenibacillus curdlanolyticus YK9]
 gi|304345650|gb|EFM11485.1| ribosomal protein L22 [Paenibacillus curdlanolyticus YK9]
          Length = 111

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 44/108 (40%), Positives = 70/108 (64%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A A A+ +R++P+K  LV  +IRGK+V +A+A L  + K  +  V K L SA+ANAE+N
Sbjct: 3   QAKAHANFVRIAPRKAQLVVDLIRGKKVGEAIAILRHTPKSASPIVEKLLNSAIANAEHN 62

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           + LDV++L++ + +V +   +KRF  R   R  RI +  S +T+IV E
Sbjct: 63  YQLDVNKLVIEQVFVNQGPTLKRFRPRAMGRASRINKRTSHITLIVSE 110


>gi|167036806|ref|YP_001664384.1| 50S ribosomal protein L22 [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|167039525|ref|YP_001662510.1| 50S ribosomal protein L22 [Thermoanaerobacter sp. X514]
 gi|256752637|ref|ZP_05493489.1| ribosomal protein L22 [Thermoanaerobacter ethanolicus CCSD1]
 gi|300915224|ref|ZP_07132539.1| ribosomal protein L22 [Thermoanaerobacter sp. X561]
 gi|307267009|ref|ZP_07548525.1| ribosomal protein L22 [Thermoanaerobacter wiegelii Rt8.B1]
 gi|307725148|ref|YP_003904899.1| 50S ribosomal protein L22 [Thermoanaerobacter sp. X513]
 gi|320115228|ref|YP_004185387.1| 50S ribosomal protein L22 [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
 gi|326390656|ref|ZP_08212211.1| ribosomal protein L22 [Thermoanaerobacter ethanolicus JW 200]
 gi|226733523|sp|B0KCK5|RL22_THEP3 RecName: Full=50S ribosomal protein L22
 gi|226733524|sp|B0K5P8|RL22_THEPX RecName: Full=50S ribosomal protein L22
 gi|166853765|gb|ABY92174.1| ribosomal protein L22 [Thermoanaerobacter sp. X514]
 gi|166855640|gb|ABY94048.1| ribosomal protein L22 [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|256748457|gb|EEU61509.1| ribosomal protein L22 [Thermoanaerobacter ethanolicus CCSD1]
 gi|300888948|gb|EFK84095.1| ribosomal protein L22 [Thermoanaerobacter sp. X561]
 gi|306917994|gb|EFN48252.1| ribosomal protein L22 [Thermoanaerobacter wiegelii Rt8.B1]
 gi|307582209|gb|ADN55608.1| ribosomal protein L22 [Thermoanaerobacter sp. X513]
 gi|319928319|gb|ADV79004.1| ribosomal protein L22 [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
 gi|325993334|gb|EGD51771.1| ribosomal protein L22 [Thermoanaerobacter ethanolicus JW 200]
          Length = 111

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 68/108 (62%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AIA  +R+SP+K+ LV  +IRGK V +AL  L F+ KR +G V K L SA+ANAENN
Sbjct: 2   EARAIARYVRISPRKVRLVLNLIRGKHVDEALTILRFTPKRASGIVAKVLKSAIANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           H ++ D L V++A   +   MKR   R   R   + +  S +T++V+E
Sbjct: 62  HGMNRDNLYVAKAVADEGPTMKRVFPRAMGRADIMRKRTSHITIVVKE 109


>gi|184155986|ref|YP_001844326.1| 50S ribosomal protein L22 [Lactobacillus fermentum IFO 3956]
 gi|227515492|ref|ZP_03945541.1| ribosomal protein L22 [Lactobacillus fermentum ATCC 14931]
 gi|260662757|ref|ZP_05863651.1| 50S ribosomal protein L22 [Lactobacillus fermentum 28-3-CHN]
 gi|226733478|sp|B2GDW4|RL22_LACF3 RecName: Full=50S ribosomal protein L22
 gi|183227330|dbj|BAG27846.1| 50S ribosomal protein L22 [Lactobacillus fermentum IFO 3956]
 gi|227086105|gb|EEI21417.1| ribosomal protein L22 [Lactobacillus fermentum ATCC 14931]
 gi|260552838|gb|EEX25837.1| 50S ribosomal protein L22 [Lactobacillus fermentum 28-3-CHN]
          Length = 115

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 51/114 (44%), Positives = 68/114 (59%), Gaps = 2/114 (1%)

Query: 12  MGDN--EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           M +N   A A A M+RVS +K+ LV   IR K V++A A L+F+    A +V K L SAV
Sbjct: 1   MAENVTSAKATAKMVRVSSRKVRLVLDTIRNKSVAEAFAILKFTPNGAASDVEKVLKSAV 60

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           ANAENN DLD   L+VSEA+  +   +KRF  R +     I +  S +TV+V E
Sbjct: 61  ANAENNFDLDQASLVVSEAFANEGPTLKRFRPRAKGSASPINKRTSHITVVVAE 114


>gi|311029054|ref|ZP_07707144.1| 50S ribosomal protein L22 [Bacillus sp. m3-13]
          Length = 113

 Score = 83.6 bits (205), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 70/108 (64%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A A+A  +R++P+K  LV  +IRGK+V +A+A L  + K  +  + K L SA+ANAE+N
Sbjct: 2   QAKAVARTVRIAPRKARLVMDLIRGKQVGEAVAILALTPKAASPVIEKVLKSAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            ++D + L+V+EAYV +   +KRF  R   R  +I +  S +T++V E
Sbjct: 62  FEMDANSLVVTEAYVNEGPTLKRFRPRAMGRASQINKRTSHITIVVSE 109


>gi|319893195|ref|YP_004150070.1| LSU ribosomal protein L22p (L17e) [Staphylococcus pseudintermedius
           HKU10-03]
 gi|317162891|gb|ADV06434.1| LSU ribosomal protein L22p (L17e) [Staphylococcus pseudintermedius
           HKU10-03]
 gi|323463757|gb|ADX75910.1| ribosomal protein L22 [Staphylococcus pseudintermedius ED99]
          Length = 117

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 44/114 (38%), Positives = 73/114 (64%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  +R++P+K+ LV  +IRGK V +A+A L+ + K  +  V K L SA+ANAE+N
Sbjct: 2   EAKAVARTIRIAPRKVRLVLDLIRGKDVREAVAILKLTNKASSPVVEKLLMSALANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEGK 129
           + ++ D+L+V EAY  +   +KRF  R + R   I +  S +T++V +  +E +
Sbjct: 62  YGMNTDQLVVKEAYANEGPTLKRFRPRAQGRASAINKRTSHITIVVSDGQEEAQ 115


>gi|319778738|ref|YP_004129651.1| LSU ribosomal protein L22p (L17e) [Taylorella equigenitalis MCE9]
 gi|317108762|gb|ADU91508.1| LSU ribosomal protein L22p (L17e) [Taylorella equigenitalis MCE9]
          Length = 112

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 66/106 (62%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  +I   + +S QK  LVA +IRGK+V  AL  L F++K+ AG ++K L SA+ANAE+N
Sbjct: 2   EVTSIVRGVHISAQKTRLVADLIRGKKVDQALHILNFTQKKAAGILKKALESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           +  D+D L V+  +V K+  MKRF  R + R  RI +    +TV V
Sbjct: 62  NGADIDELTVTTIFVDKAQSMKRFSARAKGRGNRIEKQTCHITVKV 107


>gi|219849882|ref|YP_002464315.1| 50S ribosomal protein L22 [Chloroflexus aggregans DSM 9485]
 gi|254800428|sp|B8G6S0|RL22_CHLAD RecName: Full=50S ribosomal protein L22
 gi|219544141|gb|ACL25879.1| ribosomal protein L22 [Chloroflexus aggregans DSM 9485]
          Length = 113

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 45/111 (40%), Positives = 67/111 (60%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+   +R+SP K+ LV  ++RG  V  ALA L +  ++ A EV +TL SA+ANAE+N
Sbjct: 2   EAKAVTRYVRISPLKVRLVMDVVRGMPVDRALATLRYMPQKAAREVARTLKSAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
            D++ D L +   Y  +   +KRF  R R    RI +P + +TV+V + SD
Sbjct: 62  FDMNRDELYIKTIYADQGPVLKRFMPRARGMANRIRKPTTHITVVVADKSD 112


>gi|51894205|ref|YP_076896.1| 50S ribosomal protein L22 [Symbiobacterium thermophilum IAM 14863]
 gi|81387942|sp|Q67JU8|RL22_SYMTH RecName: Full=50S ribosomal protein L22
 gi|51857894|dbj|BAD42052.1| 50S ribosomal protein L22 [Symbiobacterium thermophilum IAM 14863]
          Length = 113

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 44/108 (40%), Positives = 71/108 (65%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A A  +R++P+K+ +V  ++RGK V++ALA L+F  KR +  V K + SA ANAE+N
Sbjct: 2   EVKASARFVRIAPRKVRVVIDLVRGKSVNEALALLKFIPKRASEPVAKVIASAAANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
             L+ D L +++AYV +   +KR+H R R +   I++  S +TV+V+E
Sbjct: 62  FSLNKDNLYIAKAYVDQGPTLKRYHPRQRGQAFPILKRTSHITVVVKE 109


>gi|57239331|ref|YP_180467.1| 50S ribosomal protein L22 [Ehrlichia ruminantium str. Welgevonden]
 gi|81672784|sp|Q5HAS7|RL22_EHRRW RecName: Full=50S ribosomal protein L22
 gi|215274935|sp|Q5FFU5|RL22_EHRRG RecName: Full=50S ribosomal protein L22
 gi|57161410|emb|CAH58334.1| 50S ribosomal protein L22 [Ehrlichia ruminantium str. Welgevonden]
          Length = 114

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 64/100 (64%)

Query: 24  LRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRL 83
           LR +P KLNLVA +IRGK VS A+  L+F +K+ A  + K L SA+ANA+ N+ +DVD L
Sbjct: 13  LRSTPYKLNLVADLIRGKPVSVAVMYLKFCKKKSARYISKVLKSAIANAQANYSVDVDNL 72

Query: 84  IVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            + E  VGKS  ++R H R R +  R+ + +  + + + E
Sbjct: 73  YIKEVLVGKSFSLRRIHARARGKACRVYKHYGNVIIKLFE 112


>gi|28897036|ref|NP_796641.1| 50S ribosomal protein L22 [Vibrio parahaemolyticus RIMD 2210633]
 gi|153840300|ref|ZP_01992967.1| ribosomal protein L22 [Vibrio parahaemolyticus AQ3810]
 gi|260363908|ref|ZP_05776654.1| ribosomal protein L22 [Vibrio parahaemolyticus K5030]
 gi|260877954|ref|ZP_05890309.1| ribosomal protein L22 [Vibrio parahaemolyticus AN-5034]
 gi|260896468|ref|ZP_05904964.1| ribosomal protein L22 [Vibrio parahaemolyticus Peru-466]
 gi|262392511|ref|YP_003284365.1| 50S ribosomal protein L22p [Vibrio sp. Ex25]
 gi|269959696|ref|ZP_06174076.1| 50S ribosomal protein L22 [Vibrio harveyi 1DA3]
 gi|269964729|ref|ZP_06178967.1| 50S ribosomal protein L22 [Vibrio alginolyticus 40B]
 gi|51316823|sp|Q87T08|RL22_VIBPA RecName: Full=50S ribosomal protein L22
 gi|28805244|dbj|BAC58525.1| ribosomal protein L22 [Vibrio parahaemolyticus RIMD 2210633]
 gi|149746035|gb|EDM57165.1| ribosomal protein L22 [Vibrio parahaemolyticus AQ3810]
 gi|262336105|gb|ACY49900.1| LSU ribosomal protein L22p (L17e) [Vibrio sp. Ex25]
 gi|269830628|gb|EEZ84849.1| 50S ribosomal protein L22 [Vibrio alginolyticus 40B]
 gi|269835619|gb|EEZ89698.1| 50S ribosomal protein L22 [Vibrio harveyi 1DA3]
 gi|308087270|gb|EFO36965.1| ribosomal protein L22 [Vibrio parahaemolyticus Peru-466]
 gi|308089961|gb|EFO39656.1| ribosomal protein L22 [Vibrio parahaemolyticus AN-5034]
 gi|308111816|gb|EFO49356.1| ribosomal protein L22 [Vibrio parahaemolyticus K5030]
 gi|328471839|gb|EGF42716.1| 50S ribosomal protein L22 [Vibrio parahaemolyticus 10329]
          Length = 110

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 66/106 (62%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A  +  R+SPQK  LVA +IRGK V  AL  L FS K+ A  V+K L SA+ANAE+N
Sbjct: 2   EAIAKHNFARISPQKARLVADLIRGKSVDQALEILTFSNKKAAALVKKVLESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L V++ +V +   MKR   R + R  RI++  S +TV+V
Sbjct: 62  EGADIDDLNVAKIFVDEGPTMKRIMPRAKGRADRILKRSSHITVVV 107


>gi|256847768|ref|ZP_05553213.1| ribosomal protein L22 [Lactobacillus coleohominis 101-4-CHN]
 gi|256715457|gb|EEU30433.1| ribosomal protein L22 [Lactobacillus coleohominis 101-4-CHN]
          Length = 115

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 51/114 (44%), Positives = 68/114 (59%), Gaps = 2/114 (1%)

Query: 12  MGDN--EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           M +N   A A A M+RVS +K+ LV   IR K V++A A L+F+    A +V K L SAV
Sbjct: 1   MAENVTSAKATAKMVRVSSRKVRLVLDTIRNKSVAEAFAILKFTPNGAASDVEKVLKSAV 60

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           ANAENN DLD   L+VSEA+  +   +KRF  R +     I +  S +TV+V E
Sbjct: 61  ANAENNFDLDRASLVVSEAFANEGPTLKRFRPRAKGSASPINKRTSHITVVVTE 114


>gi|58584594|ref|YP_198167.1| 50S ribosomal protein L22 [Wolbachia endosymbiont strain TRS of
           Brugia malayi]
 gi|75497928|sp|Q5GSU9|RL22_WOLTR RecName: Full=50S ribosomal protein L22
 gi|58418910|gb|AAW70925.1| Ribosomal protein L22 [Wolbachia endosymbiont strain TRS of Brugia
           malayi]
          Length = 116

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 65/102 (63%)

Query: 23  MLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDR 82
           +LR +P+KLNLVA ++R K+VS A   L F  K+ AG + K L SA+ANA+ N+ LD+D 
Sbjct: 14  ILRSTPRKLNLVADLVRNKKVSFATVQLRFCEKKAAGLIGKVLNSAIANAQYNYGLDIDN 73

Query: 83  LIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV 124
           L + E  +GKS  + R   +   R  R+ + +S +T+ +R++
Sbjct: 74  LYIKEILIGKSFTLHRVCPKAMGRANRVSKHYSNITIKLRQI 115


>gi|19704961|ref|NP_602456.1| 50S ribosomal protein L22P [Fusobacterium nucleatum subsp.
           nucleatum ATCC 25586]
 gi|237742667|ref|ZP_04573148.1| LSU ribosomal protein L22P [Fusobacterium sp. 4_1_13]
 gi|254303415|ref|ZP_04970773.1| ribosomal protein L22 [Fusobacterium nucleatum subsp. polymorphum
           ATCC 10953]
 gi|294784807|ref|ZP_06750095.1| ribosomal protein L22 [Fusobacterium sp. 3_1_27]
 gi|296329215|ref|ZP_06871716.1| 50S ribosomal protein L22 [Fusobacterium nucleatum subsp. nucleatum
           ATCC 23726]
 gi|51316491|sp|Q8RIG0|RL22_FUSNN RecName: Full=50S ribosomal protein L22
 gi|19712863|gb|AAL93755.1| LSU ribosomal protein L22P [Fusobacterium nucleatum subsp.
           nucleatum ATCC 25586]
 gi|148323607|gb|EDK88857.1| ribosomal protein L22 [Fusobacterium nucleatum subsp. polymorphum
           ATCC 10953]
 gi|229430315|gb|EEO40527.1| LSU ribosomal protein L22P [Fusobacterium sp. 4_1_13]
 gi|294486521|gb|EFG33883.1| ribosomal protein L22 [Fusobacterium sp. 3_1_27]
 gi|296153571|gb|EFG94388.1| 50S ribosomal protein L22 [Fusobacterium nucleatum subsp. nucleatum
           ATCC 23726]
          Length = 111

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 49/112 (43%), Positives = 68/112 (60%), Gaps = 3/112 (2%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AI   +R+SP+K  LVA ++RGK   +AL  LEF+ K+ A  ++KTL SA+ANA NN
Sbjct: 2   EAKAITRFVRLSPRKARLVADLVRGKSALEALDILEFTNKKAARVIKKTLSSAIANATNN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
             +D D+L+VS   V +   +KR   R   R   I +P + +TV    VSDE
Sbjct: 62  FKMDEDKLVVSTIMVNQGPVLKRVMPRAMGRADIIRKPTAHITV---AVSDE 110


>gi|28377837|ref|NP_784729.1| 50S ribosomal protein L22 [Lactobacillus plantarum WCFS1]
 gi|51316441|sp|Q88XY1|RL22_LACPL RecName: Full=50S ribosomal protein L22
 gi|28270670|emb|CAD63576.1| ribosomal protein L22 [Lactobacillus plantarum WCFS1]
          Length = 115

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 68/107 (63%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A A  +R++ +K+ LV  +IRGK V++ALA L+F+ +  +  V K L SAVANAENN 
Sbjct: 8   ARATAKTVRIAARKVRLVVDLIRGKSVAEALAILKFTPRGASPVVEKVLLSAVANAENNF 67

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           DLD + L+VSEA+V +   +KRF  R +     I +  S +T+ V E
Sbjct: 68  DLDREDLVVSEAFVNEGPTLKRFRARAKGSASPINKRTSHITITVTE 114


>gi|261854955|ref|YP_003262238.1| ribosomal protein L22 [Halothiobacillus neapolitanus c2]
 gi|261835424|gb|ACX95191.1| ribosomal protein L22 [Halothiobacillus neapolitanus c2]
          Length = 110

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 46/108 (42%), Positives = 66/108 (61%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A A+    R+SPQK  LVA ++RG+ V+ A+  L FS K+ A  ++K L SA+ANAENN
Sbjct: 2   QATALHRYARISPQKARLVADLVRGQGVAQAIETLTFSDKKGADLIKKVLESAIANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
              DVDRL ++   V +   +KRF  R + R  RI++  S + V V E
Sbjct: 62  EGADVDRLRIATIMVDEGPVLKRFRARAKGRGARILKKTSHILVTVSE 109


>gi|169335634|ref|ZP_02862827.1| hypothetical protein ANASTE_02054 [Anaerofustis stercorihominis DSM
           17244]
 gi|169258372|gb|EDS72338.1| hypothetical protein ANASTE_02054 [Anaerofustis stercorihominis DSM
           17244]
          Length = 111

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 68/108 (62%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A  LRVSP K+  VA+++RGK + +A+  L+ +  + A E+ K + SA ANAENN
Sbjct: 2   EAKATAKYLRVSPIKVKRVASLVRGKNLGEAINILKLTGNKPAREIEKVVKSAAANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           HD+DV +L +SE    +   +KRF    + R   I++  S ++V+++E
Sbjct: 62  HDMDVTKLYISEISANQGPTLKRFRAGSQGRASMILKRSSHISVVLKE 109


>gi|217077288|ref|YP_002335006.1| 50S ribosomal protein L22 [Thermosipho africanus TCF52B]
 gi|226733522|sp|B7IHV1|RL22_THEAB RecName: Full=50S ribosomal protein L22
 gi|217037143|gb|ACJ75665.1| 50S ribosomal protein L22 [Thermosipho africanus TCF52B]
          Length = 148

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 64/108 (59%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  +R+SP+K   VA  I+GK VS+A   LEFS K+ A  ++  L SAVANA NN
Sbjct: 30  EARAVAKFVRISPRKARSVANSIKGKNVSEAFTILEFSPKKAARLIKNVLKSAVANAVNN 89

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           H L+ + L V   YV     MKR   RGR     I +  S +TVIVR+
Sbjct: 90  HGLNEENLYVYTCYVNDGPRMKRIWPRGRGSADIIQKRMSHITVIVRD 137


>gi|58579297|ref|YP_197509.1| 50S ribosomal protein L22 [Ehrlichia ruminantium str. Welgevonden]
 gi|58617351|ref|YP_196550.1| 50S ribosomal protein L22 [Ehrlichia ruminantium str. Gardel]
 gi|58416963|emb|CAI28076.1| 50S ribosomal protein L22 [Ehrlichia ruminantium str. Gardel]
 gi|58417923|emb|CAI27127.1| 50S ribosomal protein L22 [Ehrlichia ruminantium str. Welgevonden]
          Length = 145

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 62/96 (64%)

Query: 24  LRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRL 83
           LR +P KLNLVA +IRGK VS A+  L+F +K+ A  + K L SA+ANA+ N+ +DVD L
Sbjct: 44  LRSTPYKLNLVADLIRGKPVSVAVMYLKFCKKKSARYISKVLKSAIANAQANYSVDVDNL 103

Query: 84  IVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTV 119
            + E  VGKS  ++R H R R +  R+ + +  + +
Sbjct: 104 YIKEVLVGKSFSLRRIHARARGKACRVYKHYGNVII 139


>gi|20808655|ref|NP_623826.1| 50S ribosomal protein L22 [Thermoanaerobacter tengcongensis MB4]
 gi|51316879|sp|Q8R7V9|RL22_THETN RecName: Full=50S ribosomal protein L22
 gi|20517289|gb|AAM25430.1| Ribosomal protein L22 [Thermoanaerobacter tengcongensis MB4]
          Length = 112

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 69/108 (63%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AIA  +R+SP+K  LV  +IRGK V +ALA L+F+ K+ +  V K L SA+ANAENN
Sbjct: 2   EARAIARYVRISPRKARLVLNLIRGKHVDEALAILKFTPKKASKIVEKVLKSAIANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           H+++ D L V++A   +   MKR   R   R   + R  S +T++V+E
Sbjct: 62  HNMNRDNLYVAKAVADEGPTMKRVLPRAMGRADIMRRRTSHITIVVKE 109


>gi|260779498|ref|ZP_05888388.1| LSU ribosomal protein L22p (L17e) [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260604307|gb|EEX30611.1| LSU ribosomal protein L22p (L17e) [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 110

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 65/106 (61%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A  +  R+SPQK  LVA  IRGK V  AL  L FS K+ A  V+K L SA+ANAE+N
Sbjct: 2   EALAKHNFARISPQKARLVADQIRGKSVDQALEILTFSNKKAADLVKKVLESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L V++ +V +   MKR   R + R  RI++  S +TV+V
Sbjct: 62  EGADIDDLSVAKIFVDEGPIMKRIMPRAKGRADRILKRSSHITVVV 107


>gi|197287073|ref|YP_002152945.1| 50S ribosomal protein L22 [Proteus mirabilis HI4320]
 gi|227354929|ref|ZP_03839343.1| 50S ribosomal protein L22 [Proteus mirabilis ATCC 29906]
 gi|226733497|sp|B4F1I9|RL22_PROMH RecName: Full=50S ribosomal protein L22
 gi|194684560|emb|CAR46388.1| 50S ribosomal protein L22 [Proteus mirabilis HI4320]
 gi|227165011|gb|EEI49850.1| 50S ribosomal protein L22 [Proteus mirabilis ATCC 29906]
          Length = 110

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 68/108 (62%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  AI    R S QK+ LVA +IRGK+VS AL  L ++ K+ AG V+K L SA+ANAE+N
Sbjct: 2   ETIAIHRHARSSAQKVRLVADLIRGKKVSQALETLTYTNKKAAGLVKKVLESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
              D+D L V++ +V +   MKR   R + R  RI++  S +TV+V +
Sbjct: 62  DGADIDDLKVAKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSD 109


>gi|161506878|ref|YP_001576832.1| 50S ribosomal protein L22 [Lactobacillus helveticus DPC 4571]
 gi|227879248|ref|ZP_03997118.1| ribosomal protein L22 [Lactobacillus crispatus JV-V01]
 gi|227894525|ref|ZP_04012330.1| ribosomal protein L22 [Lactobacillus ultunensis DSM 16047]
 gi|256844434|ref|ZP_05549920.1| 50S ribosomal protein L22 [Lactobacillus crispatus 125-2-CHN]
 gi|256849178|ref|ZP_05554611.1| 50S ribosomal protein L22 [Lactobacillus crispatus MV-1A-US]
 gi|260102360|ref|ZP_05752597.1| 50S ribosomal protein L22 [Lactobacillus helveticus DSM 20075]
 gi|262047194|ref|ZP_06020152.1| 50S ribosomal protein L22 [Lactobacillus crispatus MV-3A-US]
 gi|293380382|ref|ZP_06626453.1| 50S ribosomal protein L22 [Lactobacillus crispatus 214-1]
 gi|295692165|ref|YP_003600775.1| 50S ribosomal protein l22 [Lactobacillus crispatus ST1]
 gi|315037535|ref|YP_004031103.1| 50S ribosomal protein L22 [Lactobacillus amylovorus GRL 1112]
 gi|325956008|ref|YP_004286618.1| 50S ribosomal protein L22 [Lactobacillus acidophilus 30SC]
 gi|172048372|sp|A8YXL0|RL22_LACH4 RecName: Full=50S ribosomal protein L22
 gi|160347867|gb|ABX26541.1| 50S ribosomal protein L22 [Lactobacillus helveticus DPC 4571]
 gi|227861142|gb|EEJ68791.1| ribosomal protein L22 [Lactobacillus crispatus JV-V01]
 gi|227863684|gb|EEJ71105.1| ribosomal protein L22 [Lactobacillus ultunensis DSM 16047]
 gi|256613512|gb|EEU18715.1| 50S ribosomal protein L22 [Lactobacillus crispatus 125-2-CHN]
 gi|256713954|gb|EEU28942.1| 50S ribosomal protein L22 [Lactobacillus crispatus MV-1A-US]
 gi|260083804|gb|EEW67924.1| 50S ribosomal protein L22 [Lactobacillus helveticus DSM 20075]
 gi|260572439|gb|EEX29001.1| 50S ribosomal protein L22 [Lactobacillus crispatus MV-3A-US]
 gi|290923065|gb|EFD99996.1| 50S ribosomal protein L22 [Lactobacillus crispatus 214-1]
 gi|295030271|emb|CBL49750.1| 50S ribosomal protein L22 [Lactobacillus crispatus ST1]
 gi|312275668|gb|ADQ58308.1| 50S ribosomal protein L22 [Lactobacillus amylovorus GRL 1112]
 gi|325332573|gb|ADZ06481.1| 50S ribosomal protein L22 [Lactobacillus acidophilus 30SC]
 gi|327182831|gb|AEA31278.1| 50S ribosomal protein L22 [Lactobacillus amylovorus GRL 1118]
 gi|328463369|gb|EGF35042.1| 50S ribosomal protein L22 [Lactobacillus helveticus MTCC 5463]
          Length = 117

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 48/110 (43%), Positives = 69/110 (62%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A A  +R++P+K  LV  +IRGK V++ALA LEF+ +  +  V K L SA+ANAE+N+
Sbjct: 8   AKAEARTVRIAPRKARLVVDLIRGKSVAEALAILEFTPRAASPIVEKVLRSAIANAEHNY 67

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           DL+   L VSEAYV +   +KRF  R +     I +  S + V+V E +D
Sbjct: 68  DLESANLYVSEAYVNEGATLKRFRPRAKGMASPINKRTSHVVVVVSEKND 117


>gi|310779591|ref|YP_003967924.1| LSU ribosomal protein L22P [Ilyobacter polytropus DSM 2926]
 gi|309748914|gb|ADO83576.1| LSU ribosomal protein L22P [Ilyobacter polytropus DSM 2926]
          Length = 110

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 45/108 (41%), Positives = 65/108 (60%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A    +R+SPQK  LVA ++RGK   +AL  L+F+ K+ A  ++KTL SA+ANA NN
Sbjct: 2   EARATTKYVRLSPQKARLVADLVRGKSALEALDILQFANKKAATVIKKTLASAIANATNN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            D+D ++L+VS   V +   +KR   R   R   I +P + + V V E
Sbjct: 62  FDMDEEKLVVSTIMVNQGPVLKRIMPRAMGRADIIRKPTAHIVVAVSE 109


>gi|256846062|ref|ZP_05551520.1| ribosomal protein L22 [Fusobacterium sp. 3_1_36A2]
 gi|256719621|gb|EEU33176.1| ribosomal protein L22 [Fusobacterium sp. 3_1_36A2]
          Length = 111

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 49/112 (43%), Positives = 68/112 (60%), Gaps = 3/112 (2%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AI   +R+SP+K  LVA ++RGK   +AL  LEF+ K+ A  ++KTL SA+ANA NN
Sbjct: 2   EAKAITRFVRLSPRKARLVADLVRGKSALEALDILEFTNKKAARVIKKTLSSAIANAANN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
             +D D+L+VS   V +   +KR   R   R   I +P + +TV    VSDE
Sbjct: 62  FKMDEDKLVVSTIMVNQGPVLKRVMPRAMGRADIIRKPTAHITV---AVSDE 110


>gi|294496990|ref|YP_003560690.1| 50S ribosomal protein L22 [Bacillus megaterium QM B1551]
 gi|295702355|ref|YP_003595430.1| 50S ribosomal protein L22 [Bacillus megaterium DSM 319]
 gi|294346927|gb|ADE67256.1| 50S ribosomal protein L22 [Bacillus megaterium QM B1551]
 gi|294800014|gb|ADF37080.1| 50S ribosomal protein L22 [Bacillus megaterium DSM 319]
          Length = 113

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 72/108 (66%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A A+A  +R++P+K+ LV  +IRGK+V +ALA L  + K  +  V K L SA+ANAE+N
Sbjct: 2   QAKAVARTVRIAPRKVRLVVDLIRGKQVGEALAVLLHTPKAASPVVEKVLKSAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           +++D + L++++A+V +   +KRF  R   R  +I +  S +T++V E
Sbjct: 62  YEMDANNLVITDAFVNEGPTLKRFRPRAMGRASQINKRTSHITIVVSE 109


>gi|134298098|ref|YP_001111594.1| 50S ribosomal protein L22 [Desulfotomaculum reducens MI-1]
 gi|172044223|sp|A4J116|RL22_DESRM RecName: Full=50S ribosomal protein L22
 gi|134050798|gb|ABO48769.1| LSU ribosomal protein L22P [Desulfotomaculum reducens MI-1]
          Length = 113

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 67/106 (63%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AIA  +RVSP+K  +V  +IRGK+V +ALA L ++  + A  V K + SA ANAE+N
Sbjct: 2   EAKAIAKFIRVSPRKARMVVDLIRGKKVEEALAILRYTPNKAAAAVTKVVKSAAANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           +D+D + L+VS+ +V +   +KR   R   R   I R  S +TV+V
Sbjct: 62  NDMDKEELVVSQIFVDQGPSLKRMMPRAMGRADIIKRRTSHITVVV 107


>gi|310644197|ref|YP_003948956.1| 50S ribosomal protein l22 [Paenibacillus polymyxa SC2]
 gi|309249148|gb|ADO58715.1| 50S ribosomal protein L22 [Paenibacillus polymyxa SC2]
          Length = 110

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 46/108 (42%), Positives = 70/108 (64%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A  +R+S +K+ LV  +IRGK+V +A+A L  + K  +  V K L SA+ANA++N
Sbjct: 2   EAKAHAKSVRISARKVKLVIDLIRGKQVGEAIAILRHTPKSASPVVEKLLNSAIANADHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           + +DV++L+VSE +V +   MKRF  R   R  RI +  S +T++V E
Sbjct: 62  YSMDVNKLVVSEVFVNQGPTMKRFRPRAMGRASRINKRTSHITLVVSE 109


>gi|152973961|ref|YP_001373478.1| 50S ribosomal protein L22 [Bacillus cereus subsp. cytotoxis NVH
           391-98]
 gi|189041941|sp|A7GK25|RL22_BACCN RecName: Full=50S ribosomal protein L22
 gi|152022713|gb|ABS20483.1| ribosomal protein L22 [Bacillus cytotoxicus NVH 391-98]
          Length = 113

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 71/108 (65%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A A+A  +R++P+K+ LV  +IRGK+V +A+A L  + K  +  V K L SA+ANAE+N
Sbjct: 2   QAKAVARTVRIAPRKVRLVVDLIRGKQVGEAIAILNHTPKTASPVVEKVLKSAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           +++DV+ L+V + +V +   +KRF  R   R  +I +  S +TV+V E
Sbjct: 62  YEMDVNNLVVEKVFVDEGPTLKRFRPRAMGRASQINKRTSHITVVVSE 109


>gi|78044381|ref|YP_361113.1| 50S ribosomal protein L22 [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|109893188|sp|Q3A9S1|RL22_CARHZ RecName: Full=50S ribosomal protein L22
 gi|77996496|gb|ABB15395.1| ribosomal protein L22 [Carboxydothermus hydrogenoformans Z-2901]
          Length = 113

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 44/108 (40%), Positives = 69/108 (63%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  +R+SP+K   V  +IRGK V +ALA L ++ K+ +  + K L SA+ANAENN
Sbjct: 2   EARAVAKYIRISPRKARQVIDLIRGKDVEEALAILRYTPKKASYFIEKVLRSAIANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           HD+  + L V++AYV +   +KR++ R + R+       S +T++V E
Sbjct: 62  HDMSKENLYVAKAYVDQGPTLKRYNPRAQGRVDLWRVRTSHITIVVAE 109


>gi|121997644|ref|YP_001002431.1| 50S ribosomal protein L22 [Halorhodospira halophila SL1]
 gi|166199501|sp|A1WVB7|RL22_HALHL RecName: Full=50S ribosomal protein L22
 gi|121589049|gb|ABM61629.1| LSU ribosomal protein L22P [Halorhodospira halophila SL1]
          Length = 110

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 63/108 (58%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A     RVSPQK  LVA  IRG  V DAL  LE+S ++ A  VRK L SAVANAE+N
Sbjct: 2   ETQAKLRFSRVSPQKARLVADQIRGLPVDDALRTLEYSPRKAAEIVRKVLESAVANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
              DVD L V+  +V +   MKR   R + R  RI++  S +TV V E
Sbjct: 62  DGADVDELRVARIFVDEGPTMKRIQPRAKGRANRILKRTSHITVAVAE 109


>gi|308070970|ref|YP_003872575.1| 50S ribosomal protein L22 [Paenibacillus polymyxa E681]
 gi|305860249|gb|ADM72037.1| 50S ribosomal protein L22 [Paenibacillus polymyxa E681]
          Length = 110

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 46/108 (42%), Positives = 70/108 (64%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A  +R+S +K+ LV  +IRGK+V +A+A L  + K  +  V K L SA+ANA++N
Sbjct: 2   EAKAHAKSVRISARKVKLVIDLIRGKQVGEAIAILRHTPKSASPVVEKLLNSAIANADHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           + LDV++L+VS+ +V +   MKRF  R   R  RI +  S +T++V E
Sbjct: 62  YSLDVNKLVVSQVFVNQGPTMKRFRPRAMGRASRINKRTSHITLVVSE 109


>gi|58336635|ref|YP_193220.1| 50S ribosomal protein L22 [Lactobacillus acidophilus NCFM]
 gi|227903192|ref|ZP_04020997.1| ribosomal protein L22 [Lactobacillus acidophilus ATCC 4796]
 gi|295425647|ref|ZP_06818334.1| 50S ribosomal protein L22 [Lactobacillus amylolyticus DSM 11664]
 gi|75358066|sp|Q5FM85|RL22_LACAC RecName: Full=50S ribosomal protein L22
 gi|58253952|gb|AAV42189.1| 50S ribosomal protein L22 [Lactobacillus acidophilus NCFM]
 gi|227868997|gb|EEJ76418.1| ribosomal protein L22 [Lactobacillus acidophilus ATCC 4796]
 gi|295064663|gb|EFG55584.1| 50S ribosomal protein L22 [Lactobacillus amylolyticus DSM 11664]
          Length = 117

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 48/110 (43%), Positives = 69/110 (62%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A A  +R++P+K  LV  +IRGK V++ALA LEF+ +  +  V K L SA+ANAE+N+
Sbjct: 8   AKAEARTVRIAPRKARLVIDLIRGKSVAEALAILEFTPRAASPIVEKVLRSAIANAEHNY 67

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           DL+   L VSEAYV +   +KRF  R +     I +  S + V+V E +D
Sbjct: 68  DLESANLYVSEAYVNEGATLKRFRPRAKGMASPINKRTSHVVVVVSEKND 117


>gi|254556022|ref|YP_003062439.1| 50S ribosomal protein L22 [Lactobacillus plantarum JDM1]
 gi|300767826|ref|ZP_07077736.1| 50S ribosomal protein L22 [Lactobacillus plantarum subsp. plantarum
           ATCC 14917]
 gi|308180016|ref|YP_003924144.1| 50S ribosomal protein L22 [Lactobacillus plantarum subsp. plantarum
           ST-III]
 gi|254044949|gb|ACT61742.1| 50S ribosomal protein L22 [Lactobacillus plantarum JDM1]
 gi|300494811|gb|EFK29969.1| 50S ribosomal protein L22 [Lactobacillus plantarum subsp. plantarum
           ATCC 14917]
 gi|308045507|gb|ADN98050.1| 50S ribosomal protein L22 [Lactobacillus plantarum subsp. plantarum
           ST-III]
          Length = 115

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 68/107 (63%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A A  +R++ +K+ LV  +IRGK V++ALA L+F+ +  +  V K L SAVANAENN 
Sbjct: 8   ARATAKTVRIAARKVRLVVDLIRGKSVAEALAILKFTPRGASPVVEKVLLSAVANAENNF 67

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           DLD + L+VSEA+V +   +KRF  R +     I +  S +T+ V E
Sbjct: 68  DLDREDLVVSEAFVNEGPTLKRFRPRAKGSASPINKRTSHITITVTE 114


>gi|30018385|ref|NP_830016.1| 50S ribosomal protein L22 [Bacillus cereus ATCC 14579]
 gi|228956556|ref|ZP_04118352.1| 50S ribosomal protein L22 [Bacillus thuringiensis serovar pakistani
           str. T13001]
 gi|228976874|ref|ZP_04137286.1| 50S ribosomal protein L22 [Bacillus thuringiensis Bt407]
 gi|229074176|ref|ZP_04207222.1| 50S ribosomal protein L22 [Bacillus cereus Rock4-18]
 gi|229094837|ref|ZP_04225842.1| 50S ribosomal protein L22 [Bacillus cereus Rock3-29]
 gi|229100914|ref|ZP_04231718.1| 50S ribosomal protein L22 [Bacillus cereus Rock3-28]
 gi|229113791|ref|ZP_04243226.1| 50S ribosomal protein L22 [Bacillus cereus Rock1-3]
 gi|229125632|ref|ZP_04254664.1| 50S ribosomal protein L22 [Bacillus cereus BDRD-Cer4]
 gi|229148524|ref|ZP_04276780.1| 50S ribosomal protein L22 [Bacillus cereus m1550]
 gi|229188400|ref|ZP_04315448.1| 50S ribosomal protein L22 [Bacillus cereus ATCC 10876]
 gi|29893925|gb|AAP07217.1| LSU ribosomal protein L22P [Bacillus cereus ATCC 14579]
 gi|228595074|gb|EEK52845.1| 50S ribosomal protein L22 [Bacillus cereus ATCC 10876]
 gi|228634940|gb|EEK91513.1| 50S ribosomal protein L22 [Bacillus cereus m1550]
 gi|228657824|gb|EEL13630.1| 50S ribosomal protein L22 [Bacillus cereus BDRD-Cer4]
 gi|228669662|gb|EEL25069.1| 50S ribosomal protein L22 [Bacillus cereus Rock1-3]
 gi|228682493|gb|EEL36566.1| 50S ribosomal protein L22 [Bacillus cereus Rock3-28]
 gi|228688580|gb|EEL42453.1| 50S ribosomal protein L22 [Bacillus cereus Rock3-29]
 gi|228708946|gb|EEL61073.1| 50S ribosomal protein L22 [Bacillus cereus Rock4-18]
 gi|228782844|gb|EEM31010.1| 50S ribosomal protein L22 [Bacillus thuringiensis Bt407]
 gi|228803121|gb|EEM49943.1| 50S ribosomal protein L22 [Bacillus thuringiensis serovar pakistani
           str. T13001]
          Length = 119

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 71/108 (65%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A A+A  +R++P+K+ LV  +IRGK+V +A+A L  + K  +  V K L SA+ANAE+N
Sbjct: 8   QAKAVARTVRIAPRKVRLVVDLIRGKQVGEAIAILNHTPKTASPVVEKVLKSAIANAEHN 67

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           +++D++ L+V + +V +   +KRF  R   R  +I +  S +TV+V E
Sbjct: 68  YEMDINNLVVEKVFVDEGPTLKRFRPRAMGRASQINKRTSHITVVVSE 115


>gi|300721370|ref|YP_003710641.1| 50S ribosomal subunit protein L22 [Xenorhabdus nematophila ATCC
           19061]
 gi|297627858|emb|CBJ88404.1| 50S ribosomal subunit protein L22 [Xenorhabdus nematophila ATCC
           19061]
          Length = 110

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 65/99 (65%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R S QK+ LVA +IRGK+VS AL  L ++ K+ AG V+K L SA+ANAE+N   D+D L 
Sbjct: 11  RSSAQKVRLVADLIRGKKVSQALETLTYTNKKAAGLVKKVLESAIANAEHNDGADIDDLK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           V++ +V +   MKR   R + R  RI++  S +TV+V +
Sbjct: 71  VTKIFVDEGPTMKRIMPRAKGRADRILKRTSHITVVVSD 109


>gi|255020770|ref|ZP_05292828.1| LSU ribosomal protein L22p (L17e) [Acidithiobacillus caldus ATCC
           51756]
 gi|254969766|gb|EET27270.1| LSU ribosomal protein L22p (L17e) [Acidithiobacillus caldus ATCC
           51756]
          Length = 99

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 44/98 (44%), Positives = 62/98 (63%)

Query: 26  VSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLIV 85
           +SPQK  LVA ++RG+ V+ AL  L+F+ K+ A  +RK L SAVANAENN   DVD L+V
Sbjct: 1   MSPQKARLVADLVRGQPVAKALEILQFTNKKAALPIRKCLESAVANAENNEGADVDALVV 60

Query: 86  SEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
               +     +KRF  R + R  RI++  S +T++V E
Sbjct: 61  ESIQIDGGTVLKRFAARAKGRGSRILKRTSHITIVVAE 98


>gi|52078614|ref|YP_077405.1| 50S ribosomal protein L22 [Bacillus licheniformis ATCC 14580]
 gi|52783976|ref|YP_089805.1| 50S ribosomal protein L22 [Bacillus licheniformis ATCC 14580]
 gi|319649111|ref|ZP_08003319.1| 50S ribosomal protein L22 [Bacillus sp. BT1B_CT2]
 gi|81691249|sp|Q65PA2|RL22_BACLD RecName: Full=50S ribosomal protein L22
 gi|52001825|gb|AAU21767.1| ribosomal protein L22 (BL17) [Bacillus licheniformis ATCC 14580]
 gi|52346478|gb|AAU39112.1| RplV [Bacillus licheniformis ATCC 14580]
 gi|317388811|gb|EFV69630.1| 50S ribosomal protein L22 [Bacillus sp. BT1B_CT2]
          Length = 114

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 71/108 (65%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A A+A  +R++P+K  LV  +IRGK+V +A++ L  + K  +  + K L SA+ANAE+N
Sbjct: 3   QAKAVARTVRIAPRKARLVMDLIRGKQVGEAVSILNHTPKAASPIIEKVLKSAIANAEHN 62

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           +++D + L+V++AYV +   +KRF  R   R  +I +  S +T++V E
Sbjct: 63  YEMDANNLVVTQAYVNEGPTLKRFRPRAMGRASQINKRTSHITIVVSE 110


>gi|171778380|ref|ZP_02919559.1| hypothetical protein STRINF_00410 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
 gi|288904278|ref|YP_003429499.1| ribosomal protein L22 [Streptococcus gallolyticus UCN34]
 gi|306830307|ref|ZP_07463478.1| 50S ribosomal protein L22 [Streptococcus gallolyticus subsp.
           gallolyticus TX20005]
 gi|306832552|ref|ZP_07465692.1| 50S ribosomal protein L22 [Streptococcus bovis ATCC 700338]
 gi|320548050|ref|ZP_08042330.1| 50S ribosomal protein L22 [Streptococcus equinus ATCC 9812]
 gi|325977257|ref|YP_004286973.1| 50S ribosomal protein L22 [Streptococcus gallolyticus subsp.
           gallolyticus ATCC BAA-2069]
 gi|171282911|gb|EDT48335.1| hypothetical protein STRINF_00410 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
 gi|288731003|emb|CBI12547.1| ribosomal protein L22 [Streptococcus gallolyticus UCN34]
 gi|304425310|gb|EFM28436.1| 50S ribosomal protein L22 [Streptococcus bovis ATCC 700338]
 gi|304427554|gb|EFM30655.1| 50S ribosomal protein L22 [Streptococcus gallolyticus subsp.
           gallolyticus TX20005]
 gi|320447292|gb|EFW88055.1| 50S ribosomal protein L22 [Streptococcus equinus ATCC 9812]
 gi|325177185|emb|CBZ47229.1| 50S ribosomal protein L22 [Streptococcus gallolyticus subsp.
           gallolyticus ATCC BAA-2069]
          Length = 114

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 66/107 (61%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A+A  +RVSP+K  LV  +IRGK V+DA+A L+F+  + A  V K L SA+ANAENN 
Sbjct: 7   AKAMARTVRVSPRKTRLVLDLIRGKNVADAIAILKFTPNKAARVVEKVLNSAIANAENNF 66

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            L+   L+VSE +  +   MKRF  R +     I +  + +TV+V E
Sbjct: 67  GLEKANLVVSETFANEGPTMKRFRPRAKGSASPINKRTTHVTVVVSE 113


>gi|296131841|ref|YP_003639088.1| ribosomal protein L22 [Thermincola sp. JR]
 gi|296030419|gb|ADG81187.1| ribosomal protein L22 [Thermincola potens JR]
          Length = 113

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 44/108 (40%), Positives = 68/108 (62%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  +R+SP+K   V  +IRGK V +ALA L+F+ ++ A  + K + SA ANAENN
Sbjct: 2   EAKAVARYIRISPRKARQVVDLIRGKSVKEALAILKFTPQKAAEAIEKVVKSAAANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            ++D D L +S+ +V +   +KR+  R   R   + R  S +TV+V+E
Sbjct: 62  FEMDKDSLYISQIFVDQGPTLKRYKPRAMGRADLMRRRTSHITVVVKE 109


>gi|260770918|ref|ZP_05879847.1| LSU ribosomal protein L22p (L17e) [Vibrio furnissii CIP 102972]
 gi|260614155|gb|EEX39345.1| LSU ribosomal protein L22p (L17e) [Vibrio furnissii CIP 102972]
 gi|315178964|gb|ADT85878.1| 50S ribosomal protein L22 [Vibrio furnissii NCTC 11218]
          Length = 110

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 66/106 (62%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A  +  R+SPQK  LVA +IRGK V  AL  L FS K+ A  ++K L SA+ANAE+N
Sbjct: 2   EALAKHNFARISPQKARLVADLIRGKSVDQALEVLTFSNKKAADLIKKVLESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L V++ +V +   MKR   R + R  RI++  S +TV+V
Sbjct: 62  EGADIDDLRVAKIFVDEGPVMKRIMPRAKGRADRILKRSSHITVVV 107


>gi|42779196|ref|NP_976443.1| 50S ribosomal protein L22 [Bacillus cereus ATCC 10987]
 gi|206972211|ref|ZP_03233158.1| 50S ribosomal protein L22 [Bacillus cereus AH1134]
 gi|217957690|ref|YP_002336234.1| 50S ribosomal protein L22 [Bacillus cereus AH187]
 gi|218233892|ref|YP_002364964.1| 50S ribosomal protein L22 [Bacillus cereus B4264]
 gi|218895250|ref|YP_002443661.1| ribosomal protein L22 [Bacillus cereus G9842]
 gi|222093885|ref|YP_002527935.1| 50S ribosomal protein l22 [Bacillus cereus Q1]
 gi|228898868|ref|ZP_04063150.1| 50S ribosomal protein L22 [Bacillus thuringiensis IBL 4222]
 gi|228905912|ref|ZP_04069809.1| 50S ribosomal protein L22 [Bacillus thuringiensis IBL 200]
 gi|228919065|ref|ZP_04082444.1| 50S ribosomal protein L22 [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228937418|ref|ZP_04100064.1| 50S ribosomal protein L22 [Bacillus thuringiensis serovar berliner
           ATCC 10792]
 gi|228950663|ref|ZP_04112797.1| 50S ribosomal protein L22 [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
 gi|228963215|ref|ZP_04124384.1| 50S ribosomal protein L22 [Bacillus thuringiensis serovar sotto
           str. T04001]
 gi|228970304|ref|ZP_04130963.1| 50S ribosomal protein L22 [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|229015517|ref|ZP_04172515.1| 50S ribosomal protein L22 [Bacillus cereus AH1273]
 gi|229027963|ref|ZP_04184116.1| 50S ribosomal protein L22 [Bacillus cereus AH1271]
 gi|229041020|ref|ZP_04189783.1| 50S ribosomal protein L22 [Bacillus cereus AH676]
 gi|229067880|ref|ZP_04201197.1| 50S ribosomal protein L22 [Bacillus cereus F65185]
 gi|229083435|ref|ZP_04215783.1| 50S ribosomal protein L22 [Bacillus cereus Rock3-44]
 gi|229107801|ref|ZP_04237437.1| 50S ribosomal protein L22 [Bacillus cereus Rock1-15]
 gi|229136961|ref|ZP_04265588.1| 50S ribosomal protein L22 [Bacillus cereus BDRD-ST26]
 gi|229142921|ref|ZP_04271362.1| 50S ribosomal protein L22 [Bacillus cereus BDRD-ST24]
 gi|229159288|ref|ZP_04287312.1| 50S ribosomal protein L22 [Bacillus cereus R309803]
 gi|229170966|ref|ZP_04298567.1| 50S ribosomal protein L22 [Bacillus cereus MM3]
 gi|229176715|ref|ZP_04304119.1| 50S ribosomal protein L22 [Bacillus cereus 172560W]
 gi|229194505|ref|ZP_04321308.1| 50S ribosomal protein L22 [Bacillus cereus m1293]
 gi|296500948|ref|YP_003662648.1| 50S ribosomal protein L22 [Bacillus thuringiensis BMB171]
 gi|51316286|sp|Q73F91|RL22_BACC1 RecName: Full=50S ribosomal protein L22
 gi|215273891|sp|Q81J37|RL22_BACCR RecName: Full=50S ribosomal protein L22
 gi|226733430|sp|B7IT24|RL22_BACC2 RecName: Full=50S ribosomal protein L22
 gi|226733431|sp|B7HJ53|RL22_BACC4 RecName: Full=50S ribosomal protein L22
 gi|226733432|sp|B7HQU9|RL22_BACC7 RecName: Full=50S ribosomal protein L22
 gi|254800420|sp|B9IZJ9|RL22_BACCQ RecName: Full=50S ribosomal protein L22
 gi|42735111|gb|AAS39051.1| ribosomal protein L22 [Bacillus cereus ATCC 10987]
 gi|206732785|gb|EDZ49960.1| 50S ribosomal protein L22 [Bacillus cereus AH1134]
 gi|217066223|gb|ACJ80473.1| ribosomal protein L22 [Bacillus cereus AH187]
 gi|218161849|gb|ACK61841.1| ribosomal protein L22 [Bacillus cereus B4264]
 gi|218545905|gb|ACK98299.1| ribosomal protein L22 [Bacillus cereus G9842]
 gi|221237933|gb|ACM10643.1| ribosomal protein L22 [Bacillus cereus Q1]
 gi|228588971|gb|EEK46986.1| 50S ribosomal protein L22 [Bacillus cereus m1293]
 gi|228606758|gb|EEK64175.1| 50S ribosomal protein L22 [Bacillus cereus 172560W]
 gi|228612506|gb|EEK69727.1| 50S ribosomal protein L22 [Bacillus cereus MM3]
 gi|228624180|gb|EEK80982.1| 50S ribosomal protein L22 [Bacillus cereus R309803]
 gi|228640542|gb|EEK96931.1| 50S ribosomal protein L22 [Bacillus cereus BDRD-ST24]
 gi|228646499|gb|EEL02706.1| 50S ribosomal protein L22 [Bacillus cereus BDRD-ST26]
 gi|228675650|gb|EEL30858.1| 50S ribosomal protein L22 [Bacillus cereus Rock1-15]
 gi|228699868|gb|EEL52505.1| 50S ribosomal protein L22 [Bacillus cereus Rock3-44]
 gi|228715239|gb|EEL67098.1| 50S ribosomal protein L22 [Bacillus cereus F65185]
 gi|228727317|gb|EEL78511.1| 50S ribosomal protein L22 [Bacillus cereus AH676]
 gi|228733351|gb|EEL84180.1| 50S ribosomal protein L22 [Bacillus cereus AH1271]
 gi|228745804|gb|EEL95808.1| 50S ribosomal protein L22 [Bacillus cereus AH1273]
 gi|228789413|gb|EEM37333.1| 50S ribosomal protein L22 [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228796473|gb|EEM43912.1| 50S ribosomal protein L22 [Bacillus thuringiensis serovar sotto
           str. T04001]
 gi|228809014|gb|EEM55499.1| 50S ribosomal protein L22 [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
 gi|228822251|gb|EEM68233.1| 50S ribosomal protein L22 [Bacillus thuringiensis serovar berliner
           ATCC 10792]
 gi|228840590|gb|EEM85852.1| 50S ribosomal protein L22 [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228853727|gb|EEM98487.1| 50S ribosomal protein L22 [Bacillus thuringiensis IBL 200]
 gi|228860768|gb|EEN05146.1| 50S ribosomal protein L22 [Bacillus thuringiensis IBL 4222]
 gi|296322000|gb|ADH04928.1| 50S ribosomal protein L22 [Bacillus thuringiensis BMB171]
 gi|324324106|gb|ADY19366.1| 50S ribosomal protein L22 [Bacillus thuringiensis serovar finitimus
           YBT-020]
 gi|326937910|gb|AEA13806.1| 50S ribosomal protein L22 [Bacillus thuringiensis serovar chinensis
           CT-43]
          Length = 113

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 71/108 (65%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A A+A  +R++P+K+ LV  +IRGK+V +A+A L  + K  +  V K L SA+ANAE+N
Sbjct: 2   QAKAVARTVRIAPRKVRLVVDLIRGKQVGEAIAILNHTPKTASPVVEKVLKSAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           +++D++ L+V + +V +   +KRF  R   R  +I +  S +TV+V E
Sbjct: 62  YEMDINNLVVEKVFVDEGPTLKRFRPRAMGRASQINKRTSHITVVVSE 109


>gi|42518434|ref|NP_964364.1| 50S ribosomal protein L22 [Lactobacillus johnsonii NCC 533]
 gi|116628968|ref|YP_814140.1| 50S ribosomal protein L22 [Lactobacillus gasseri ATCC 33323]
 gi|227888848|ref|ZP_04006653.1| 50S ribosomal protein L22 [Lactobacillus johnsonii ATCC 33200]
 gi|238853478|ref|ZP_04643856.1| ribosomal protein L22 [Lactobacillus gasseri 202-4]
 gi|268318856|ref|YP_003292512.1| ribosomal protein L22 [Lactobacillus johnsonii FI9785]
 gi|300362384|ref|ZP_07058560.1| 50S ribosomal protein L22 [Lactobacillus gasseri JV-V03]
 gi|51316300|sp|Q74L84|RL22_LACJO RecName: Full=50S ribosomal protein L22
 gi|122274034|sp|Q046C0|RL22_LACGA RecName: Full=50S ribosomal protein L22
 gi|41582719|gb|AAS08330.1| 50S ribosomal protein L22 [Lactobacillus johnsonii NCC 533]
 gi|116094550|gb|ABJ59702.1| LSU ribosomal protein L22P [Lactobacillus gasseri ATCC 33323]
 gi|227850685|gb|EEJ60771.1| 50S ribosomal protein L22 [Lactobacillus johnsonii ATCC 33200]
 gi|238833918|gb|EEQ26177.1| ribosomal protein L22 [Lactobacillus gasseri 202-4]
 gi|262397231|emb|CAX66245.1| ribosomal protein L22 [Lactobacillus johnsonii FI9785]
 gi|300353375|gb|EFJ69247.1| 50S ribosomal protein L22 [Lactobacillus gasseri JV-V03]
 gi|329666697|gb|AEB92645.1| 50S ribosomal protein L22 [Lactobacillus johnsonii DPC 6026]
          Length = 117

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 47/110 (42%), Positives = 69/110 (62%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A A  +R++P+K  LV  +IRGK V++ALA L+F+ +  +  V K L SA+ANAE+N+
Sbjct: 8   AKAEARTVRIAPRKARLVVDLIRGKSVAEALAILQFTPRAASPIVEKVLKSAIANAEHNY 67

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           DL+   L VSEAYV +   +KRF  R +     I +  S + V+V E +D
Sbjct: 68  DLESANLYVSEAYVNEGATLKRFRPRAKGMASPINKRTSHVVVVVSEKND 117


>gi|118475884|ref|YP_893035.1| 50S ribosomal protein L22 [Bacillus thuringiensis str. Al Hakam]
 gi|229153893|ref|ZP_04282023.1| 50S ribosomal protein L22 [Bacillus cereus ATCC 4342]
 gi|118415109|gb|ABK83528.1| LSU ribosomal protein L22P [Bacillus thuringiensis str. Al Hakam]
 gi|228629574|gb|EEK86271.1| 50S ribosomal protein L22 [Bacillus cereus ATCC 4342]
          Length = 119

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 71/108 (65%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A A+A  +R++P+K+ LV  +IRGK+V +A+A L  + K  +  V K L SA+ANAE+N
Sbjct: 8   QAKAVARTVRIAPRKVRLVVDLIRGKQVGEAIAILNHTPKTASPVVEKVLKSAIANAEHN 67

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           +++D++ L+V + +V +   +KRF  R   R  +I +  S +TV+V E
Sbjct: 68  YEMDINSLVVEKVFVDEGPTLKRFRPRAMGRASQINKRTSHITVVVSE 115


>gi|317126866|ref|YP_004093148.1| ribosomal protein L22 [Bacillus cellulosilyticus DSM 2522]
 gi|315471814|gb|ADU28417.1| ribosomal protein L22 [Bacillus cellulosilyticus DSM 2522]
          Length = 113

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 71/108 (65%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+   +R++P+K+ LV  +IRGK V +A++ L  + K+ +  V K L SA+ANAE+N
Sbjct: 2   EAKAVVKQVRIAPRKVRLVVDLIRGKGVGEAISILRHTPKKASPVVEKLLNSAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           ++LD + L+VS+ +V + V +KRF  R   R  RI +  S +T+++ E
Sbjct: 62  YELDPNSLVVSKVFVDEGVTLKRFRPRAMGRASRINKRTSHITLVLTE 109


>gi|132779|sp|P23311|RL22_BACST RecName: Full=50S ribosomal protein L22
 gi|40107|emb|CAA38739.1| ribosomal protein L22 [Geobacillus stearothermophilus]
          Length = 113

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 44/108 (40%), Positives = 68/108 (62%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A A+A  +R++P+K  LV  +IRGK V +  A L  + K  +  + K L SAVANAE+N
Sbjct: 2   QAKAVARTVRIAPRKARLVIDLIRGKEVGERFAILRHTPKAASPIIEKVLKSAVANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           +D+DV+ L++S+AYV +   +KRF  R   R   I +  S +T++V E
Sbjct: 62  YDMDVNNLVISQAYVDEGPTLKRFRPRAMGRASAINKRTSHITIVVSE 109


>gi|37528538|ref|NP_931883.1| 50S ribosomal protein L22 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|253991683|ref|YP_003043039.1| 50S ribosomal protein L22 [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|51316750|sp|Q7MYF6|RL22_PHOLL RecName: Full=50S ribosomal protein L22
 gi|36787976|emb|CAE17093.1| 50S ribosomal protein L22 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|253783133|emb|CAQ86298.1| 50S ribosomal protein L22 [Photorhabdus asymbiotica]
          Length = 110

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 65/99 (65%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R S QK+ LVA +IRGK+VS AL  L ++ K+ AG V+K L SA+ANAE+N   D+D L 
Sbjct: 11  RSSAQKVRLVADLIRGKKVSQALETLTYTNKKAAGLVKKVLESAIANAEHNDGADIDDLK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           V++ +V +   MKR   R + R  RI++  S +TV+V +
Sbjct: 71  VTKIFVDEGPTMKRIMPRAKGRADRILKRSSHITVVVSD 109


>gi|22127864|ref|NP_671287.1| 50S ribosomal protein L22 [Yersinia pestis KIM 10]
 gi|45440072|ref|NP_991611.1| 50S ribosomal protein L22 [Yersinia pestis biovar Microtus str.
           91001]
 gi|51597983|ref|YP_072174.1| 50S ribosomal protein L22 [Yersinia pseudotuberculosis IP 32953]
 gi|108809249|ref|YP_653165.1| 50S ribosomal protein L22 [Yersinia pestis Antiqua]
 gi|108814014|ref|YP_649781.1| 50S ribosomal protein L22 [Yersinia pestis Nepal516]
 gi|145597457|ref|YP_001161532.1| 50S ribosomal protein L22 [Yersinia pestis Pestoides F]
 gi|150260738|ref|ZP_01917466.1| 50S ribosomal protein L22 [Yersinia pestis CA88-4125]
 gi|153949774|ref|YP_001402858.1| 50S ribosomal protein L22 [Yersinia pseudotuberculosis IP 31758]
 gi|162419522|ref|YP_001605180.1| 50S ribosomal protein L22 [Yersinia pestis Angola]
 gi|166010426|ref|ZP_02231324.1| ribosomal protein L22 [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166213166|ref|ZP_02239201.1| ribosomal protein L22 [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167425720|ref|ZP_02317473.1| ribosomal protein L22 [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|170022549|ref|YP_001719054.1| 50S ribosomal protein L22 [Yersinia pseudotuberculosis YPIII]
 gi|186897179|ref|YP_001874291.1| 50S ribosomal protein L22 [Yersinia pseudotuberculosis PB1/+]
 gi|218927420|ref|YP_002345295.1| 50S ribosomal protein L22 [Yersinia pestis CO92]
 gi|229836304|ref|ZP_04456471.1| 50S ribosomal subunit protein L22 [Yersinia pestis Pestoides A]
 gi|229840072|ref|ZP_04460231.1| 50S ribosomal subunit protein L22 [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229842154|ref|ZP_04462309.1| 50S ribosomal subunit protein L22 [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229904546|ref|ZP_04519657.1| 50S ribosomal subunit protein L22 [Yersinia pestis Nepal516]
 gi|238792943|ref|ZP_04636573.1| hypothetical protein yinte0001_36010 [Yersinia intermedia ATCC
           29909]
 gi|293393306|ref|ZP_06637620.1| 50S ribosomal protein L22 [Serratia odorifera DSM 4582]
 gi|294502293|ref|YP_003566355.1| 50S ribosomal protein L22 [Yersinia pestis Z176003]
 gi|320540604|ref|ZP_08040254.1| 50S ribosomal subunit protein L22 [Serratia symbiotica str. Tucson]
 gi|51316889|sp|Q8ZJA7|RL22_YERPE RecName: Full=50S ribosomal protein L22
 gi|81691631|sp|Q664S6|RL22_YERPS RecName: Full=50S ribosomal protein L22
 gi|123073064|sp|Q1CCU9|RL22_YERPN RecName: Full=50S ribosomal protein L22
 gi|123245522|sp|Q1C2V2|RL22_YERPA RecName: Full=50S ribosomal protein L22
 gi|166222009|sp|A4TGZ7|RL22_YERPP RecName: Full=50S ribosomal protein L22
 gi|166986976|sp|A7FNN0|RL22_YERP3 RecName: Full=50S ribosomal protein L22
 gi|226734756|sp|B2K5M5|RL22_YERPB RecName: Full=50S ribosomal protein L22
 gi|226734757|sp|A9R901|RL22_YERPG RecName: Full=50S ribosomal protein L22
 gi|226734758|sp|B1JIW6|RL22_YERPY RecName: Full=50S ribosomal protein L22
 gi|21960999|gb|AAM87538.1|AE014002_11 50S ribosomal subunit protein L22 [Yersinia pestis KIM 10]
 gi|45434927|gb|AAS60488.1| 50S ribosomal protein L22 [Yersinia pestis biovar Microtus str.
           91001]
 gi|51591265|emb|CAH22931.1| 50S ribosomal protein L22 [Yersinia pseudotuberculosis IP 32953]
 gi|108777662|gb|ABG20181.1| LSU ribosomal protein L22P [Yersinia pestis Nepal516]
 gi|108781162|gb|ABG15220.1| LSU ribosomal protein L22P [Yersinia pestis Antiqua]
 gi|115346031|emb|CAL18897.1| 50S ribosomal protein L22 [Yersinia pestis CO92]
 gi|145209153|gb|ABP38560.1| LSU ribosomal protein L22P [Yersinia pestis Pestoides F]
 gi|149290146|gb|EDM40223.1| 50S ribosomal protein L22 [Yersinia pestis CA88-4125]
 gi|152961269|gb|ABS48730.1| ribosomal protein L22 [Yersinia pseudotuberculosis IP 31758]
 gi|162352337|gb|ABX86285.1| ribosomal protein L22 [Yersinia pestis Angola]
 gi|165990516|gb|EDR42817.1| ribosomal protein L22 [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166205464|gb|EDR49944.1| ribosomal protein L22 [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167055410|gb|EDR65204.1| ribosomal protein L22 [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|169749083|gb|ACA66601.1| ribosomal protein L22 [Yersinia pseudotuberculosis YPIII]
 gi|186700205|gb|ACC90834.1| ribosomal protein L22 [Yersinia pseudotuberculosis PB1/+]
 gi|229678664|gb|EEO74769.1| 50S ribosomal subunit protein L22 [Yersinia pestis Nepal516]
 gi|229690464|gb|EEO82518.1| 50S ribosomal subunit protein L22 [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229696438|gb|EEO86485.1| 50S ribosomal subunit protein L22 [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229706372|gb|EEO92379.1| 50S ribosomal subunit protein L22 [Yersinia pestis Pestoides A]
 gi|238727797|gb|EEQ19321.1| hypothetical protein yinte0001_36010 [Yersinia intermedia ATCC
           29909]
 gi|262360373|gb|ACY57094.1| 50S ribosomal protein L22 [Yersinia pestis D106004]
 gi|262364325|gb|ACY60882.1| 50S ribosomal protein L22 [Yersinia pestis D182038]
 gi|291424216|gb|EFE97431.1| 50S ribosomal protein L22 [Serratia odorifera DSM 4582]
 gi|294352752|gb|ADE63093.1| 50S ribosomal protein L22 [Yersinia pestis Z176003]
 gi|320013347|gb|ADV96918.1| 50S ribosomal subunit protein L22 [Yersinia pestis biovar
           Medievalis str. Harbin 35]
 gi|320029535|gb|EFW11564.1| 50S ribosomal subunit protein L22 [Serratia symbiotica str. Tucson]
          Length = 110

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 65/99 (65%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R S QK+ LVA +IRGK+VS AL  L ++ K+ AG V+K L SA+ANAE+N   D+D L 
Sbjct: 11  RSSAQKVRLVADLIRGKKVSQALETLTYTNKKAAGLVKKVLESAIANAEHNDGADIDDLK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           V++ +V +   MKR   R + R  RI++  S +TV+V +
Sbjct: 71  VTKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSD 109


>gi|312884698|ref|ZP_07744399.1| 50S ribosomal protein L22 [Vibrio caribbenthicus ATCC BAA-2122]
 gi|323492124|ref|ZP_08097286.1| 50S ribosomal protein L22 [Vibrio brasiliensis LMG 20546]
 gi|323495509|ref|ZP_08100583.1| 50S ribosomal protein L22 [Vibrio sinaloensis DSM 21326]
 gi|309367611|gb|EFP95162.1| 50S ribosomal protein L22 [Vibrio caribbenthicus ATCC BAA-2122]
 gi|323313685|gb|EGA66787.1| 50S ribosomal protein L22 [Vibrio brasiliensis LMG 20546]
 gi|323319390|gb|EGA72327.1| 50S ribosomal protein L22 [Vibrio sinaloensis DSM 21326]
          Length = 110

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 65/106 (61%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A  +  R+SPQK  LVA  IRGK V  AL  L FS K+ A  ++K L SA+ANAE+N
Sbjct: 2   EALAKHNFARISPQKARLVADQIRGKSVDQALEILTFSNKKAADLIKKVLESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L V++ +V +   MKR   R + R  RI++  S +TV+V
Sbjct: 62  EGADIDDLNVAKIFVDEGPIMKRIMPRAKGRADRILKRSSHITVVV 107


>gi|312200015|ref|YP_004020076.1| ribosomal protein L22 [Frankia sp. EuI1c]
 gi|311231351|gb|ADP84206.1| ribosomal protein L22 [Frankia sp. EuI1c]
          Length = 138

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 47/115 (40%), Positives = 66/115 (57%)

Query: 11  RMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVA 70
           R G   A A A  +R+SP K   V  ++RG+   +AL  L F+ +  + +V K L SA+A
Sbjct: 11  RAGLPGAKATARYVRISPTKARRVVDLVRGRNAKEALDILTFAAQSASTDVYKVLHSAIA 70

Query: 71  NAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVS 125
           NAENNH LD D L V EAYV +   +KR   R + R  RI +  S +T++V  V+
Sbjct: 71  NAENNHGLDPDTLFVGEAYVDEGPTLKRIRPRAQGRAYRIRKRTSHITIVVESVA 125


>gi|262066299|ref|ZP_06025911.1| ribosomal protein L22 [Fusobacterium periodonticum ATCC 33693]
 gi|294783637|ref|ZP_06748961.1| ribosomal protein L22 [Fusobacterium sp. 1_1_41FAA]
 gi|291379994|gb|EFE87512.1| ribosomal protein L22 [Fusobacterium periodonticum ATCC 33693]
 gi|294480515|gb|EFG28292.1| ribosomal protein L22 [Fusobacterium sp. 1_1_41FAA]
          Length = 110

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 46/108 (42%), Positives = 66/108 (61%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AI   +R+SP+K  LVA ++RGK   DA+  LEF+ K+ A  ++KTL SAVANA NN
Sbjct: 2   EAKAITRFVRLSPRKARLVADLVRGKSALDAIDILEFTNKKAARIIKKTLMSAVANATNN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
             +D ++L+VS   + +   +KR   R   R   I +P + +TV V E
Sbjct: 62  FKMDEEKLVVSTIMINQGPVLKRVMPRAMGRADIIRKPTAHITVAVSE 109


>gi|30260306|ref|NP_842683.1| 50S ribosomal protein L22 [Bacillus anthracis str. Ames]
 gi|47525371|ref|YP_016720.1| 50S ribosomal protein L22 [Bacillus anthracis str. 'Ames Ancestor']
 gi|49183149|ref|YP_026401.1| 50S ribosomal protein L22 [Bacillus anthracis str. Sterne]
 gi|49479245|ref|YP_034467.1| 50S ribosomal protein L22 [Bacillus thuringiensis serovar konkukian
           str. 97-27]
 gi|52145103|ref|YP_081726.1| 50S ribosomal protein L22 [Bacillus cereus E33L]
 gi|218901319|ref|YP_002449153.1| ribosomal protein L22 [Bacillus cereus AH820]
 gi|225862167|ref|YP_002747545.1| 50S ribosomal protein L22 [Bacillus cereus 03BB102]
 gi|227812788|ref|YP_002812797.1| 50S ribosomal protein L22 [Bacillus anthracis str. CDC 684]
 gi|228912854|ref|ZP_04076501.1| 50S ribosomal protein L22 [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|228925368|ref|ZP_04088464.1| 50S ribosomal protein L22 [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228931617|ref|ZP_04094523.1| 50S ribosomal protein L22 [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228943921|ref|ZP_04106306.1| 50S ribosomal protein L22 [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|228983370|ref|ZP_04143583.1| 50S ribosomal protein L22 [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|229089246|ref|ZP_04220527.1| 50S ribosomal protein L22 [Bacillus cereus Rock3-42]
 gi|229119777|ref|ZP_04249038.1| 50S ribosomal protein L22 [Bacillus cereus 95/8201]
 gi|229182509|ref|ZP_04309760.1| 50S ribosomal protein L22 [Bacillus cereus BGSC 6E1]
 gi|229603697|ref|YP_002864766.1| 50S ribosomal protein L22 [Bacillus anthracis str. A0248]
 gi|254684381|ref|ZP_05148241.1| 50S ribosomal protein L22 [Bacillus anthracis str. CNEVA-9066]
 gi|254720837|ref|ZP_05182629.1| 50S ribosomal protein L22 [Bacillus anthracis str. A1055]
 gi|254733584|ref|ZP_05191304.1| 50S ribosomal protein L22 [Bacillus anthracis str. Western North
           America USA6153]
 gi|254739512|ref|ZP_05197209.1| 50S ribosomal protein L22 [Bacillus anthracis str. Kruger B]
 gi|254751223|ref|ZP_05203261.1| 50S ribosomal protein L22 [Bacillus anthracis str. Vollum]
 gi|254756770|ref|ZP_05208799.1| 50S ribosomal protein L22 [Bacillus anthracis str. Australia 94]
 gi|300119572|ref|ZP_07057116.1| 50S ribosomal protein L22 [Bacillus cereus SJ1]
 gi|301051852|ref|YP_003790063.1| 50S ribosomal protein L22 [Bacillus anthracis CI]
 gi|51316397|sp|Q81VS5|RL22_BACAN RecName: Full=50S ribosomal protein L22
 gi|81689837|sp|Q63H85|RL22_BACCZ RecName: Full=50S ribosomal protein L22
 gi|81697019|sp|Q6HPQ3|RL22_BACHK RecName: Full=50S ribosomal protein L22
 gi|215274936|sp|A0R8I5|RL22_BACAH RecName: Full=50S ribosomal protein L22
 gi|226733429|sp|B7JKC4|RL22_BACC0 RecName: Full=50S ribosomal protein L22
 gi|254800417|sp|C3P9R0|RL22_BACAA RecName: Full=50S ribosomal protein L22
 gi|254800418|sp|C3LJ87|RL22_BACAC RecName: Full=50S ribosomal protein L22
 gi|254800419|sp|C1ET44|RL22_BACC3 RecName: Full=50S ribosomal protein L22
 gi|30253627|gb|AAP24169.1| 50S ribosomal protein L22 [Bacillus anthracis str. Ames]
 gi|47500519|gb|AAT29195.1| ribosomal protein L22 [Bacillus anthracis str. 'Ames Ancestor']
 gi|49177076|gb|AAT52452.1| ribosomal protein L22 [Bacillus anthracis str. Sterne]
 gi|49330801|gb|AAT61447.1| ribosomal protein L22 (50S ribosomal protein L22) [Bacillus
           thuringiensis serovar konkukian str. 97-27]
 gi|51978572|gb|AAU20122.1| ribosomal protein L22 (50S ribosomal protein L22) [Bacillus cereus
           E33L]
 gi|218539891|gb|ACK92289.1| ribosomal protein L22 [Bacillus cereus AH820]
 gi|225789885|gb|ACO30102.1| 50S ribosomal protein L22 [Bacillus cereus 03BB102]
 gi|227002396|gb|ACP12139.1| 50S ribosomal protein L22 [Bacillus anthracis str. CDC 684]
 gi|228600964|gb|EEK58533.1| 50S ribosomal protein L22 [Bacillus cereus BGSC 6E1]
 gi|228663678|gb|EEL19257.1| 50S ribosomal protein L22 [Bacillus cereus 95/8201]
 gi|228694085|gb|EEL47767.1| 50S ribosomal protein L22 [Bacillus cereus Rock3-42]
 gi|228776360|gb|EEM24713.1| 50S ribosomal protein L22 [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|228815754|gb|EEM61990.1| 50S ribosomal protein L22 [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|228828045|gb|EEM73773.1| 50S ribosomal protein L22 [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228834290|gb|EEM79831.1| 50S ribosomal protein L22 [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228846790|gb|EEM91795.1| 50S ribosomal protein L22 [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|229268105|gb|ACQ49742.1| 50S ribosomal protein L22 [Bacillus anthracis str. A0248]
 gi|298723044|gb|EFI63942.1| 50S ribosomal protein L22 [Bacillus cereus SJ1]
 gi|300374021|gb|ADK02925.1| 50S ribosomal protein L22 [Bacillus cereus biovar anthracis str.
           CI]
          Length = 113

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 71/108 (65%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A A+A  +R++P+K+ LV  +IRGK+V +A+A L  + K  +  V K L SA+ANAE+N
Sbjct: 2   QAKAVARTVRIAPRKVRLVVDLIRGKQVGEAIAILNHTPKTASPVVEKVLKSAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           +++D++ L+V + +V +   +KRF  R   R  +I +  S +TV+V E
Sbjct: 62  YEMDINSLVVEKVFVDEGPTLKRFRPRAMGRASQINKRTSHITVVVSE 109


>gi|238855073|ref|ZP_04645401.1| ribosomal protein L22 [Lactobacillus jensenii 269-3]
 gi|256852041|ref|ZP_05557428.1| ribosomal protein L22 [Lactobacillus jensenii 27-2-CHN]
 gi|260661390|ref|ZP_05862303.1| ribosomal protein L22 [Lactobacillus jensenii 115-3-CHN]
 gi|260664858|ref|ZP_05865709.1| ribosomal protein L22 [Lactobacillus jensenii SJ-7A-US]
 gi|282932132|ref|ZP_06337587.1| ribosomal protein L22 [Lactobacillus jensenii 208-1]
 gi|282932829|ref|ZP_06338228.1| ribosomal protein L22 [Lactobacillus jensenii 208-1]
 gi|297205084|ref|ZP_06922480.1| 50S ribosomal protein L22 [Lactobacillus jensenii JV-V16]
 gi|238832317|gb|EEQ24626.1| ribosomal protein L22 [Lactobacillus jensenii 269-3]
 gi|256615453|gb|EEU20643.1| ribosomal protein L22 [Lactobacillus jensenii 27-2-CHN]
 gi|260547845|gb|EEX23822.1| ribosomal protein L22 [Lactobacillus jensenii 115-3-CHN]
 gi|260561341|gb|EEX27314.1| ribosomal protein L22 [Lactobacillus jensenii SJ-7A-US]
 gi|281303045|gb|EFA95248.1| ribosomal protein L22 [Lactobacillus jensenii 208-1]
 gi|281303742|gb|EFA95889.1| ribosomal protein L22 [Lactobacillus jensenii 208-1]
 gi|297149662|gb|EFH29959.1| 50S ribosomal protein L22 [Lactobacillus jensenii JV-V16]
          Length = 117

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 47/110 (42%), Positives = 70/110 (63%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A A  +R++P+K  LV  +IRGK V++ALA L+F+ +  +  V K L SA+ANAE+N+
Sbjct: 8   ARAEARTVRIAPRKARLVIDLIRGKSVAEALAILQFTPRAASPIVEKVLRSAIANAEHNY 67

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           DL+   L VSEAYV +   +KRF  R +     I +  S + V+V E++D
Sbjct: 68  DLESANLYVSEAYVNEGATLKRFRPRAKGMASPINKRTSHVVVVVSEMND 117


>gi|254516916|ref|ZP_05128974.1| ribosomal protein L22 [gamma proteobacterium NOR5-3]
 gi|219674421|gb|EED30789.1| ribosomal protein L22 [gamma proteobacterium NOR5-3]
          Length = 112

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 60/97 (61%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R+S QK  LVA  +RGK V +AL+ LE+S K+ A  VRK L SA+ANAENN   DVD L 
Sbjct: 11  RISAQKARLVADQVRGKPVEEALSVLEYSNKKAAHIVRKVLNSAIANAENNEGADVDELK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           VS  +V + V MKR   R + R  RI +    +TV V
Sbjct: 71  VSSVFVDEGVTMKRLRPRAKGRADRIFKRSCHITVKV 107


>gi|27364210|ref|NP_759738.1| 50S ribosomal protein L22 [Vibrio vulnificus CMCP6]
 gi|37678564|ref|NP_933173.1| 50S ribosomal protein L22 [Vibrio vulnificus YJ016]
 gi|156973056|ref|YP_001443963.1| 50S ribosomal protein L22 [Vibrio harveyi ATCC BAA-1116]
 gi|320157596|ref|YP_004189975.1| 50S ribosomal protein L22p (L17e) [Vibrio vulnificus MO6-24/O]
 gi|51316743|sp|Q7MPI3|RL22_VIBVY RecName: Full=50S ribosomal protein L22
 gi|51316840|sp|Q8DE44|RL22_VIBVU RecName: Full=50S ribosomal protein L22
 gi|215274883|sp|A7MWI8|RL22_VIBHB RecName: Full=50S ribosomal protein L22
 gi|27360328|gb|AAO09265.1| ribosomal protein L22 [Vibrio vulnificus CMCP6]
 gi|37197304|dbj|BAC93144.1| ribosomal protein L22 [Vibrio vulnificus YJ016]
 gi|156524650|gb|ABU69736.1| hypothetical protein VIBHAR_00735 [Vibrio harveyi ATCC BAA-1116]
 gi|319932908|gb|ADV87772.1| LSU ribosomal protein L22p (L17e) [Vibrio vulnificus MO6-24/O]
          Length = 110

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 66/106 (62%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A  +  R+SPQK  LVA +IRGK V  AL  L FS K+ A  V+K L SA+ANAE+N
Sbjct: 2   EAIAKHNFARISPQKARLVADLIRGKSVDQALEILTFSNKKAAVLVKKVLESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L V++ +V +   MKR   R + R  RI++  S +TV+V
Sbjct: 62  EGADIDDLNVAKIFVDEGPTMKRIMPRAKGRADRILKRSSHITVVV 107


>gi|237743904|ref|ZP_04574385.1| LSU ribosomal protein L22P [Fusobacterium sp. 7_1]
 gi|256027485|ref|ZP_05441319.1| 50S ribosomal protein L22P [Fusobacterium sp. D11]
 gi|260495198|ref|ZP_05815326.1| ribosomal protein L22 [Fusobacterium sp. 3_1_33]
 gi|289765447|ref|ZP_06524825.1| LSU ribosomal protein L22P [Fusobacterium sp. D11]
 gi|229432935|gb|EEO43147.1| LSU ribosomal protein L22P [Fusobacterium sp. 7_1]
 gi|260197255|gb|EEW94774.1| ribosomal protein L22 [Fusobacterium sp. 3_1_33]
 gi|289717002|gb|EFD81014.1| LSU ribosomal protein L22P [Fusobacterium sp. D11]
          Length = 111

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 48/112 (42%), Positives = 68/112 (60%), Gaps = 3/112 (2%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AI   +R+SP+K  LVA ++RGK   DA+  LEF+ K+ A  ++KTL SAVANA NN
Sbjct: 2   EAKAITRFVRLSPRKARLVADLVRGKSALDAIDILEFTNKKAARIIKKTLMSAVANATNN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
             +D ++L+VS   + +   +KR   R   R   I +P + +TV    VSDE
Sbjct: 62  FKMDEEKLVVSTIMINQGPVLKRVMPRAMGRADIIRKPTAHITV---AVSDE 110


>gi|123444093|ref|YP_001008063.1| 50S ribosomal protein L22 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|157372771|ref|YP_001480760.1| 50S ribosomal protein L22 [Serratia proteamaculans 568]
 gi|238754180|ref|ZP_04615538.1| hypothetical protein yruck0001_27820 [Yersinia ruckeri ATCC 29473]
 gi|238758769|ref|ZP_04619943.1| hypothetical protein yaldo0001_31840 [Yersinia aldovae ATCC 35236]
 gi|238763725|ref|ZP_04624684.1| hypothetical protein ykris0001_23010 [Yersinia kristensenii ATCC
           33638]
 gi|238783174|ref|ZP_04627200.1| hypothetical protein yberc0001_2590 [Yersinia bercovieri ATCC
           43970]
 gi|238788905|ref|ZP_04632695.1| hypothetical protein yfred0001_27130 [Yersinia frederiksenii ATCC
           33641]
 gi|238797233|ref|ZP_04640734.1| hypothetical protein ymoll0001_2940 [Yersinia mollaretii ATCC
           43969]
 gi|317494337|ref|ZP_07952751.1| ribosomal protein L22 [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|322831077|ref|YP_004211104.1| ribosomal protein L22 [Rahnella sp. Y9602]
 gi|332163254|ref|YP_004299831.1| 50S ribosomal protein L22 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|166222008|sp|A1JS31|RL22_YERE8 RecName: Full=50S ribosomal protein L22
 gi|166986974|sp|A8GKJ2|RL22_SERP5 RecName: Full=50S ribosomal protein L22
 gi|122091054|emb|CAL13937.1| 50S ribosomal protein L22 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|157324535|gb|ABV43632.1| ribosomal protein L22 [Serratia proteamaculans 568]
 gi|238698027|gb|EEP90785.1| hypothetical protein ykris0001_23010 [Yersinia kristensenii ATCC
           33638]
 gi|238703066|gb|EEP95609.1| hypothetical protein yaldo0001_31840 [Yersinia aldovae ATCC 35236]
 gi|238707676|gb|EEQ00036.1| hypothetical protein yruck0001_27820 [Yersinia ruckeri ATCC 29473]
 gi|238715970|gb|EEQ07956.1| hypothetical protein yberc0001_2590 [Yersinia bercovieri ATCC
           43970]
 gi|238718870|gb|EEQ10685.1| hypothetical protein ymoll0001_2940 [Yersinia mollaretii ATCC
           43969]
 gi|238722932|gb|EEQ14582.1| hypothetical protein yfred0001_27130 [Yersinia frederiksenii ATCC
           33641]
 gi|316917587|gb|EFV38932.1| ribosomal protein L22 [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|318607739|emb|CBY29237.1| LSU ribosomal protein L22p (L17e) [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|321166278|gb|ADW71977.1| ribosomal protein L22 [Rahnella sp. Y9602]
 gi|325667484|gb|ADZ44128.1| 50S ribosomal protein L22 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330861850|emb|CBX72021.1| 50S ribosomal protein L22 [Yersinia enterocolitica W22703]
          Length = 110

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 65/99 (65%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R S QK+ LVA +IRGK+VS AL  L ++ K+ AG V+K L SA+ANAE+N   D+D L 
Sbjct: 11  RSSAQKVRLVADLIRGKKVSQALETLAYTNKKAAGLVKKVLESAIANAEHNDGADIDDLK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           V++ +V +   MKR   R + R  RI++  S +TV+V +
Sbjct: 71  VTKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSD 109


>gi|311744804|ref|ZP_07718600.1| 50S ribosomal protein L22 [Aeromicrobium marinum DSM 15272]
 gi|311311921|gb|EFQ81842.1| 50S ribosomal protein L22 [Aeromicrobium marinum DSM 15272]
          Length = 138

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 49/130 (37%), Positives = 77/130 (59%), Gaps = 4/130 (3%)

Query: 2   SGKRSVSKRR---MGDNEAN-AIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRI 57
           + + SV+ RR   +GD   + A+A  +RV+PQK   +A +IRG+ V  ALA L+F+ + +
Sbjct: 4   TTRTSVTARRERLLGDEPGSFAVARFVRVTPQKARRIADLIRGESVETALATLKFAPQAV 63

Query: 58  AGEVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRL 117
           A    K + SA ANAE   DLD   L++S+  V +   MKR+  R +    RI++  S L
Sbjct: 64  AENFYKLVDSAAANAETTEDLDRSSLVISQVMVDEGPTMKRWRPRAKGAANRILKRTSHL 123

Query: 118 TVIVREVSDE 127
           TV+V  V+++
Sbjct: 124 TVVVTPVTEK 133


>gi|153952866|ref|YP_001393631.1| 50S ribosomal protein L22 [Clostridium kluyveri DSM 555]
 gi|219853531|ref|YP_002470653.1| hypothetical protein CKR_0188 [Clostridium kluyveri NBRC 12016]
 gi|189041945|sp|A5N4Q2|RL22_CLOK5 RecName: Full=50S ribosomal protein L22
 gi|254800430|sp|B9DYB4|RL22_CLOK1 RecName: Full=50S ribosomal protein L22
 gi|146345747|gb|EDK32283.1| RplV [Clostridium kluyveri DSM 555]
 gi|219567255|dbj|BAH05239.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 111

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 69/108 (63%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AIA  +R+S  K+ +V  ++RGK V++A A L+++ +  A  V K L SAVANAENN
Sbjct: 2   EAKAIAKYVRMSSMKVRVVLNLVRGKNVNEAFAILKYTPRDAAVVVNKLLKSAVANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            DL+ D L +SEAY  +   +KRF    + R  RI +  S +T+IV+E
Sbjct: 62  LDLNRDTLYISEAYACEGPTLKRFQPHAQGRAFRINKRSSHITLIVKE 109


>gi|261250412|ref|ZP_05942987.1| LSU ribosomal protein L22p (L17e) [Vibrio orientalis CIP 102891]
 gi|260938981|gb|EEX94968.1| LSU ribosomal protein L22p (L17e) [Vibrio orientalis CIP 102891]
          Length = 110

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 65/106 (61%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A  +  R+SPQK  LVA  IRGK V  AL  L FS K+ A  ++K L SA+ANAE+N
Sbjct: 2   EALAKHNFARISPQKARLVADQIRGKSVDQALEILTFSNKKAAELIKKVLESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L V++ +V +   MKR   R + R  RI++  S +TV+V
Sbjct: 62  EGADIDDLNVAKIFVDEGPIMKRIMPRAKGRADRILKRSSHITVVV 107


>gi|289168727|ref|YP_003446996.1| 50S ribosomal protein L22 [Streptococcus mitis B6]
 gi|296875399|ref|ZP_06899473.1| 50S ribosomal protein L22 [Streptococcus parasanguinis ATCC 15912]
 gi|312867059|ref|ZP_07727270.1| ribosomal protein L22 [Streptococcus parasanguinis F0405]
 gi|322390665|ref|ZP_08064179.1| 50S ribosomal protein L22 [Streptococcus parasanguinis ATCC 903]
 gi|288908294|emb|CBJ23136.1| 50S ribosomal protein L22 [Streptococcus mitis B6]
 gi|296433592|gb|EFH19365.1| 50S ribosomal protein L22 [Streptococcus parasanguinis ATCC 15912]
 gi|311097541|gb|EFQ55774.1| ribosomal protein L22 [Streptococcus parasanguinis F0405]
 gi|321142638|gb|EFX38102.1| 50S ribosomal protein L22 [Streptococcus parasanguinis ATCC 903]
          Length = 114

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 49/107 (45%), Positives = 65/107 (60%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A+A  +RVSP+K  LV   IRGK V+DA+A L F+  + AG + K L SAVANAENN 
Sbjct: 7   AKAMARTVRVSPRKSRLVLDNIRGKSVADAIAILTFTPNKAAGIILKVLNSAVANAENNF 66

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            L+   L+VSEA+  +   MKRF  R +     I +  + +TV V E
Sbjct: 67  GLEKANLVVSEAFANEGPTMKRFRPRAKGSASPINKRTAHITVAVAE 113


>gi|282852654|ref|ZP_06261996.1| ribosomal protein L22 [Lactobacillus gasseri 224-1]
 gi|282556396|gb|EFB62016.1| ribosomal protein L22 [Lactobacillus gasseri 224-1]
          Length = 117

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 46/110 (41%), Positives = 69/110 (62%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A A  +R++P+K  LV  +IRGK V++ALA L+F+ +  +  V K L SA+ANAE+N+
Sbjct: 8   AKAEARTVRIAPRKARLVVDLIRGKSVAEALAILQFTPRAASPIVEKVLKSAIANAEHNY 67

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           DL+   L +SEAYV +   +KRF  R +     I +  S + V+V E +D
Sbjct: 68  DLESANLYISEAYVNEGATLKRFRPRAKGMASPINKRTSHVVVVVSEKND 117


>gi|228989324|ref|ZP_04149315.1| 50S ribosomal protein L22 [Bacillus pseudomycoides DSM 12442]
 gi|228995506|ref|ZP_04155174.1| 50S ribosomal protein L22 [Bacillus mycoides Rock3-17]
 gi|229003131|ref|ZP_04160977.1| 50S ribosomal protein L22 [Bacillus mycoides Rock1-4]
 gi|228758094|gb|EEM07293.1| 50S ribosomal protein L22 [Bacillus mycoides Rock1-4]
 gi|228764235|gb|EEM13114.1| 50S ribosomal protein L22 [Bacillus mycoides Rock3-17]
 gi|228770402|gb|EEM18975.1| 50S ribosomal protein L22 [Bacillus pseudomycoides DSM 12442]
          Length = 113

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 70/108 (64%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A A+A  +R++P+K+ LV  +IRGK+V +A+A L  + K  +  V K L SA+ANAE+N
Sbjct: 2   QAKAVARTVRIAPRKVRLVVDLIRGKQVGEAIAILNHTPKTASPVVEKVLKSAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           +++D++ L+V   +V +   +KRF  R   R  +I +  S +TV+V E
Sbjct: 62  YEMDINNLVVETVFVDEGPTLKRFRPRAMGRASQINKRTSHITVVVSE 109


>gi|319654873|ref|ZP_08008948.1| 50S ribosomal protein L22 [Bacillus sp. 2_A_57_CT2]
 gi|317393436|gb|EFV74199.1| 50S ribosomal protein L22 [Bacillus sp. 2_A_57_CT2]
          Length = 113

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 72/108 (66%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A A+A  +R++P+K  LV  +IRGK+V +A+A L  + K  +  V K L SA+ANAE+N
Sbjct: 2   QAKAVARTVRIAPRKARLVVDLIRGKQVGEAVAILNLTPKAASPIVEKVLKSALANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           +++DV+ L+V++A+V +   +KRF  R   R  +I +  S +T+++ E
Sbjct: 62  YEMDVNNLVVAQAFVDEGPTLKRFRPRAMGRASQINKRTSHITIVLSE 109


>gi|284006158|emb|CBA71400.1| 50S ribosomal protein L22 [Arsenophonus nasoniae]
          Length = 110

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 47/108 (43%), Positives = 68/108 (62%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A+    R S QK+ LVA +IRGK+VS AL  L ++ K+ AG V+K L SA+ANAE+N
Sbjct: 2   ETIAMHRHARSSAQKVRLVADLIRGKKVSQALEILNYTNKKAAGLVKKVLESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
              D+D L V++ +V +   MKR   R + R  RI++  S +TV+V +
Sbjct: 62  DGADIDDLKVTKIFVNEGPTMKRIMPRAKGRADRILKRTSHITVVVSD 109


>gi|260772101|ref|ZP_05881018.1| LSU ribosomal protein L22p (L17e) [Vibrio metschnikovii CIP 69.14]
 gi|260612968|gb|EEX38170.1| LSU ribosomal protein L22p (L17e) [Vibrio metschnikovii CIP 69.14]
          Length = 110

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 65/106 (61%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A  +  R+SPQK  LVA  IRGK V  AL  L FS K+ A  ++K L SA+ANAE+N
Sbjct: 2   EAFAKHNFARISPQKARLVADQIRGKSVDQALETLTFSNKKAAELIKKVLESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L V++ +V +   MKR   R + R  RI++  S +T++V
Sbjct: 62  EGADIDDLRVAKIFVDEGPTMKRIMPRAKGRADRILKRSSHITIVV 107


>gi|254506503|ref|ZP_05118645.1| ribosomal protein L22 [Vibrio parahaemolyticus 16]
 gi|219550677|gb|EED27660.1| ribosomal protein L22 [Vibrio parahaemolyticus 16]
          Length = 111

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 65/106 (61%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A  +  R+SPQK  LVA  IRGK V  AL  L FS K+ A  ++K L SA+ANAE+N
Sbjct: 3   EALAKHNFARISPQKARLVADQIRGKSVDQALEILTFSNKKAAELIKKVLESAIANAEHN 62

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L V++ +V +   MKR   R + R  RI++  S +TV+V
Sbjct: 63  EGADIDDLNVAKIFVDEGPIMKRIMPRAKGRADRILKRSSHITVVV 108


>gi|226329486|ref|ZP_03805004.1| hypothetical protein PROPEN_03395 [Proteus penneri ATCC 35198]
 gi|225202672|gb|EEG85026.1| hypothetical protein PROPEN_03395 [Proteus penneri ATCC 35198]
          Length = 110

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 68/108 (62%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A+    R S QK+ LVA +IRGK+VS AL  L F+ K+ AG V+K L SA+ANAE+N
Sbjct: 2   ETIAMHRHARSSAQKVRLVADLIRGKKVSQALEILTFTNKKAAGLVKKVLESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
              D+D L V++ +V +   MKR   R + R  RI++  S +TV+V +
Sbjct: 62  DGADIDDLKVAKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSD 109


>gi|325288583|ref|YP_004264764.1| LSU ribosomal protein L22P [Syntrophobotulus glycolicus DSM 8271]
 gi|324963984|gb|ADY54763.1| LSU ribosomal protein L22P [Syntrophobotulus glycolicus DSM 8271]
          Length = 113

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 66/106 (62%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AIA  +R+SP+K+ LV  +IRGK+V +ALA L F+ K     V K L SAVANAE+N
Sbjct: 2   EAKAIAKHVRISPRKVRLVVDLIRGKKVEEALAILRFTPKGSTEPVSKVLRSAVANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
            +L  D L V++ +V +   MKR   R   R  RI +  S +TV+V
Sbjct: 62  LELSADDLYVTKIFVDQGPTMKRIMPRAMGRADRIRKRSSHITVVV 107


>gi|270264368|ref|ZP_06192634.1| 50S ribosomal protein L22 [Serratia odorifera 4Rx13]
 gi|270041504|gb|EFA14602.1| 50S ribosomal protein L22 [Serratia odorifera 4Rx13]
          Length = 110

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 65/99 (65%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R S QK+ LVA +IRGK+VS AL  L ++ K+ AG V+K L SA+ANAE+N   D+D L 
Sbjct: 11  RSSAQKVRLVADLIRGKKVSQALETLTYTDKKAAGLVKKVLESAIANAEHNDGADIDDLK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           V++ +V +   MKR   R + R  RI++  S +TV+V +
Sbjct: 71  VTKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSD 109


>gi|298531080|ref|ZP_07018481.1| ribosomal protein L22 [Desulfonatronospira thiodismutans ASO3-1]
 gi|298509103|gb|EFI33008.1| ribosomal protein L22 [Desulfonatronospira thiodismutans ASO3-1]
          Length = 110

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 65/109 (59%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  AIA  +R+SPQK  LV   +RG  V DA+  L F+ K+ A  ++K L SA+ANAE N
Sbjct: 2   ETRAIARYIRISPQKARLVGDNVRGLPVEDAVNILNFTPKKAARLLKKVLDSALANAEQN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV 124
           + LD+D L V +  V +   +KR   R   R  RI++  S +TVIV E+
Sbjct: 62  YSLDLDNLYVKQVRVDEGPTLKRIQPRAMGRANRILKRTSHITVIVEEL 110


>gi|302390963|ref|YP_003826783.1| 50S ribosomal protein L22P [Acetohalobium arabaticum DSM 5501]
 gi|302203040|gb|ADL11718.1| LSU ribosomal protein L22P [Acetohalobium arabaticum DSM 5501]
          Length = 113

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 46/108 (42%), Positives = 63/108 (58%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A  +R+SP+K  LV  ++R K +  A   L  + K+ A  + K L SAVANAENN
Sbjct: 2   EAKATAKEVRISPRKARLVIDLVRDKEIGKAFGILRNTPKKAAEIIEKVLNSAVANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           HD+  D L +SEAYV +   MKRF  R   +   I +  S +T+ V+E
Sbjct: 62  HDMIPDELYISEAYVNEGPTMKRFKPRAMGQATPINKRTSHITIKVKE 109


>gi|255526583|ref|ZP_05393490.1| ribosomal protein L22 [Clostridium carboxidivorans P7]
 gi|296187271|ref|ZP_06855667.1| ribosomal protein L22 [Clostridium carboxidivorans P7]
 gi|255509691|gb|EET86024.1| ribosomal protein L22 [Clostridium carboxidivorans P7]
 gi|296048142|gb|EFG87580.1| ribosomal protein L22 [Clostridium carboxidivorans P7]
          Length = 111

 Score = 81.6 bits (200), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 47/108 (43%), Positives = 68/108 (62%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AI   +R+S  K+ +V  +IRGK V++A A L+++ K  A  V K L SAVANAENN
Sbjct: 2   EAKAIVKYVRMSSMKIGVVLDLIRGKNVNEAFAILKYTPKDAAEVVNKVLKSAVANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
             LD++ L V+EAY  +   +KRF    + R  RI +  S +T++V+E
Sbjct: 62  LSLDINDLYVAEAYACQGPTLKRFRPHAQGRAFRIKKRTSHVTLVVKE 109


>gi|15642586|ref|NP_232219.1| 50S ribosomal protein L22 [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121591694|ref|ZP_01678923.1| ribosomal protein L22 [Vibrio cholerae 2740-80]
 gi|147675261|ref|YP_001218085.1| 50S ribosomal protein L22 [Vibrio cholerae O395]
 gi|153217584|ref|ZP_01951265.1| ribosomal protein L22 [Vibrio cholerae 1587]
 gi|153824147|ref|ZP_01976814.1| ribosomal protein L22 [Vibrio cholerae B33]
 gi|153827407|ref|ZP_01980074.1| ribosomal protein L22 [Vibrio cholerae MZO-2]
 gi|153831340|ref|ZP_01984007.1| ribosomal protein L22 [Vibrio cholerae 623-39]
 gi|227082708|ref|YP_002811259.1| ribosomal protein L22 [Vibrio cholerae M66-2]
 gi|229507357|ref|ZP_04396862.1| LSU ribosomal protein L22p (L17e) [Vibrio cholerae BX 330286]
 gi|229509720|ref|ZP_04399201.1| LSU ribosomal protein L22p (L17e) [Vibrio cholerae B33]
 gi|229513514|ref|ZP_04402978.1| LSU ribosomal protein L22p (L17e) [Vibrio cholerae TMA 21]
 gi|229516844|ref|ZP_04406290.1| LSU ribosomal protein L22p (L17e) [Vibrio cholerae RC9]
 gi|229521657|ref|ZP_04411075.1| LSU ribosomal protein L22p (L17e) [Vibrio cholerae TM 11079-80]
 gi|229524572|ref|ZP_04413977.1| LSU ribosomal protein L22p (L17e) [Vibrio cholerae bv. albensis
           VL426]
 gi|229527479|ref|ZP_04416871.1| LSU ribosomal protein L22p (L17e) [Vibrio cholerae 12129(1)]
 gi|229606863|ref|YP_002877511.1| 50S ribosomal protein L22 [Vibrio cholerae MJ-1236]
 gi|254292183|ref|ZP_04962953.1| ribosomal protein L22 [Vibrio cholerae AM-19226]
 gi|254851131|ref|ZP_05240481.1| ribosomal protein L22 [Vibrio cholerae MO10]
 gi|255744440|ref|ZP_05418392.1| LSU ribosomal protein L22p (L17e) [Vibrio cholera CIRS 101]
 gi|258625745|ref|ZP_05720624.1| 50S ribosomal protein L22 [Vibrio mimicus VM603]
 gi|262166612|ref|ZP_06034349.1| LSU ribosomal protein L22p (L17e) [Vibrio mimicus VM223]
 gi|262170472|ref|ZP_06038150.1| LSU ribosomal protein L22p (L17e) [Vibrio mimicus MB-451]
 gi|262401878|ref|ZP_06078443.1| LSU ribosomal protein L22p (L17e) [Vibrio sp. RC586]
 gi|297581433|ref|ZP_06943356.1| ribosomal protein L22 [Vibrio cholerae RC385]
 gi|51316926|sp|Q9KNY9|RL22_VIBCH RecName: Full=50S ribosomal protein L22
 gi|215274882|sp|A5F544|RL22_VIBC3 RecName: Full=50S ribosomal protein L22
 gi|254800469|sp|C3LRQ3|RL22_VIBCM RecName: Full=50S ribosomal protein L22
 gi|9657178|gb|AAF95732.1| ribosomal protein L22 [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121546445|gb|EAX56675.1| ribosomal protein L22 [Vibrio cholerae 2740-80]
 gi|124113472|gb|EAY32292.1| ribosomal protein L22 [Vibrio cholerae 1587]
 gi|126518333|gb|EAZ75556.1| ribosomal protein L22 [Vibrio cholerae B33]
 gi|146317144|gb|ABQ21683.1| ribosomal protein L22 [Vibrio cholerae O395]
 gi|148873174|gb|EDL71309.1| ribosomal protein L22 [Vibrio cholerae 623-39]
 gi|149738680|gb|EDM53022.1| ribosomal protein L22 [Vibrio cholerae MZO-2]
 gi|150421912|gb|EDN13889.1| ribosomal protein L22 [Vibrio cholerae AM-19226]
 gi|227010596|gb|ACP06808.1| ribosomal protein L22 [Vibrio cholerae M66-2]
 gi|227014480|gb|ACP10690.1| ribosomal protein L22 [Vibrio cholerae O395]
 gi|229335111|gb|EEO00596.1| LSU ribosomal protein L22p (L17e) [Vibrio cholerae 12129(1)]
 gi|229338153|gb|EEO03170.1| LSU ribosomal protein L22p (L17e) [Vibrio cholerae bv. albensis
           VL426]
 gi|229341251|gb|EEO06255.1| LSU ribosomal protein L22p (L17e) [Vibrio cholerae TM 11079-80]
 gi|229345907|gb|EEO10879.1| LSU ribosomal protein L22p (L17e) [Vibrio cholerae RC9]
 gi|229349391|gb|EEO14347.1| LSU ribosomal protein L22p (L17e) [Vibrio cholerae TMA 21]
 gi|229353194|gb|EEO18133.1| LSU ribosomal protein L22p (L17e) [Vibrio cholerae B33]
 gi|229354862|gb|EEO19783.1| LSU ribosomal protein L22p (L17e) [Vibrio cholerae BX 330286]
 gi|229369518|gb|ACQ59941.1| LSU ribosomal protein L22p (L17e) [Vibrio cholerae MJ-1236]
 gi|254846836|gb|EET25250.1| ribosomal protein L22 [Vibrio cholerae MO10]
 gi|255737965|gb|EET93358.1| LSU ribosomal protein L22p (L17e) [Vibrio cholera CIRS 101]
 gi|258581983|gb|EEW06853.1| 50S ribosomal protein L22 [Vibrio mimicus VM603]
 gi|261891548|gb|EEY37534.1| LSU ribosomal protein L22p (L17e) [Vibrio mimicus MB-451]
 gi|262026328|gb|EEY44996.1| LSU ribosomal protein L22p (L17e) [Vibrio mimicus VM223]
 gi|262351850|gb|EEZ00981.1| LSU ribosomal protein L22p (L17e) [Vibrio sp. RC586]
 gi|297534271|gb|EFH73109.1| ribosomal protein L22 [Vibrio cholerae RC385]
 gi|327485073|gb|AEA79480.1| LSU ribosomal protein L22p (L17e) [Vibrio cholerae LMA3894-4]
          Length = 110

 Score = 81.6 bits (200), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 65/106 (61%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A  +  R+SPQK  LVA  IRGK V  AL  L FS K+ A  V+K L SA+ANAE+N
Sbjct: 2   EAIAKHNFARISPQKARLVADQIRGKSVDQALELLTFSNKKAAELVKKVLESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L V++ +V +   MKR   R + R  RI++  S +TV+V
Sbjct: 62  EGADIDDLRVAKIFVDEGPVMKRIMPRAKGRADRILKRSSHITVVV 107


>gi|319945830|ref|ZP_08020080.1| 50S ribosomal protein L22 [Streptococcus australis ATCC 700641]
 gi|319747895|gb|EFW00139.1| 50S ribosomal protein L22 [Streptococcus australis ATCC 700641]
          Length = 114

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 49/107 (45%), Positives = 66/107 (61%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A+A  +RVSP+K  LV   IRGK V+DA+A L+F+  + A  + K L SAVANAENN 
Sbjct: 7   AKAMARTVRVSPRKSRLVLDNIRGKSVADAVAILKFTPNKAAEIILKVLNSAVANAENNF 66

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            L+   L+VSEA+  +   MKRF  R +     I +  S +TV+V E
Sbjct: 67  GLEKANLVVSEAFANEGPTMKRFRPRAKGSASPINKRTSHITVVVTE 113


>gi|42520525|ref|NP_966440.1| 50S ribosomal protein L22 [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|58699231|ref|ZP_00374033.1| ribosomal protein L22 [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|225630296|ref|YP_002727087.1| ribosomal protein L22 [Wolbachia sp. wRi]
 gi|51316702|sp|Q73H91|RL22_WOLPM RecName: Full=50S ribosomal protein L22
 gi|254800470|sp|C0R304|RL22_WOLWR RecName: Full=50S ribosomal protein L22
 gi|42410264|gb|AAS14374.1| ribosomal protein L22 [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|58534247|gb|EAL58444.1| ribosomal protein L22 [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|225592277|gb|ACN95296.1| ribosomal protein L22 [Wolbachia sp. wRi]
          Length = 115

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 67/102 (65%), Gaps = 1/102 (0%)

Query: 23  MLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDR 82
           +L+ +P+KLNLVA ++R K+VS A   L F  K+ AG +RK L SA+ANA+ N+ LD+D 
Sbjct: 14  VLKSTPRKLNLVAGLVRNKKVSFATVQLRFCEKKAAGLIRKVLNSAIANAQ-NYGLDIDN 72

Query: 83  LIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV 124
           L + E  +GKS+ ++R   +   R  R+ + +S +TV + E+
Sbjct: 73  LYIKEILIGKSLTLRRVCPKAMGRANRVSKRYSNITVKLGEI 114


>gi|261211146|ref|ZP_05925435.1| LSU ribosomal protein L22p (L17e) [Vibrio sp. RC341]
 gi|260839647|gb|EEX66258.1| LSU ribosomal protein L22p (L17e) [Vibrio sp. RC341]
          Length = 111

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 65/106 (61%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A  +  R+SPQK  LVA  IRGK V  AL  L FS K+ A  V+K L SA+ANAE+N
Sbjct: 3   EAIAKHNFARISPQKARLVADQIRGKSVDQALELLTFSNKKAAELVKKVLESAIANAEHN 62

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L V++ +V +   MKR   R + R  RI++  S +TV+V
Sbjct: 63  EGADIDDLRVAKIFVDEGPVMKRIMPRAKGRADRILKRSSHITVVV 108


>gi|237739371|ref|ZP_04569852.1| LSU ribosomal protein L22P [Fusobacterium sp. 2_1_31]
 gi|229422979|gb|EEO38026.1| LSU ribosomal protein L22P [Fusobacterium sp. 2_1_31]
          Length = 110

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 46/108 (42%), Positives = 66/108 (61%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AI   +R+SP+K  LVA ++RGK   +AL  LEF+ K+ A  ++KTL SAVANA NN
Sbjct: 2   EAKAITRFVRLSPRKARLVADLVRGKSALEALDILEFTNKKAARIIKKTLMSAVANATNN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
             +D ++L+VS   + +   +KR   R   R   I +P + +TV V E
Sbjct: 62  FKMDEEKLVVSTIMINQGPVLKRVMPRAMGRADIIRKPTAHITVAVSE 109


>gi|290477187|ref|YP_003470102.1| 50S ribosomal subunit protein L22 [Xenorhabdus bovienii SS-2004]
 gi|289176535|emb|CBJ83344.1| 50S ribosomal subunit protein L22 [Xenorhabdus bovienii SS-2004]
          Length = 110

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 65/99 (65%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R S QK+ LVA +IRGK+VS AL  L ++ K+ AG V+K L SA+ANAE+N   D+D L 
Sbjct: 11  RSSAQKVRLVADLIRGKKVSQALETLLYTNKKAAGLVKKVLESAIANAEHNDGADIDDLK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           V++ +V +   MKR   R + R  RI++  S +TV+V +
Sbjct: 71  VTKIFVDEGPTMKRIMPRAKGRADRILKRTSHITVVVSD 109


>gi|325184141|emb|CCA18599.1| conserved hypothetical protein [Albugo laibachii Nc14]
 gi|325186054|emb|CCA20556.1| conserved hypothetical protein [Albugo laibachii Nc14]
          Length = 195

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 43/106 (40%), Positives = 67/106 (63%)

Query: 24  LRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRL 83
           +RVSP+KL  +A  +RG  V +AL  ++FSRKR AG V+ T+ +AV  A+  ++++ + L
Sbjct: 70  IRVSPRKLTYLAQQVRGLPVEEALLQMKFSRKRRAGIVQTTVQNAVNLADIRYNIEPENL 129

Query: 84  IVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEGK 129
            V+EA+V K  ++KR    GR R G +  PFS L +++ E   E K
Sbjct: 130 KVAEAFVTKGKYLKRLRIMGRGRSGIMHHPFSHLVIVLEEFEPEPK 175


>gi|289209324|ref|YP_003461390.1| ribosomal protein L22 [Thioalkalivibrio sp. K90mix]
 gi|288944955|gb|ADC72654.1| ribosomal protein L22 [Thioalkalivibrio sp. K90mix]
          Length = 112

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 61/99 (61%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R+SPQK  LVA  +RG RV +AL +L FS K+ A  V+K L SA+ANAENN   D+D L 
Sbjct: 11  RISPQKARLVADQVRGLRVEEALNELTFSAKKPAAIVKKVLESAIANAENNDGADIDELR 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           +S   V +   +KR H R + R  RI++  S + + V E
Sbjct: 71  ISRIQVDEGPVLKRMHARAKGRGNRILKRTSHIVIGVSE 109


>gi|256830533|ref|YP_003159261.1| ribosomal protein L22 [Desulfomicrobium baculatum DSM 4028]
 gi|256579709|gb|ACU90845.1| ribosomal protein L22 [Desulfomicrobium baculatum DSM 4028]
          Length = 110

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 64/109 (58%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  ++A  +RVSPQK  LVA  + GK V DAL  L+F+ K+ A  + K L +A+ANAE+N
Sbjct: 2   ETRSVAKFIRVSPQKARLVARNVTGKHVEDALNVLKFTPKKAARLIEKVLTTAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV 124
             L+VD L V E  +      KR   R   R  RI++  S +TV+V E+
Sbjct: 62  SKLNVDNLYVKEVRIDGGPSWKRIQSRAMGRAYRIIKRSSHITVVVDEL 110


>gi|65317567|ref|ZP_00390526.1| COG0091: Ribosomal protein L22 [Bacillus anthracis str. A2012]
          Length = 113

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 70/107 (65%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A+A  +R++P+K+ LV  +IRGK+V +A+A L  + K  +  V K L SA+ANAE+N+
Sbjct: 3   AKAVARTVRIAPRKVRLVVDLIRGKQVGEAIAILNHTPKTASPVVEKVLKSAIANAEHNY 62

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           ++D++ L+V + +V +   +KRF  R   R  +I +  S +TV+V E
Sbjct: 63  EMDINSLVVEKVFVDEGPTLKRFRPRAMGRASQINKRTSHITVVVSE 109


>gi|171060664|ref|YP_001793013.1| 50S ribosomal protein L22 [Leptothrix cholodnii SP-6]
 gi|226733481|sp|B1Y8I2|RL22_LEPCP RecName: Full=50S ribosomal protein L22
 gi|170778109|gb|ACB36248.1| ribosomal protein L22 [Leptothrix cholodnii SP-6]
          Length = 109

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 65/106 (61%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  AI   +R+S  K  LVA +IRGK+V  AL  L F++K+ AG ++K L SA+ANAE+N
Sbjct: 2   ETQAIVRGVRLSCDKGRLVADLIRGKKVGLALDILTFTQKKAAGIIKKALESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L V+  YV +   +KRF  R + R  RI +P + + V V
Sbjct: 62  DGADIDELRVTSIYVEQGATLKRFSARAKGRGNRISKPTAHIYVTV 107


>gi|188584841|ref|YP_001916386.1| LSU ribosomal protein L22P [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|226733489|sp|B2A4E4|RL22_NATTJ RecName: Full=50S ribosomal protein L22
 gi|179349528|gb|ACB83798.1| LSU ribosomal protein L22P [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 113

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 45/108 (41%), Positives = 63/108 (58%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A  +R+SP+K   V  MIRGK + +AL  L+ + K     + K + SA ANAENN
Sbjct: 2   EAKATARYVRISPRKAREVIDMIRGKNIEEALGILQLTPKGATKPIEKVVKSAQANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            +++ D L +SE YV +   +KRF  R   R   I +  S LTV+V+E
Sbjct: 62  FEMNPDSLYISECYVDEGPTLKRFRPRAMGRATPINKKTSHLTVVVKE 109


>gi|74316428|ref|YP_314168.1| 50S ribosomal protein L22P [Thiobacillus denitrificans ATCC 25259]
 gi|109893252|sp|Q3SLP4|RL22_THIDA RecName: Full=50S ribosomal protein L22
 gi|74055923|gb|AAZ96363.1| ribosomal protein L22 [Thiobacillus denitrificans ATCC 25259]
          Length = 109

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 62/106 (58%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E +AI    R+S QK  LVA  IRG RV  AL  L FS K+ AG ++K L SA+ANAE+N
Sbjct: 2   EVSAILRGTRLSAQKGRLVADQIRGLRVEKALNILAFSPKKGAGIIKKVLESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L V   YV +   +KRF  R + R  RI +P   +TV V
Sbjct: 62  EGADIDALKVKTIYVDQGSVLKRFTARAKGRGNRISKPTCHITVTV 107


>gi|84394585|ref|ZP_00993289.1| 50S ribosomal protein L22 [Vibrio splendidus 12B01]
 gi|148982467|ref|ZP_01816769.1| 50S ribosomal protein L22 [Vibrionales bacterium SWAT-3]
 gi|84374805|gb|EAP91748.1| 50S ribosomal protein L22 [Vibrio splendidus 12B01]
 gi|145960458|gb|EDK25835.1| 50S ribosomal protein L22 [Vibrionales bacterium SWAT-3]
          Length = 110

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 65/106 (61%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A  +  R+SPQK  LVA  IRGK V  AL  L FS K+ A  V+K L SA+ANAE+N
Sbjct: 2   EALAKHNFARISPQKARLVADQIRGKSVDQALEILTFSNKKAAVLVKKVLESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L V++ +V +   MKR   R + R  RI++  S +T++V
Sbjct: 62  EGADIDDLNVAKIFVDEGPIMKRIMPRAKGRADRILKRSSHITIVV 107


>gi|218710744|ref|YP_002418365.1| 50S ribosomal protein L22 [Vibrio splendidus LGP32]
 gi|218323763|emb|CAV20120.1| Ribosomal protein L22 [Vibrio splendidus LGP32]
          Length = 111

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 65/106 (61%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A  +  R+SPQK  LVA  IRGK V  AL  L FS K+ A  V+K L SA+ANAE+N
Sbjct: 3   EALAKHNFARISPQKARLVADQIRGKSVDQALEILTFSNKKAAVLVKKVLESAIANAEHN 62

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L V++ +V +   MKR   R + R  RI++  S +T++V
Sbjct: 63  EGADIDDLNVAKIFVDEGPIMKRIMPRAKGRADRILKRSSHITIVV 108


>gi|258543826|ref|ZP_05704060.1| 50S ribosomal protein L22 [Cardiobacterium hominis ATCC 15826]
 gi|258520915|gb|EEV89774.1| 50S ribosomal protein L22 [Cardiobacterium hominis ATCC 15826]
          Length = 110

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 65/100 (65%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R+S QK  LVA  IRGK V++A+  L FS+K+ +  + K L SA+ANAENN   D+D L 
Sbjct: 11  RISAQKARLVADQIRGKHVNEAIEILTFSQKKASTIILKLLNSAIANAENNEGADIDVLR 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV 124
           V+E  VG+ + MKRF  R + R  RI++  S + + V+EV
Sbjct: 71  VAEIQVGEGMTMKRFAARAKGRGNRILKRTSNIFIRVQEV 110


>gi|331702075|ref|YP_004399034.1| 50S ribosomal protein L22 [Lactobacillus buchneri NRRL B-30929]
 gi|329129418|gb|AEB73971.1| ribosomal protein L22 [Lactobacillus buchneri NRRL B-30929]
          Length = 118

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 47/112 (41%), Positives = 70/112 (62%), Gaps = 1/112 (0%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A A  +R++ +K+ LV  +I+GK V++A A L+F+ +  +  V K L SAVANAENN 
Sbjct: 8   AKATAKTVRIAARKVRLVVDLIKGKSVAEAAAILDFTPRGASPVVSKVLKSAVANAENNF 67

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           DLD + L VSEA+V +   +KRF  R +     I +  S +T++V E  +EG
Sbjct: 68  DLDSENLFVSEAFVNEGPTLKRFRPRAKGSASPINKRTSHITIVVSE-KEEG 118


>gi|303256455|ref|ZP_07342469.1| ribosomal protein L22 [Burkholderiales bacterium 1_1_47]
 gi|331000649|ref|ZP_08324302.1| ribosomal protein L22 [Parasutterella excrementihominis YIT 11859]
 gi|302859946|gb|EFL83023.1| ribosomal protein L22 [Burkholderiales bacterium 1_1_47]
 gi|329570861|gb|EGG52572.1| ribosomal protein L22 [Parasutterella excrementihominis YIT 11859]
          Length = 114

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 65/106 (61%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  AI   +R+S QK  LVA ++RGK V  AL  L F++K+ AG +RK L SA+ANAE+N
Sbjct: 2   ETTAIVRGVRLSAQKGRLVADLVRGKPVDKALNILSFTQKKAAGIIRKALDSAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           +  D+D L V+  YV K+  ++RF  R + R  RI +    + V V
Sbjct: 62  NGADIDELRVTSIYVEKATTLRRFSARAKGRGARIGKQTCHIYVTV 107


>gi|251787976|ref|YP_003002697.1| 50S ribosomal protein L22 [Dickeya zeae Ech1591]
 gi|247536597|gb|ACT05218.1| ribosomal protein L22 [Dickeya zeae Ech1591]
          Length = 110

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 65/99 (65%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R S QK+ LVA +IRGK+VS AL  L ++ K+ AG V+K L SA+ANAE+N   D+D L 
Sbjct: 11  RSSAQKVRLVADLIRGKKVSQALEILTYTNKKAAGLVKKVLESAIANAEHNDGADIDDLK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           V++ +V +   MKR   R + R  RI++  S +TV+V +
Sbjct: 71  VTKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSD 109


>gi|323703543|ref|ZP_08115189.1| ribosomal protein L22 [Desulfotomaculum nigrificans DSM 574]
 gi|323531534|gb|EGB21427.1| ribosomal protein L22 [Desulfotomaculum nigrificans DSM 574]
          Length = 113

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 45/108 (41%), Positives = 66/108 (61%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AIA  +RVSP+K  +V  +IRGK++ +ALA L ++  +    V K + SA ANAE+N
Sbjct: 2   EARAIAKFIRVSPRKARMVVDLIRGKKLDEALAILRYTPNKATEAVTKVVKSAAANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           +D+D D L +S+ YV +   +KR   R   R   I R  S +TV+V +
Sbjct: 62  YDMDKDELYISKIYVDQGPSLKRIMPRAMGRADIIKRRTSHITVVVSD 109


>gi|145345198|ref|XP_001417107.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144577333|gb|ABO95400.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 109

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 63/107 (58%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A+AI    + SP+K +    ++RG RV DAL   + S KR+A  V K L SA+ NA NN 
Sbjct: 3   ASAILRGAKGSPKKFSAFLRLVRGLRVDDALIQCDMSPKRVAKTVAKVLQSAIGNAVNNQ 62

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            LD +RL+VS A VGK  +++R    GR R G + RP S + V V E
Sbjct: 63  GLDRERLVVSSATVGKGEYLRRVSIHGRGRAGVMHRPRSHVRVTVEE 109


>gi|183600748|ref|ZP_02962241.1| hypothetical protein PROSTU_04342 [Providencia stuartii ATCC 25827]
 gi|212708986|ref|ZP_03317114.1| hypothetical protein PROVALCAL_00018 [Providencia alcalifaciens DSM
           30120]
 gi|268593546|ref|ZP_06127767.1| ribosomal protein L22 [Providencia rettgeri DSM 1131]
 gi|188019726|gb|EDU57766.1| hypothetical protein PROSTU_04342 [Providencia stuartii ATCC 25827]
 gi|212688352|gb|EEB47880.1| hypothetical protein PROVALCAL_00018 [Providencia alcalifaciens DSM
           30120]
 gi|291310824|gb|EFE51277.1| ribosomal protein L22 [Providencia rettgeri DSM 1131]
          Length = 110

 Score = 80.5 bits (197), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 64/99 (64%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R S QK+ LVA +IRGK+VS AL  L ++ K+ AG V+K L SA+ANAE N   D+D L 
Sbjct: 11  RSSAQKVRLVADLIRGKKVSQALEILTYTNKKAAGLVKKVLESAIANAEQNDGADIDDLK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           V++ +V +   MKR   R + R  RI++  S +TV+V +
Sbjct: 71  VAKIFVDEGPTMKRIMPRAKGRADRILKRTSHITVVVSD 109


>gi|88704371|ref|ZP_01102085.1| 50S ribosomal protein L22 [Congregibacter litoralis KT71]
 gi|88701422|gb|EAQ98527.1| 50S ribosomal protein L22 [Congregibacter litoralis KT71]
          Length = 112

 Score = 80.5 bits (197), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 60/97 (61%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R+S QK  LVA  +RGK V +AL+ LE+S K+ A  VRK L SA+ANAENN   DVD L 
Sbjct: 11  RISAQKARLVADQVRGKPVEEALSVLEYSNKKAAHIVRKVLNSAIANAENNEGADVDELK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           VS  +V + + MKR   R + R  RI +    +TV V
Sbjct: 71  VSTVFVDEGMTMKRLRPRAKGRADRIFKRSCHITVKV 107


>gi|320352922|ref|YP_004194261.1| 50S ribosomal protein L22P [Desulfobulbus propionicus DSM 2032]
 gi|320121424|gb|ADW16970.1| LSU ribosomal protein L22P [Desulfobulbus propionicus DSM 2032]
          Length = 110

 Score = 80.5 bits (197), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 47/108 (43%), Positives = 62/108 (57%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A+A  +R+SPQK  LVA +IRG     A+  L F  K+ A  +RK L SAVANA+  
Sbjct: 2   ETRAVAKYIRISPQKARLVADVIRGMNAEKAVTTLRFMPKKAARVIRKVLESAVANADQM 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
             +DVD L V E  V     +KRF  R + R  RI++  S +TV+V E
Sbjct: 62  ESIDVDTLYVKEITVDGGPMLKRFSPRAQGRATRILKRTSHITVVVDE 109


>gi|163938123|ref|YP_001643007.1| 50S ribosomal protein L22 [Bacillus weihenstephanensis KBAB4]
 gi|229053961|ref|ZP_04195395.1| 50S ribosomal protein L22 [Bacillus cereus AH603]
 gi|229131123|ref|ZP_04260035.1| 50S ribosomal protein L22 [Bacillus cereus BDRD-ST196]
 gi|229165103|ref|ZP_04292898.1| 50S ribosomal protein L22 [Bacillus cereus AH621]
 gi|226733433|sp|A9VP82|RL22_BACWK RecName: Full=50S ribosomal protein L22
 gi|163860320|gb|ABY41379.1| ribosomal protein L22 [Bacillus weihenstephanensis KBAB4]
 gi|228618366|gb|EEK75396.1| 50S ribosomal protein L22 [Bacillus cereus AH621]
 gi|228652336|gb|EEL08261.1| 50S ribosomal protein L22 [Bacillus cereus BDRD-ST196]
 gi|228721379|gb|EEL72900.1| 50S ribosomal protein L22 [Bacillus cereus AH603]
          Length = 113

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 70/108 (64%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A A+   +R++P+K+ LV  +IRGK+V +A+A L  + K  +  V K L SA+ANAE+N
Sbjct: 2   QAKAVVRTVRIAPRKVRLVVDLIRGKQVGEAIAILNHTPKTASPVVEKVLKSAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           +++D++ L+V + +V +   +KRF  R   R  +I +  S +TV+V E
Sbjct: 62  YEMDINNLVVEKVFVDEGPTLKRFRPRAMGRASQINKRTSHITVVVSE 109


>gi|269958589|ref|YP_003328376.1| 50S ribosomal protein L22 [Anaplasma centrale str. Israel]
 gi|269848418|gb|ACZ49062.1| 50S ribosomal protein L22 [Anaplasma centrale str. Israel]
          Length = 112

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 61/97 (62%), Gaps = 7/97 (7%)

Query: 22  SMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVD 81
           S LR +P KLNLVA +IRG+ VS A+  L F RK+ A  V K L SA+ANA+ N+D+D+D
Sbjct: 10  SGLRSTPSKLNLVADLIRGQDVSTAVMYLRFCRKKAAFLVGKVLKSAMANAQANYDVDLD 69

Query: 82  RLIVSEAYVGKSVFMKRFH-------CRGRQRIGRIV 111
            L V E  VGKS  ++R         CR R+R G IV
Sbjct: 70  SLYVKEVLVGKSFTLRRVRPRARGKACRVRKRYGSIV 106


>gi|261346930|ref|ZP_05974574.1| ribosomal protein L22 [Providencia rustigianii DSM 4541]
 gi|282564995|gb|EFB70530.1| ribosomal protein L22 [Providencia rustigianii DSM 4541]
          Length = 110

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 64/99 (64%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R S QK+ LVA +IRGK+VS AL  L ++ K+ AG V+K L SA+ANAE N   D+D L 
Sbjct: 11  RSSAQKVRLVADLIRGKKVSQALEILAYTNKKAAGLVKKVLESAIANAEQNDGADIDDLK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           V++ +V +   MKR   R + R  RI++  S +TV+V +
Sbjct: 71  VAKIFVDEGPTMKRIMPRAKGRADRILKRTSHITVVVSD 109


>gi|113476574|ref|YP_722635.1| 50S ribosomal protein L22P [Trichodesmium erythraeum IMS101]
 gi|123352120|sp|Q110B2|RL22_TRIEI RecName: Full=50S ribosomal protein L22
 gi|110167622|gb|ABG52162.1| LSU ribosomal protein L22P [Trichodesmium erythraeum IMS101]
          Length = 119

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 65/114 (57%)

Query: 14  DNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAE 73
           + E  AIA  +R+SP K+  V   IRG    +AL  LEF   R    +RK LCSAVANAE
Sbjct: 6   NTEVKAIARYIRMSPFKVRRVLDQIRGISYREALIILEFMPYRSCVPIRKVLCSAVANAE 65

Query: 74  NNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           NN  +D D L++S+A+  +   + R+  R + R  +I +P   +TV V  + D+
Sbjct: 66  NNKGIDPDTLVISKAFADQGPCLPRYRPRAQGRAYKIRKPTCHITVAVASLVDD 119


>gi|159039829|ref|YP_001539082.1| ribosomal protein L22 [Salinispora arenicola CNS-205]
 gi|215274866|sp|A8M524|RL22_SALAI RecName: Full=50S ribosomal protein L22
 gi|157918664|gb|ABW00092.1| ribosomal protein L22 [Salinispora arenicola CNS-205]
          Length = 152

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 43/94 (45%), Positives = 58/94 (61%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A+A  +R+SP K   V  ++RG    +AL  L+F+ +  + +V K L SA+ANAENN 
Sbjct: 13  ARAVARYVRISPMKARRVVNLVRGLPAKEALTVLQFAPQAASEQVYKVLASAIANAENNE 72

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRI 110
            LD D L+VSEAYV +   MKRF  R + R  RI
Sbjct: 73  RLDPDALLVSEAYVDEGPTMKRFQPRAQGRAYRI 106


>gi|288574667|ref|ZP_06393024.1| ribosomal protein L22 [Dethiosulfovibrio peptidovorans DSM 11002]
 gi|288570408|gb|EFC91965.1| ribosomal protein L22 [Dethiosulfovibrio peptidovorans DSM 11002]
          Length = 110

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 57/84 (67%)

Query: 16 EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
          EA A A  +RVSP K+  V  +IRGK+V DAL  L ++ K+ A  + K L SAVANAE+N
Sbjct: 2  EARARAKQVRVSPFKVRQVLPLIRGKKVGDALVVLRYTPKKAAKVIEKVLKSAVANAEHN 61

Query: 76 HDLDVDRLIVSEAYVGKSVFMKRF 99
          + LD+D+L+V EA+  +   MKRF
Sbjct: 62 YGLDIDKLVVVEAFADQGPSMKRF 85


>gi|145596429|ref|YP_001160726.1| ribosomal protein L22 [Salinispora tropica CNB-440]
 gi|215274867|sp|A4XBP1|RL22_SALTO RecName: Full=50S ribosomal protein L22
 gi|145305766|gb|ABP56348.1| LSU ribosomal protein L22P [Salinispora tropica CNB-440]
          Length = 152

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 43/94 (45%), Positives = 58/94 (61%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A+A  +R+SP K   V  ++RG    +AL  L+F+ +  + +V K L SA+ANAENN 
Sbjct: 13  ARAVARYVRISPMKARRVVNLVRGLPAKEALTVLQFAPQAASEQVYKVLASAIANAENNE 72

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRI 110
            LD D L+VSEAYV +   MKRF  R + R  RI
Sbjct: 73  RLDPDALLVSEAYVDEGPTMKRFQPRAQGRAYRI 106


>gi|116495942|ref|YP_807676.1| 50S ribosomal protein L22 [Lactobacillus casei ATCC 334]
 gi|191639423|ref|YP_001988589.1| 50S ribosomal protein L22 [Lactobacillus casei BL23]
 gi|199598837|ref|ZP_03212248.1| 50S ribosomal protein L22 [Lactobacillus rhamnosus HN001]
 gi|227533965|ref|ZP_03964014.1| 50S ribosomal protein L22 [Lactobacillus paracasei subsp. paracasei
           ATCC 25302]
 gi|229552713|ref|ZP_04441438.1| 50S ribosomal protein L22 [Lactobacillus rhamnosus LMS2-1]
 gi|239630346|ref|ZP_04673377.1| 50S ribosomal protein L22 [Lactobacillus paracasei subsp. paracasei
           8700:2]
 gi|258509477|ref|YP_003172228.1| 50S ribosomal protein L22 [Lactobacillus rhamnosus GG]
 gi|258540674|ref|YP_003175173.1| 50S ribosomal protein L22 [Lactobacillus rhamnosus Lc 705]
 gi|301067498|ref|YP_003789521.1| 50S ribosomal protein L22 [Lactobacillus casei str. Zhang]
 gi|122262658|sp|Q034Y8|RL22_LACC3 RecName: Full=50S ribosomal protein L22
 gi|226733477|sp|B3WAL2|RL22_LACCB RecName: Full=50S ribosomal protein L22
 gi|116106092|gb|ABJ71234.1| LSU ribosomal protein L22P [Lactobacillus casei ATCC 334]
 gi|190713725|emb|CAQ67731.1| 50S ribosomal protein L22 [Lactobacillus casei BL23]
 gi|199590249|gb|EDY98344.1| 50S ribosomal protein L22 [Lactobacillus rhamnosus HN001]
 gi|227188342|gb|EEI68409.1| 50S ribosomal protein L22 [Lactobacillus paracasei subsp. paracasei
           ATCC 25302]
 gi|229313919|gb|EEN79892.1| 50S ribosomal protein L22 [Lactobacillus rhamnosus LMS2-1]
 gi|239527958|gb|EEQ66959.1| 50S ribosomal protein L22 [Lactobacillus paracasei subsp. paracasei
           8700:2]
 gi|257149404|emb|CAR88377.1| LSU/50S ribosomal protein L22P [Lactobacillus rhamnosus GG]
 gi|257152350|emb|CAR91322.1| LSU/50S ribosomal protein L22P [Lactobacillus rhamnosus Lc 705]
 gi|259650756|dbj|BAI42918.1| 50S ribosomal protein L22 [Lactobacillus rhamnosus GG]
 gi|300439905|gb|ADK19671.1| Ribosomal protein L22 [Lactobacillus casei str. Zhang]
 gi|327383512|gb|AEA54988.1| 50S ribosomal protein L22 [Lactobacillus casei LC2W]
 gi|327386705|gb|AEA58179.1| 50S ribosomal protein L22 [Lactobacillus casei BD-II]
 gi|328478162|gb|EGF48008.1| 50S ribosomal protein L22 [Lactobacillus rhamnosus MTCC 5462]
          Length = 117

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 69/114 (60%), Gaps = 2/114 (1%)

Query: 12  MGD--NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           M D    A A A  +R++ +K  LV  +IRG+ V++ALA LEF+ +  +  + K L SA+
Sbjct: 1   MADQITSATATAKTVRIAARKARLVIDLIRGRDVAEALAILEFTPRSGSPIIEKVLKSAI 60

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           ANAE+N+DLD   L VS+AYV +   +KRF  R +     I +  S +TV+V E
Sbjct: 61  ANAEHNYDLDAQNLYVSKAYVNEGPTLKRFRPRAKGSASPINKRTSHVTVVVSE 114


>gi|242237864|ref|YP_002986045.1| 50S ribosomal protein L22 [Dickeya dadantii Ech703]
 gi|271502241|ref|YP_003335267.1| 50S ribosomal protein L22 [Dickeya dadantii Ech586]
 gi|307132834|ref|YP_003884850.1| 50S ribosomal subunit protein L22 [Dickeya dadantii 3937]
 gi|242129921|gb|ACS84223.1| ribosomal protein L22 [Dickeya dadantii Ech703]
 gi|270345796|gb|ACZ78561.1| ribosomal protein L22 [Dickeya dadantii Ech586]
 gi|306530363|gb|ADN00294.1| 50S ribosomal subunit protein L22 [Dickeya dadantii 3937]
          Length = 110

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 65/99 (65%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R S QK+ LVA +IRGK+VS AL  L ++ K+ AG V+K L SA+ANAE+N   D+D L 
Sbjct: 11  RSSAQKVRLVADLIRGKKVSQALDILTYTNKKAAGLVKKVLESAIANAEHNDGADIDDLK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           V++ +V +   MKR   R + R  RI++  S +TV+V +
Sbjct: 71  VAKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSD 109


>gi|88801214|ref|ZP_01116755.1| ribosomal protein L22 [Reinekea sp. MED297]
 gi|88776052|gb|EAR07286.1| ribosomal protein L22 [Reinekea sp. MED297]
          Length = 111

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 66/108 (61%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A+    R+S QK  L+A MIRGK V++AL  L FS K+ A  V+K L SA+ANAE+N
Sbjct: 2   ETQAVLRGARLSAQKGRLIADMIRGKSVAEALDILTFSPKKGADLVKKVLESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           +  DVD L VS  +V + + MKR   R + R  RI +  S +TV V E
Sbjct: 62  NGADVDELRVSTVFVDEGMTMKRIRPRAKGRADRIFKRTSHITVKVAE 109


>gi|323340379|ref|ZP_08080636.1| 50S ribosomal protein L22 [Lactobacillus ruminis ATCC 25644]
 gi|323092155|gb|EFZ34770.1| 50S ribosomal protein L22 [Lactobacillus ruminis ATCC 25644]
          Length = 115

 Score = 80.1 bits (196), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 47/105 (44%), Positives = 64/105 (60%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A A  +R+  +K  LV  +IRGK V++AL  L+F+ +  A  V K L SA+ANAENN 
Sbjct: 8   AKATAKTVRIPARKARLVIDLIRGKSVAEALGILKFTPRSGAFLVEKVLKSAIANAENNF 67

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           DLDV+ L VSEAY  +   +KRF  R +     I +  S +TV+V
Sbjct: 68  DLDVEDLYVSEAYANEGPTLKRFRPRAKGSASPINKRTSHITVVV 112


>gi|50122946|ref|YP_052113.1| 50S ribosomal protein L22 [Pectobacterium atrosepticum SCRI1043]
 gi|227115267|ref|ZP_03828923.1| 50S ribosomal protein L22 [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
 gi|227328944|ref|ZP_03832968.1| 50S ribosomal protein L22 [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
 gi|253690178|ref|YP_003019368.1| ribosomal protein L22 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|261823227|ref|YP_003261333.1| 50S ribosomal protein L22 [Pectobacterium wasabiae WPP163]
 gi|81693073|sp|Q6CZX5|RL22_ERWCT RecName: Full=50S ribosomal protein L22
 gi|259646253|sp|C6DG69|RL22_PECCP RecName: Full=50S ribosomal protein L22
 gi|49613472|emb|CAG76923.1| 50S ribosomal subunit protein L22 [Pectobacterium atrosepticum
           SCRI1043]
 gi|251756756|gb|ACT14832.1| ribosomal protein L22 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|261607240|gb|ACX89726.1| ribosomal protein L22 [Pectobacterium wasabiae WPP163]
          Length = 110

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 65/99 (65%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R S QK+ LVA +IRGK+VS AL  L ++ K+ AG V+K L SA+ANAE+N   D+D L 
Sbjct: 11  RSSAQKVRLVADLIRGKKVSQALEVLTYTNKKAAGLVKKVLESAIANAEHNDGADIDDLK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           V++ +V +   MKR   R + R  RI++  S +TV+V +
Sbjct: 71  VAKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSD 109


>gi|296333118|ref|ZP_06875572.1| 50S ribosomal protein L22 [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305672820|ref|YP_003864491.1| 50S ribosomal protein L22 [Bacillus subtilis subsp. spizizenii str.
           W23]
 gi|296149734|gb|EFG90629.1| 50S ribosomal protein L22 [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305411063|gb|ADM36181.1| 50S ribosomal protein L22 [Bacillus subtilis subsp. spizizenii str.
           W23]
          Length = 113

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 71/108 (65%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A A+A  +R++P+K  LV  +IRGK+V +A++ L  + +  +  + K L SA+ANAE+N
Sbjct: 2   QAKAVARTVRIAPRKARLVMDLIRGKQVGEAVSILNLTPRAASPIIEKVLKSAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           ++LD + L++S+A+V +   +KRF  R   R  +I +  S +T++V E
Sbjct: 62  YELDANNLVISQAFVDEGPTLKRFRPRAMGRASQINKRTSHITIVVSE 109


>gi|259500897|ref|ZP_05743799.1| 50S ribosomal protein L22 [Lactobacillus iners DSM 13335]
 gi|302190650|ref|ZP_07266904.1| 50S ribosomal protein L22 [Lactobacillus iners AB-1]
 gi|309803650|ref|ZP_07697740.1| ribosomal protein L22 [Lactobacillus iners LactinV 11V1-d]
 gi|309804958|ref|ZP_07699016.1| ribosomal protein L22 [Lactobacillus iners LactinV 09V1-c]
 gi|309806722|ref|ZP_07700717.1| ribosomal protein L22 [Lactobacillus iners LactinV 03V1-b]
 gi|309808439|ref|ZP_07702338.1| ribosomal protein L22 [Lactobacillus iners LactinV 01V1-a]
 gi|309809110|ref|ZP_07702983.1| ribosomal protein L22 [Lactobacillus iners SPIN 2503V10-D]
 gi|312871206|ref|ZP_07731304.1| ribosomal protein L22 [Lactobacillus iners LEAF 3008A-a]
 gi|312872707|ref|ZP_07732772.1| ribosomal protein L22 [Lactobacillus iners LEAF 2062A-h1]
 gi|312874030|ref|ZP_07734065.1| ribosomal protein L22 [Lactobacillus iners LEAF 2052A-d]
 gi|312874769|ref|ZP_07734788.1| ribosomal protein L22 [Lactobacillus iners LEAF 2053A-b]
 gi|315654021|ref|ZP_07906937.1| 50S ribosomal protein L22 [Lactobacillus iners ATCC 55195]
 gi|325912346|ref|ZP_08174742.1| ribosomal protein L22 [Lactobacillus iners UPII 143-D]
 gi|325913204|ref|ZP_08175573.1| ribosomal protein L22 [Lactobacillus iners UPII 60-B]
 gi|329920647|ref|ZP_08277334.1| ribosomal protein L22 [Lactobacillus iners SPIN 1401G]
 gi|259167591|gb|EEW52086.1| 50S ribosomal protein L22 [Lactobacillus iners DSM 13335]
 gi|308164248|gb|EFO66505.1| ribosomal protein L22 [Lactobacillus iners LactinV 11V1-d]
 gi|308165718|gb|EFO67943.1| ribosomal protein L22 [Lactobacillus iners LactinV 09V1-c]
 gi|308166902|gb|EFO69086.1| ribosomal protein L22 [Lactobacillus iners LactinV 03V1-b]
 gi|308168267|gb|EFO70386.1| ribosomal protein L22 [Lactobacillus iners LactinV 01V1-a]
 gi|308170555|gb|EFO72575.1| ribosomal protein L22 [Lactobacillus iners SPIN 2503V10-D]
 gi|311089514|gb|EFQ47939.1| ribosomal protein L22 [Lactobacillus iners LEAF 2053A-b]
 gi|311090370|gb|EFQ48779.1| ribosomal protein L22 [Lactobacillus iners LEAF 2052A-d]
 gi|311091749|gb|EFQ50128.1| ribosomal protein L22 [Lactobacillus iners LEAF 2062A-h1]
 gi|311093220|gb|EFQ51566.1| ribosomal protein L22 [Lactobacillus iners LEAF 3008A-a]
 gi|315488717|gb|EFU78363.1| 50S ribosomal protein L22 [Lactobacillus iners ATCC 55195]
 gi|325475817|gb|EGC78987.1| ribosomal protein L22 [Lactobacillus iners UPII 143-D]
 gi|325477468|gb|EGC80611.1| ribosomal protein L22 [Lactobacillus iners UPII 60-B]
 gi|328935905|gb|EGG32365.1| ribosomal protein L22 [Lactobacillus iners SPIN 1401G]
          Length = 117

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 42/90 (46%), Positives = 61/90 (67%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
           N A + A  +R++P+K  LV  +IRGK V++ALA LEF+ +  +  V+K L SA+ANAE+
Sbjct: 6   NSARSEARTVRIAPRKARLVVDLIRGKSVAEALAILEFTPRSASPIVKKVLKSAIANAEH 65

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGR 104
           N+DL+   L VSEAYV +   +KRF  R +
Sbjct: 66  NYDLESANLYVSEAYVNEGPTLKRFRPRAK 95


>gi|15900150|ref|NP_344754.1| 50S ribosomal protein L22 [Streptococcus pneumoniae TIGR4]
 gi|15902238|ref|NP_357788.1| 50S ribosomal protein L22 [Streptococcus pneumoniae R6]
 gi|111658796|ref|ZP_01409427.1| hypothetical protein SpneT_02000093 [Streptococcus pneumoniae
           TIGR4]
 gi|116517196|ref|YP_815717.1| 50S ribosomal protein L22 [Streptococcus pneumoniae D39]
 gi|148983613|ref|ZP_01816932.1| 50S ribosomal protein L22 [Streptococcus pneumoniae SP3-BS71]
 gi|148987951|ref|ZP_01819414.1| 50S ribosomal protein L22 [Streptococcus pneumoniae SP6-BS73]
 gi|148992791|ref|ZP_01822434.1| 50S ribosomal protein L22 [Streptococcus pneumoniae SP9-BS68]
 gi|148996636|ref|ZP_01824354.1| 50S ribosomal protein L22 [Streptococcus pneumoniae SP11-BS70]
 gi|149001680|ref|ZP_01826653.1| ribosomal protein L22 [Streptococcus pneumoniae SP14-BS69]
 gi|149005964|ref|ZP_01829693.1| 50S ribosomal protein L22 [Streptococcus pneumoniae SP18-BS74]
 gi|149011083|ref|ZP_01832388.1| 50S ribosomal protein L22 [Streptococcus pneumoniae SP19-BS75]
 gi|149017903|ref|ZP_01834362.1| 50S ribosomal protein L22 [Streptococcus pneumoniae SP23-BS72]
 gi|168483850|ref|ZP_02708802.1| ribosomal protein L22 [Streptococcus pneumoniae CDC1873-00]
 gi|168486020|ref|ZP_02710528.1| ribosomal protein L22 [Streptococcus pneumoniae CDC1087-00]
 gi|168489691|ref|ZP_02713890.1| ribosomal protein L22 [Streptococcus pneumoniae SP195]
 gi|168492167|ref|ZP_02716310.1| ribosomal protein L22 [Streptococcus pneumoniae CDC0288-04]
 gi|168493907|ref|ZP_02718050.1| ribosomal protein L22 [Streptococcus pneumoniae CDC3059-06]
 gi|168576359|ref|ZP_02722242.1| ribosomal protein L22 [Streptococcus pneumoniae MLV-016]
 gi|169832894|ref|YP_001693746.1| 50S ribosomal protein L22 [Streptococcus pneumoniae Hungary19A-6]
 gi|182683193|ref|YP_001834940.1| 50S ribosomal protein L22 [Streptococcus pneumoniae CGSP14]
 gi|194398165|ref|YP_002036915.1| 50S ribosomal protein L22 [Streptococcus pneumoniae G54]
 gi|221231118|ref|YP_002510270.1| 50S ribosomal protein L22 [Streptococcus pneumoniae ATCC 700669]
 gi|225853820|ref|YP_002735332.1| 50S ribosomal protein L22 [Streptococcus pneumoniae JJA]
 gi|225855979|ref|YP_002737490.1| 50S ribosomal protein L22 [Streptococcus pneumoniae P1031]
 gi|225858068|ref|YP_002739578.1| 50S ribosomal protein L22 [Streptococcus pneumoniae 70585]
 gi|225860256|ref|YP_002741765.1| 50S ribosomal protein L22 [Streptococcus pneumoniae Taiwan19F-14]
 gi|237649718|ref|ZP_04523970.1| 50S ribosomal protein L22 [Streptococcus pneumoniae CCRI 1974]
 gi|237821416|ref|ZP_04597261.1| 50S ribosomal protein L22 [Streptococcus pneumoniae CCRI 1974M2]
 gi|270292005|ref|ZP_06198220.1| ribosomal protein L22 [Streptococcus sp. M143]
 gi|293364342|ref|ZP_06611068.1| 50S ribosomal protein L22 [Streptococcus oralis ATCC 35037]
 gi|298230371|ref|ZP_06964052.1| 50S ribosomal protein L22 [Streptococcus pneumoniae str. Canada
           MDR_19F]
 gi|298255992|ref|ZP_06979578.1| 50S ribosomal protein L22 [Streptococcus pneumoniae str. Canada
           MDR_19A]
 gi|298502028|ref|YP_003723968.1| 50S ribosomal protein L22 [Streptococcus pneumoniae TCH8431/19A]
 gi|303255090|ref|ZP_07341166.1| 50S ribosomal protein L22 [Streptococcus pneumoniae BS455]
 gi|303259266|ref|ZP_07345244.1| 50S ribosomal protein L22 [Streptococcus pneumoniae SP-BS293]
 gi|303261021|ref|ZP_07346970.1| 50S ribosomal protein L22 [Streptococcus pneumoniae SP14-BS292]
 gi|303263349|ref|ZP_07349272.1| 50S ribosomal protein L22 [Streptococcus pneumoniae BS397]
 gi|303265514|ref|ZP_07351414.1| 50S ribosomal protein L22 [Streptococcus pneumoniae BS457]
 gi|303267928|ref|ZP_07353730.1| 50S ribosomal protein L22 [Streptococcus pneumoniae BS458]
 gi|306825981|ref|ZP_07459317.1| 50S ribosomal protein L22 [Streptococcus sp. oral taxon 071 str.
           73H25AP]
 gi|306828788|ref|ZP_07461980.1| 50S ribosomal protein L22 [Streptococcus mitis ATCC 6249]
 gi|307066892|ref|YP_003875858.1| ribosomal protein L22 [Streptococcus pneumoniae AP200]
 gi|307126434|ref|YP_003878465.1| 50S ribosomal protein L22 [Streptococcus pneumoniae 670-6B]
 gi|307702691|ref|ZP_07639643.1| ribosomal protein L22 [Streptococcus oralis ATCC 35037]
 gi|307704070|ref|ZP_07640999.1| ribosomal protein L22 [Streptococcus mitis SK597]
 gi|307708065|ref|ZP_07644533.1| ribosomal protein L22 [Streptococcus mitis NCTC 12261]
 gi|307709915|ref|ZP_07646362.1| ribosomal protein L22 [Streptococcus mitis SK564]
 gi|307711050|ref|ZP_07647472.1| ribosomal protein L22 [Streptococcus mitis SK321]
 gi|309799063|ref|ZP_07693316.1| ribosomal protein L22 [Streptococcus infantis SK1302]
 gi|315612337|ref|ZP_07887250.1| 50S ribosomal protein L22 [Streptococcus sanguinis ATCC 49296]
 gi|322375034|ref|ZP_08049548.1| ribosomal protein L22 [Streptococcus sp. C300]
 gi|322377225|ref|ZP_08051717.1| ribosomal protein L22 [Streptococcus sp. M334]
 gi|322388396|ref|ZP_08061999.1| 50S ribosomal protein L22 [Streptococcus infantis ATCC 700779]
 gi|322391204|ref|ZP_08064676.1| 50S ribosomal protein L22 [Streptococcus peroris ATCC 700780]
 gi|331267131|ref|YP_004326761.1| 50S ribosomal protein L22 [Streptococcus oralis Uo5]
 gi|47117758|sp|P61182|RL22_STRPN RecName: Full=50S ribosomal protein L22
 gi|47117759|sp|P61183|RL22_STRR6 RecName: Full=50S ribosomal protein L22
 gi|122279397|sp|Q04MN1|RL22_STRP2 RecName: Full=50S ribosomal protein L22
 gi|226733517|sp|B5E6G0|RL22_STRP4 RecName: Full=50S ribosomal protein L22
 gi|226733518|sp|B1I8K3|RL22_STRPI RecName: Full=50S ribosomal protein L22
 gi|226733519|sp|B2IS45|RL22_STRPS RecName: Full=50S ribosomal protein L22
 gi|254800461|sp|C1CAL7|RL22_STRP7 RecName: Full=50S ribosomal protein L22
 gi|254800462|sp|B8ZKG2|RL22_STRPJ RecName: Full=50S ribosomal protein L22
 gi|254800464|sp|C1CC11|RL22_STRZJ RecName: Full=50S ribosomal protein L22
 gi|254800465|sp|C1CIA2|RL22_STRZP RecName: Full=50S ribosomal protein L22
 gi|254800466|sp|C1CP93|RL22_STRZT RecName: Full=50S ribosomal protein L22
 gi|4927745|gb|AAD33261.1|AF126059_2 RpL22 [Streptococcus pneumoniae]
 gi|4927754|gb|AAD33270.1| RpL22 [Streptococcus pneumoniae]
 gi|4927763|gb|AAD33279.1| RpL22 [Streptococcus pneumoniae]
 gi|14971682|gb|AAK74394.1| ribosomal protein L22 [Streptococcus pneumoniae TIGR4]
 gi|15457739|gb|AAK98998.1| 50S Ribosomal protein L22 [Streptococcus pneumoniae R6]
 gi|116077772|gb|ABJ55492.1| ribosomal protein L22 [Streptococcus pneumoniae D39]
 gi|147757211|gb|EDK64250.1| 50S ribosomal protein L22 [Streptococcus pneumoniae SP11-BS70]
 gi|147760138|gb|EDK67127.1| ribosomal protein L22 [Streptococcus pneumoniae SP14-BS69]
 gi|147762320|gb|EDK69281.1| 50S ribosomal protein L22 [Streptococcus pneumoniae SP18-BS74]
 gi|147764719|gb|EDK71649.1| 50S ribosomal protein L22 [Streptococcus pneumoniae SP19-BS75]
 gi|147923760|gb|EDK74872.1| 50S ribosomal protein L22 [Streptococcus pneumoniae SP3-BS71]
 gi|147926415|gb|EDK77488.1| 50S ribosomal protein L22 [Streptococcus pneumoniae SP6-BS73]
 gi|147928517|gb|EDK79532.1| 50S ribosomal protein L22 [Streptococcus pneumoniae SP9-BS68]
 gi|147931467|gb|EDK82445.1| 50S ribosomal protein L22 [Streptococcus pneumoniae SP23-BS72]
 gi|168995396|gb|ACA36008.1| ribosomal protein L22 [Streptococcus pneumoniae Hungary19A-6]
 gi|172042866|gb|EDT50912.1| ribosomal protein L22 [Streptococcus pneumoniae CDC1873-00]
 gi|182628527|gb|ACB89475.1| 50S ribosomal protein L22 [Streptococcus pneumoniae CGSP14]
 gi|183570923|gb|EDT91451.1| ribosomal protein L22 [Streptococcus pneumoniae CDC1087-00]
 gi|183571868|gb|EDT92396.1| ribosomal protein L22 [Streptococcus pneumoniae SP195]
 gi|183573619|gb|EDT94147.1| ribosomal protein L22 [Streptococcus pneumoniae CDC0288-04]
 gi|183576212|gb|EDT96740.1| ribosomal protein L22 [Streptococcus pneumoniae CDC3059-06]
 gi|183577808|gb|EDT98336.1| ribosomal protein L22 [Streptococcus pneumoniae MLV-016]
 gi|194357832|gb|ACF56280.1| 50S ribosomal protein L22 [Streptococcus pneumoniae G54]
 gi|220673578|emb|CAR68064.1| 50S ribosomal protein L22 [Streptococcus pneumoniae ATCC 700669]
 gi|225720888|gb|ACO16742.1| ribosomal protein L22 [Streptococcus pneumoniae 70585]
 gi|225723664|gb|ACO19517.1| ribosomal protein L22 [Streptococcus pneumoniae JJA]
 gi|225725026|gb|ACO20878.1| ribosomal protein L22 [Streptococcus pneumoniae P1031]
 gi|225727941|gb|ACO23792.1| ribosomal protein L22 [Streptococcus pneumoniae Taiwan19F-14]
 gi|270279533|gb|EFA25375.1| ribosomal protein L22 [Streptococcus sp. M143]
 gi|291317188|gb|EFE57615.1| 50S ribosomal protein L22 [Streptococcus oralis ATCC 35037]
 gi|298237623|gb|ADI68754.1| 50S ribosomal protein L22 [Streptococcus pneumoniae TCH8431/19A]
 gi|301793487|emb|CBW35860.1| 50S ribosomal protein L22 [Streptococcus pneumoniae INV104]
 gi|301799363|emb|CBW31898.1| 50S ribosomal protein L22 [Streptococcus pneumoniae OXC141]
 gi|301801158|emb|CBW33831.1| 50S ribosomal protein L22 [Streptococcus pneumoniae INV200]
 gi|302597920|gb|EFL64990.1| 50S ribosomal protein L22 [Streptococcus pneumoniae BS455]
 gi|302637858|gb|EFL68344.1| 50S ribosomal protein L22 [Streptococcus pneumoniae SP14-BS292]
 gi|302639684|gb|EFL70141.1| 50S ribosomal protein L22 [Streptococcus pneumoniae SP-BS293]
 gi|302642624|gb|EFL72969.1| 50S ribosomal protein L22 [Streptococcus pneumoniae BS458]
 gi|302644954|gb|EFL75201.1| 50S ribosomal protein L22 [Streptococcus pneumoniae BS457]
 gi|302647122|gb|EFL77346.1| 50S ribosomal protein L22 [Streptococcus pneumoniae BS397]
 gi|304428966|gb|EFM32054.1| 50S ribosomal protein L22 [Streptococcus mitis ATCC 6249]
 gi|304431697|gb|EFM34677.1| 50S ribosomal protein L22 [Streptococcus sp. oral taxon 071 str.
           73H25AP]
 gi|306408429|gb|ADM83856.1| Ribosomal protein L22 [Streptococcus pneumoniae AP200]
 gi|306483496|gb|ADM90365.1| ribosomal protein L22 [Streptococcus pneumoniae 670-6B]
 gi|307615850|gb|EFN95055.1| ribosomal protein L22 [Streptococcus mitis NCTC 12261]
 gi|307617012|gb|EFN96190.1| ribosomal protein L22 [Streptococcus mitis SK321]
 gi|307619286|gb|EFN98415.1| ribosomal protein L22 [Streptococcus mitis SK564]
 gi|307622360|gb|EFO01368.1| ribosomal protein L22 [Streptococcus mitis SK597]
 gi|307623807|gb|EFO02792.1| ribosomal protein L22 [Streptococcus oralis ATCC 35037]
 gi|308117298|gb|EFO54721.1| ribosomal protein L22 [Streptococcus infantis SK1302]
 gi|315315318|gb|EFU63357.1| 50S ribosomal protein L22 [Streptococcus sanguinis ATCC 49296]
 gi|321140709|gb|EFX36211.1| 50S ribosomal protein L22 [Streptococcus infantis ATCC 700779]
 gi|321145957|gb|EFX41346.1| 50S ribosomal protein L22 [Streptococcus peroris ATCC 700780]
 gi|321280534|gb|EFX57573.1| ribosomal protein L22 [Streptococcus sp. C300]
 gi|321281938|gb|EFX58946.1| ribosomal protein L22 [Streptococcus sp. M334]
 gi|326683803|emb|CBZ01421.1| 50S ribosomal protein L22 [Streptococcus oralis Uo5]
 gi|327390633|gb|EGE88973.1| ribosomal protein L22 [Streptococcus pneumoniae GA04375]
 gi|332075879|gb|EGI86346.1| ribosomal protein L22 [Streptococcus pneumoniae GA17570]
 gi|332076660|gb|EGI87122.1| ribosomal protein L22 [Streptococcus pneumoniae GA17545]
 gi|332077515|gb|EGI87976.1| ribosomal protein L22 [Streptococcus pneumoniae GA41301]
          Length = 114

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 49/107 (45%), Positives = 64/107 (59%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A+A  +RVSP+K  LV   IRGK V+DA+A L F+  + A  + K L SAVANAENN 
Sbjct: 7   AKAMARTVRVSPRKSRLVLDNIRGKSVADAIAILTFTPNKAAEIILKVLNSAVANAENNF 66

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            LD   L+VSEA+  +   MKRF  R +     I +  + +TV V E
Sbjct: 67  GLDKANLVVSEAFANEGPTMKRFRPRAKGSASPINKRTAHITVAVAE 113


>gi|254796652|ref|YP_003081488.1| ribosomal protein L22 [Neorickettsia risticii str. Illinois]
 gi|254589889|gb|ACT69251.1| ribosomal protein L22 [Neorickettsia risticii str. Illinois]
          Length = 113

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 43/98 (43%), Positives = 63/98 (64%)

Query: 24  LRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRL 83
           ++ S QK+NLVA MIRGK V  A + L F +K +A  + K L S+VANA+NN  +D D L
Sbjct: 8   MKSSVQKVNLVADMIRGKGVGVARSQLLFLKKALAKPLSKVLMSSVANAQNNFGVDPDSL 67

Query: 84  IVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
            V E +VGK + +KRF  R R R   I + +S +++++
Sbjct: 68  YVKEVFVGKGMSLKRFAARARGRSASIRKHYSNVSILL 105


>gi|328951231|ref|YP_004368566.1| ribosomal protein L22 [Marinithermus hydrothermalis DSM 14884]
 gi|328451555|gb|AEB12456.1| ribosomal protein L22 [Marinithermus hydrothermalis DSM 14884]
          Length = 113

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 65/108 (60%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A A+A  +R+SP+K+ LV  +IRGK V +A   L +  KR A  VRK L SAVANA NN
Sbjct: 2   QAKAVARYVRMSPRKVRLVVDLIRGKSVEEADVLLRYLNKRAARPVRKVLKSAVANAVNN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           H+L  D L V  AYV +   +KR   R R R   I +  S +T+IV E
Sbjct: 62  HNLLEDALYVKAAYVDEGPALKRILPRARGRADIIKKRTSHITIIVEE 109


>gi|241895182|ref|ZP_04782478.1| ribosomal protein L22 [Weissella paramesenteroides ATCC 33313]
 gi|241871488|gb|EER75239.1| ribosomal protein L22 [Weissella paramesenteroides ATCC 33313]
          Length = 115

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 67/107 (62%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A A ++RV+P+K+ LV   +RGK V++A A L+F     + +V K L SAVANAENN 
Sbjct: 8   ARATAKIVRVAPRKVRLVLDQVRGKSVAEAFAILQFLPNHSSEDVYKVLNSAVANAENNF 67

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            LD + L+V+EA+  +   +KRF  R +     I +  S +T++V+E
Sbjct: 68  SLDREDLVVAEAFANEGPTLKRFRPRAKGSASPINKRTSHITIVVKE 114


>gi|15837759|ref|NP_298447.1| 50S ribosomal protein L22 [Xylella fastidiosa 9a5c]
 gi|51316931|sp|Q9PE71|RL22_XYLFA RecName: Full=50S ribosomal protein L22
 gi|9106121|gb|AAF83967.1|AE003950_17 50S ribosomal protein L22 [Xylella fastidiosa 9a5c]
          Length = 111

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 64/106 (60%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AI    R+SPQK  LVAA +RG     A+  L FS K+ A  ++K + SA+ANAENN
Sbjct: 2   EATAILRGARISPQKARLVAAQVRGLSAESAVNILRFSSKKAACLIKKVVESAIANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           H  ++D L ++   V +   +KRF  R + R  RIV+  S +TV+V
Sbjct: 62  HGSNIDALKINTIIVDEGRMLKRFMARAKGRSSRIVKRSSHITVVV 107


>gi|85858151|ref|YP_460353.1| 50S ribosomal protein L22P [Syntrophus aciditrophicus SB]
 gi|109893244|sp|Q2LQ96|RL22_SYNAS RecName: Full=50S ribosomal protein L22
 gi|85721242|gb|ABC76185.1| LSU ribosomal protein L22P [Syntrophus aciditrophicus SB]
          Length = 110

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 62/108 (57%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A  +R+SPQK  LV  +IRGK+V DA   L +SRKR    V K L SA ANA  N
Sbjct: 2   EAKATAKYIRISPQKARLVVDLIRGKKVDDAREILNYSRKRSGQIVGKVLKSAFANAVQN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            ++D   L V E +V +   MKR+  R + R   I +  S +TVI+ E
Sbjct: 62  PNIDEKILFVKEIFVDQGPSMKRWRARAQGRAASIKKRMSHITVILDE 109


>gi|85060251|ref|YP_455953.1| 50S ribosomal protein L22 [Sodalis glossinidius str. 'morsitans']
 gi|109893239|sp|Q2NQM7|RL22_SODGM RecName: Full=50S ribosomal protein L22
 gi|84780771|dbj|BAE75548.1| 50S ribosomal protein L22 [Sodalis glossinidius str. 'morsitans']
          Length = 110

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 64/99 (64%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R S QK+ LVA +IRGK+VS AL  L ++ K+ AG V+K L SA+ANAE+N   D+D L 
Sbjct: 11  RSSAQKVRLVADLIRGKKVSQALEVLTYTNKKAAGLVKKVLESAIANAEHNDGADIDDLK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           V++ +V     MKR   R + R  RI++  S +TV+V +
Sbjct: 71  VAKIFVDAGPSMKRIMPRAKGRADRILKRTSHITVVVSD 109


>gi|241765222|ref|ZP_04763205.1| ribosomal protein L22 [Acidovorax delafieldii 2AN]
 gi|326315229|ref|YP_004232901.1| 50S ribosomal protein L22 [Acidovorax avenae subsp. avenae ATCC
           19860]
 gi|241365102|gb|EER59981.1| ribosomal protein L22 [Acidovorax delafieldii 2AN]
 gi|323372065|gb|ADX44334.1| ribosomal protein L22 [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 110

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 64/107 (59%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
           +E  A+   +R+S  K  LVA +IRGK+V  AL  L F++K+ AG V+K L SA+ANAE+
Sbjct: 2   SETRAVLRGVRLSVDKGRLVADLIRGKKVDQALNILTFTQKKAAGIVKKVLESAIANAEH 61

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           N   D+D L V   YV +   +KRF  R + R  RI +P   + V V
Sbjct: 62  NDGADIDELKVKTIYVEQGTTLKRFTARAKGRGNRISKPTCHVYVTV 108


>gi|320451295|ref|YP_004203391.1| 50S ribosomal protein L22 [Thermus scotoductus SA-01]
 gi|320151464|gb|ADW22842.1| 50S ribosomal protein L22 [Thermus scotoductus SA-01]
          Length = 113

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 66/108 (61%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AIA  +R+SP+K+ LV  +IRGK + +A A L ++ KR A  V K L SA ANA NN
Sbjct: 2   EAKAIARYVRISPRKVRLVVDLIRGKSLEEARAILRYTPKRGAYYVAKVLESAAANAVNN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           HD+  DRL V  A+V +   +KR   R R R   I +  S +TVI+ E
Sbjct: 62  HDMLEDRLFVKAAFVDEGPALKRVLPRARGRADIIKKRTSHITVILGE 109


>gi|160871621|ref|ZP_02061753.1| ribosomal protein L22 [Rickettsiella grylli]
 gi|159120420|gb|EDP45758.1| ribosomal protein L22 [Rickettsiella grylli]
          Length = 115

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/103 (43%), Positives = 63/103 (61%), Gaps = 3/103 (2%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R+SPQK  LVA  +RG  V  AL  L  S K+ A  ++K L SA+ANAE+N  LD+D L 
Sbjct: 11  RLSPQKCRLVADQVRGLTVEKALQVLAMSAKKNASAIKKVLESAMANAEHNAGLDIDTLK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           VS  ++ +   +KR H R + R  RI++P   +TV   +VSD+
Sbjct: 71  VSTIFIDQGPTLKRMHARAKGRSNRILKPTCHITV---KVSDD 110


>gi|223983926|ref|ZP_03634086.1| hypothetical protein HOLDEFILI_01367 [Holdemania filiformis DSM
           12042]
 gi|223964118|gb|EEF68470.1| hypothetical protein HOLDEFILI_01367 [Holdemania filiformis DSM
           12042]
          Length = 110

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/108 (40%), Positives = 63/108 (58%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A A  +R++P+K+ LV  ++RGK   +A A L+F+    A  V K L SAVANA NN
Sbjct: 2   EVKATAKTVRIAPRKVRLVLDLVRGKDAKEAEAILKFTPNHAAEAVGKVLKSAVANAVNN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           H LD  +L V   Y  + + MKRF  R +    +I++  S +TV+V E
Sbjct: 62  HQLDESKLYVKACYANEGITMKRFMPRAKGNAAQILKRTSHITVVVEE 109


>gi|257470831|ref|ZP_05634921.1| 50S ribosomal protein L22P [Fusobacterium ulcerans ATCC 49185]
 gi|317065035|ref|ZP_07929520.1| LSU ribosomal protein L22P [Fusobacterium ulcerans ATCC 49185]
 gi|313690711|gb|EFS27546.1| LSU ribosomal protein L22P [Fusobacterium ulcerans ATCC 49185]
          Length = 110

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/108 (42%), Positives = 64/108 (59%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AI   +R+SP+K  LVA ++RGK   +AL  LEF+ K+ A  ++KTL SAVANA NN
Sbjct: 2   EARAITRFVRLSPRKARLVADLVRGKSALEALDILEFTNKKAARIIKKTLASAVANATNN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
             +D D+L+VS   +     +KR   R   R   I +P + + V V E
Sbjct: 62  FKMDEDKLVVSTIMINDGPALKRIMPRAMGRADIIRKPTAHIVVAVSE 109


>gi|88608245|ref|YP_506162.1| ribosomal protein L22 [Neorickettsia sennetsu str. Miyayama]
 gi|123750029|sp|Q2GED4|RL22_NEOSM RecName: Full=50S ribosomal protein L22
 gi|88600414|gb|ABD45882.1| ribosomal protein L22 [Neorickettsia sennetsu str. Miyayama]
          Length = 113

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 43/98 (43%), Positives = 63/98 (64%)

Query: 24  LRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRL 83
           ++ S QK+NLVA MIRGK V  A + L F +K +A  + K L S+VANA+NN  +D D L
Sbjct: 8   MKSSVQKVNLVADMIRGKGVDVARSQLLFLKKALAKPLSKVLMSSVANAQNNFGVDPDNL 67

Query: 84  IVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
            V E +VGK + +KRF  R R R   I + +S +++++
Sbjct: 68  YVKEVFVGKGMSLKRFAARARGRSASIRKHYSNVSILL 105


>gi|89076319|ref|ZP_01162660.1| 50S ribosomal protein L22 [Photobacterium sp. SKA34]
 gi|90581683|ref|ZP_01237471.1| 50S ribosomal protein L22 [Vibrio angustum S14]
 gi|269104017|ref|ZP_06156714.1| LSU ribosomal protein L22p (L17e) [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|330447032|ref|ZP_08310682.1| ribosomal protein L22 [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|89048023|gb|EAR53612.1| 50S ribosomal protein L22 [Photobacterium sp. SKA34]
 gi|90437098|gb|EAS62301.1| 50S ribosomal protein L22 [Vibrio angustum S14]
 gi|268163915|gb|EEZ42411.1| LSU ribosomal protein L22p (L17e) [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|328491223|dbj|GAA05179.1| ribosomal protein L22 [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 110

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 65/106 (61%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A     R+SPQK  LVA  +RGK V+ AL  L FS K+ A  ++K L SA+ANAE+N
Sbjct: 2   EAIAKHRFARISPQKARLVADQLRGKPVAQALEILNFSNKKAADLIKKVLESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L V++ +V +   MKR   R + R  RI++  S +TV+V
Sbjct: 62  EGADIDDLNVAKIFVDEGPTMKRIMPRAKGRADRILKRSSHITVVV 107


>gi|146317736|ref|YP_001197448.1| 50S ribosomal protein L22 [Streptococcus suis 05ZYH33]
 gi|146319926|ref|YP_001199637.1| 50S ribosomal protein L22 [Streptococcus suis 98HAH33]
 gi|223933101|ref|ZP_03625094.1| ribosomal protein L22 [Streptococcus suis 89/1591]
 gi|253750992|ref|YP_003024133.1| 50S ribosomal protein L22 [Streptococcus suis SC84]
 gi|253752892|ref|YP_003026032.1| 50S ribosomal protein L22 [Streptococcus suis P1/7]
 gi|253754717|ref|YP_003027857.1| 50S ribosomal protein L22 [Streptococcus suis BM407]
 gi|302023167|ref|ZP_07248378.1| 50S ribosomal protein L22 [Streptococcus suis 05HAS68]
 gi|330831925|ref|YP_004400750.1| 50S ribosomal protein L22 [Streptococcus suis ST3]
 gi|166222003|sp|A4VYP8|RL22_STRS2 RecName: Full=50S ribosomal protein L22
 gi|166222005|sp|A4VSF9|RL22_STRSY RecName: Full=50S ribosomal protein L22
 gi|145688542|gb|ABP89048.1| Ribosomal protein L22 [Streptococcus suis 05ZYH33]
 gi|145690732|gb|ABP91237.1| Ribosomal protein L22 [Streptococcus suis 98HAH33]
 gi|223898288|gb|EEF64656.1| ribosomal protein L22 [Streptococcus suis 89/1591]
 gi|251815281|emb|CAZ50847.1| 50S ribosomal protein L22 [Streptococcus suis SC84]
 gi|251817181|emb|CAZ54903.1| 50S ribosomal protein L22 [Streptococcus suis BM407]
 gi|251819137|emb|CAR44232.1| 50S ribosomal protein L22 [Streptococcus suis P1/7]
 gi|292557536|gb|ADE30537.1| ribosomal protein L22 [Streptococcus suis GZ1]
 gi|319757246|gb|ADV69188.1| 50S ribosomal protein L22 [Streptococcus suis JS14]
 gi|329306148|gb|AEB80564.1| 50S ribosomal protein L22 [Streptococcus suis ST3]
          Length = 114

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 65/107 (60%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A A  +RVSP+K  LV   IRGK V+DA+A L+F+  + AG +   L SA+ANAENN 
Sbjct: 7   AKATARTVRVSPRKSRLVLDNIRGKSVADAIAILKFTPNKAAGIIEGVLNSAIANAENNF 66

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            L+   L+VSEA+  +   +KRF  R +     I +  + +TV+V E
Sbjct: 67  GLEKANLVVSEAFANEGPTLKRFRPRAKGSASPINKRTAHITVVVAE 113


>gi|215274930|sp|A4FPM0|RL22_SACEN RecName: Full=50S ribosomal protein L22
          Length = 139

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 48/105 (45%), Positives = 63/105 (60%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A A  +RV+P K   V  +I+G+  S+ALA L+F+ +  +G V K L SAVANAENN 
Sbjct: 16  AVARARFVRVTPMKARRVVELIKGRSASEALAVLQFAPQAASGPVSKVLASAVANAENNL 75

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
            LD D L V  AYV +   +KRF  R + R  RI +  S +TV V
Sbjct: 76  SLDPDTLWVHRAYVDEGPTLKRFRPRAQGRAYRIRKRTSHITVEV 120


>gi|283853158|ref|ZP_06370411.1| ribosomal protein L22 [Desulfovibrio sp. FW1012B]
 gi|283571416|gb|EFC19423.1| ribosomal protein L22 [Desulfovibrio sp. FW1012B]
          Length = 110

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 63/108 (58%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AIA  +RVSPQK  LVAA I G+ V +A+  L+F+ K+ A  + K L SAVANAE  
Sbjct: 2   EAKAIAKFIRVSPQKARLVAANILGRPVEEAMNILKFTPKKSAKIIGKVLHSAVANAEQI 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
             +D+D L V +  V      KR   R   R  RIV+  S +TV+V E
Sbjct: 62  SGVDIDNLTVKQVIVNPGPTWKRIMTRSMGRAFRIVKRTSHITVVVAE 109


>gi|307579468|gb|ADN63437.1| 50S ribosomal protein L22 [Xylella fastidiosa subsp. fastidiosa
           GB514]
          Length = 113

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 65/106 (61%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA+AI    RVSPQK  LVAA +RG     A+  L FS K+ A  ++K + SA+ANAENN
Sbjct: 4   EASAILRGARVSPQKARLVAAQVRGLSADSAVNLLRFSSKKAACLIKKVVESAIANAENN 63

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           H  ++D L ++   V +   +KRF  R + R  RIV+  S +TV+V
Sbjct: 64  HGSNIDDLRINTIIVDEGRMLKRFMARAKGRSSRIVKRSSHITVVV 109


>gi|257453266|ref|ZP_05618565.1| 50S ribosomal protein L22P [Fusobacterium sp. 3_1_5R]
 gi|257467139|ref|ZP_05631450.1| 50S ribosomal protein L22P [Fusobacterium gonidiaformans ATCC
           25563]
 gi|315918270|ref|ZP_07914510.1| LSU ribosomal protein L22P [Fusobacterium gonidiaformans ATCC
           25563]
 gi|317059800|ref|ZP_07924285.1| LSU ribosomal protein L22P [Fusobacterium sp. 3_1_5R]
 gi|313685476|gb|EFS22311.1| LSU ribosomal protein L22P [Fusobacterium sp. 3_1_5R]
 gi|313692145|gb|EFS28980.1| LSU ribosomal protein L22P [Fusobacterium gonidiaformans ATCC
           25563]
          Length = 110

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/108 (41%), Positives = 64/108 (59%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AI   +R+SP+K  LVA ++RGK    AL  LEF+ K+ A  ++KTL SA+ANA NN
Sbjct: 2   EARAITRYVRLSPRKARLVADLVRGKSALQALDILEFTNKKAARVIKKTLASAIANATNN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
             +D D+L+VS   + +   +KR   R   R   I +P + + V V E
Sbjct: 62  FKMDEDKLVVSTIMINEGPVLKRIMPRAMGRADIIRKPTAHIIVAVSE 109


>gi|28198358|ref|NP_778672.1| 50S ribosomal protein L22 [Xylella fastidiosa Temecula1]
 gi|182680999|ref|YP_001829159.1| 50S ribosomal protein L22 [Xylella fastidiosa M23]
 gi|51316820|sp|Q87E77|RL22_XYLFT RecName: Full=50S ribosomal protein L22
 gi|226734754|sp|B2I8H4|RL22_XYLF2 RecName: Full=50S ribosomal protein L22
 gi|28056428|gb|AAO28321.1| 50S ribosomal protein L22 [Xylella fastidiosa Temecula1]
 gi|182631109|gb|ACB91885.1| ribosomal protein L22 [Xylella fastidiosa M23]
          Length = 111

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 65/106 (61%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA+AI    RVSPQK  LVAA +RG     A+  L FS K+ A  ++K + SA+ANAENN
Sbjct: 2   EASAILRGARVSPQKARLVAAQVRGLSADSAVNLLRFSSKKAACLIKKVVESAIANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           H  ++D L ++   V +   +KRF  R + R  RIV+  S +TV+V
Sbjct: 62  HGSNIDDLRINTIIVDEGRMLKRFMARAKGRSSRIVKRSSHITVVV 107


>gi|71905966|ref|YP_283553.1| 50S ribosomal protein L22 [Dechloromonas aromatica RCB]
 gi|109893194|sp|Q47J98|RL22_DECAR RecName: Full=50S ribosomal protein L22
 gi|71845587|gb|AAZ45083.1| LSU ribosomal protein L22P [Dechloromonas aromatica RCB]
          Length = 109

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/98 (44%), Positives = 60/98 (61%)

Query: 24  LRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRL 83
           +R+S QK  LVA ++RGK V  AL  L F  K+ AG V+K L SA+ANAE+N   D+D L
Sbjct: 10  VRLSAQKGRLVADLVRGKPVGQALNILAFCPKKGAGIVKKVLESAIANAEHNDGADIDEL 69

Query: 84  IVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
            V   YV K + +KRF  R + R  RI++P   + + V
Sbjct: 70  TVKTIYVEKGMVLKRFTARAKGRGNRIIKPTCHIYLTV 107


>gi|71276488|ref|ZP_00652763.1| Ribosomal protein L22, bacterial and organelle form [Xylella
           fastidiosa Dixon]
 gi|170729705|ref|YP_001775138.1| 50S ribosomal protein L22 [Xylella fastidiosa M12]
 gi|226734755|sp|B0U5K4|RL22_XYLFM RecName: Full=50S ribosomal protein L22
 gi|71162665|gb|EAO12392.1| Ribosomal protein L22, bacterial and organelle form [Xylella
           fastidiosa Dixon]
 gi|167964498|gb|ACA11508.1| 50S ribosomal protein L22 [Xylella fastidiosa M12]
          Length = 113

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 64/106 (60%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AI    R+SPQK  LVAA +RG     A+  L FS K+ A  ++K + SA+ANAENN
Sbjct: 4   EATAILRGARISPQKARLVAAQVRGLSAESAVNLLRFSSKKAACLIKKVVESAIANAENN 63

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           H  ++D L ++   V +   +KRF  R + R  RIV+  S +TV+V
Sbjct: 64  HGSNIDDLKINTIIVDEGRMLKRFMARAKGRSSRIVKRSSHITVVV 109


>gi|296877858|ref|ZP_06901880.1| 50S ribosomal protein L22 [Clostridium difficile NAP07]
 gi|296431158|gb|EFH16983.1| 50S ribosomal protein L22 [Clostridium difficile NAP07]
          Length = 119

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 65/108 (60%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A  +RVSP+K   +  ++RGK V +ALA L+F+ +  A  + K + SA ANAENN
Sbjct: 10  EAKATAKYVRVSPRKAGQICDLVRGKNVDEALAILKFTPRGAASIIAKVVKSAKANAENN 69

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           H++D ++L ++     +   MKRF  R R R   I +  S + V+V+E
Sbjct: 70  HEMDTEKLYIASIVANQGPTMKRFMPRARGRATTIRKRTSHIEVVVKE 117


>gi|241888944|ref|ZP_04776248.1| ribosomal protein L22 [Gemella haemolysans ATCC 10379]
 gi|317496185|ref|ZP_07954545.1| ribosomal protein L22 [Gemella moribillum M424]
 gi|329768278|ref|ZP_08259779.1| 50S ribosomal protein L22 [Gemella haemolysans M341]
 gi|329770035|ref|ZP_08261430.1| 50S ribosomal protein L22 [Gemella sanguinis M325]
 gi|241864193|gb|EER68571.1| ribosomal protein L22 [Gemella haemolysans ATCC 10379]
 gi|316913760|gb|EFV35246.1| ribosomal protein L22 [Gemella moribillum M424]
 gi|328837346|gb|EGF86976.1| 50S ribosomal protein L22 [Gemella sanguinis M325]
 gi|328837477|gb|EGF87106.1| 50S ribosomal protein L22 [Gemella haemolysans M341]
          Length = 111

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 70/108 (64%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E+ AIA  +R++P+K+ LV  ++RGK+V +AL  LEF+ K  +  V K + SA ANAE+N
Sbjct: 2   ESKAIAKTVRIAPRKVRLVLDLVRGKKVGEALGILEFTTKSASLPVAKVIKSAAANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           + ++V+ L+VS+A+  +   +KRF  R +     I +  S +T+++ +
Sbjct: 62  YGMNVEDLVVSQAFANEGPTLKRFRPRAKGAASSINKRTSHITIVLSD 109


>gi|157690905|ref|YP_001485367.1| 50S ribosomal protein L22 [Bacillus pumilus SAFR-032]
 gi|166986969|sp|A8F990|RL22_BACP2 RecName: Full=50S ribosomal protein L22
 gi|157679663|gb|ABV60807.1| ribosomal protein L22 [Bacillus pumilus SAFR-032]
          Length = 113

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 70/108 (64%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A A+A  +R++P+K  LV  +IRGK+V +A++ L  + K  +  + K L SA+ANAE+N
Sbjct: 2   QAKAVARTVRIAPRKARLVMDLIRGKQVGEAVSILNLTPKAASPIIEKVLKSAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           ++LD + L++++A+V +   +KRF  R   R   I +  S +T++V E
Sbjct: 62  YELDANSLVITQAFVDEGPTLKRFRPRAMGRASAINKRTSHITIVVSE 109


>gi|71842319|ref|YP_277407.1| ribosomal protein L22 [Emiliania huxleyi]
 gi|109893071|sp|Q4G360|RK22_EMIHU RecName: Full=50S ribosomal protein L22, chloroplastic
 gi|60101562|gb|AAX13906.1| ribosomal protein L22 [Emiliania huxleyi]
          Length = 117

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 67/115 (58%)

Query: 7   VSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLC 66
           +SK  + +NE  A+A  +R+ P K+  V   I GK  S+AL  LEF   +    + K L 
Sbjct: 1   MSKTLLQENETMAVARYVRMGPNKVRRVLRQITGKSYSEALLLLEFLPYKSCDPIIKVLR 60

Query: 67  SAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           SAVANA+NN   D  +L++ +A+  +   MKRF  R + R  RI++P S +T++V
Sbjct: 61  SAVANAKNNLGYDTTKLVIKKAFADQGPVMKRFRPRAQGRAYRILKPTSHITIVV 115


>gi|116493158|ref|YP_804893.1| 50S ribosomal protein L22 [Pediococcus pentosaceus ATCC 25745]
 gi|122265378|sp|Q03EC1|RL22_PEDPA RecName: Full=50S ribosomal protein L22
 gi|116103308|gb|ABJ68451.1| LSU ribosomal protein L22P [Pediococcus pentosaceus ATCC 25745]
          Length = 118

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 67/107 (62%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A A  +R++ +K+ LV  +IRGK V++A A L+F+ +  +  V K L SAVANAENN 
Sbjct: 8   AQATAKTVRIAARKIRLVVDLIRGKSVAEAFAILKFTPRSASPVVEKVLKSAVANAENNF 67

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           DLD + L++S+ +V +   +KRF  R +     I +  S +TV+V E
Sbjct: 68  DLDREDLVISKVFVNEGPTLKRFRPRAKGSASPINKRTSHITVVVSE 114


>gi|262273374|ref|ZP_06051188.1| LSU ribosomal protein L22p (L17e) [Grimontia hollisae CIP 101886]
 gi|262222352|gb|EEY73663.1| LSU ribosomal protein L22p (L17e) [Grimontia hollisae CIP 101886]
          Length = 110

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 65/106 (61%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A     R+SPQK  LVA  +RGK V+ A+  L FS K+ A  ++K L SA+ANAE+N
Sbjct: 2   EAIAKHRFARISPQKARLVADQVRGKNVAQAIEILTFSDKKAATLIKKVLESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L V++ +V +   MKR   R + R  RI++  S +TV+V
Sbjct: 62  EGADIDDLSVAKIFVDEGPVMKRIMPRAKGRADRILKRSSHITVVV 107


>gi|291298715|ref|YP_003509993.1| 50S ribosomal protein L22 [Stackebrandtia nassauensis DSM 44728]
 gi|290567935|gb|ADD40900.1| ribosomal protein L22 [Stackebrandtia nassauensis DSM 44728]
          Length = 158

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 67/119 (56%), Gaps = 6/119 (5%)

Query: 12  MGDNEAN------AIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTL 65
           M  NEA       A+A  +RVSP K   V  ++RG    +AL  L+F+ +  +  V K +
Sbjct: 1   MASNEATLAPSARAVARYVRVSPMKARRVVNLVRGLPADEALTVLQFAPQAASEPVYKVI 60

Query: 66  CSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV 124
            SA+ANAENN  LD + L+VSEA+V +   MKR+  R   R  RI +  S +TV++  V
Sbjct: 61  ASAIANAENNEKLDRESLLVSEAFVDEGPTMKRYRPRAHGRAYRIRKRTSHITVVLESV 119


>gi|134103259|ref|YP_001108920.1| 50S ribosomal protein L22 [Saccharopolyspora erythraea NRRL 2338]
 gi|291007948|ref|ZP_06565921.1| ribosomal protein L22 [Saccharopolyspora erythraea NRRL 2338]
 gi|133915882|emb|CAM05995.1| 50S ribosomal protein L22 [Saccharopolyspora erythraea NRRL 2338]
          Length = 123

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 47/103 (45%), Positives = 62/103 (60%)

Query: 19  AIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDL 78
           A A  +RV+P K   V  +I+G+  S+ALA L+F+ +  +G V K L SAVANAENN  L
Sbjct: 2   ARARFVRVTPMKARRVVELIKGRSASEALAVLQFAPQAASGPVSKVLASAVANAENNLSL 61

Query: 79  DVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           D D L V  AYV +   +KRF  R + R  RI +  S +TV V
Sbjct: 62  DPDTLWVHRAYVDEGPTLKRFRPRAQGRAYRIRKRTSHITVEV 104


>gi|153869560|ref|ZP_01999134.1| Ribosomal protein L22 [Beggiatoa sp. PS]
 gi|152073946|gb|EDN70858.1| Ribosomal protein L22 [Beggiatoa sp. PS]
          Length = 109

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 52/111 (46%), Positives = 65/111 (58%), Gaps = 3/111 (2%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E ++     R+SPQK  LV   IRG  V  AL  L+FS++R A  VRK L SA+ANAENN
Sbjct: 2   EVSSQCKYARISPQKCRLVINQIRGLPVEKALNVLKFSQRRAALLVRKVLESAIANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
              DVD L VS  YV +   MKR   R + R  RI++  S +TV   +VSD
Sbjct: 62  EGADVDELKVSTIYVDEGPTMKRMRPRAKGRGSRILKRTSHITV---KVSD 109


>gi|296137301|ref|YP_003644543.1| ribosomal protein L22 [Thiomonas intermedia K12]
 gi|294341605|emb|CAZ90022.1| 50S ribosomal protein L22 [Thiomonas sp. 3As]
 gi|295797423|gb|ADG32213.1| ribosomal protein L22 [Thiomonas intermedia K12]
          Length = 109

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 64/106 (60%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A    +R+S QK  LVA +IRGK+V  AL  LEFS K+ +G ++K L SA+ANAE+N
Sbjct: 2   ETRATLRGVRLSAQKGRLVADLIRGKKVDSALNILEFSPKKASGIIKKVLESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              DVD L V++  V +   +KRF  R + R  RI +P   + + V
Sbjct: 62  DGADVDELKVTQIMVEEGATLKRFSARAKGRGNRISKPTCHIYIQV 107


>gi|307297389|ref|ZP_07577195.1| ribosomal protein L22 [Thermotogales bacterium mesG1.Ag.4.2]
 gi|306916649|gb|EFN47031.1| ribosomal protein L22 [Thermotogales bacterium mesG1.Ag.4.2]
          Length = 144

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 70/125 (56%), Gaps = 7/125 (5%)

Query: 4   KRSVSKRRMGD-------NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKR 56
           KRSV  R+  +       ++A A+A  +R+SP+K   V   IR K V +A   LEFS K+
Sbjct: 9   KRSVFHRKRKEEKAATPVSQAKAVAKFVRISPRKARSVVNAIRNKEVGEAFQILEFSPKK 68

Query: 57  IAGEVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSR 116
            +  V K L SAVANAENN  L+VD L V +A V     MKR   RGR R     + FS 
Sbjct: 69  ASRLVYKVLRSAVANAENNFGLNVDSLYVEKAVVDDGPRMKRLWPRGRGRADIQQKRFSH 128

Query: 117 LTVIV 121
           +TV+V
Sbjct: 129 ITVVV 133


>gi|257463966|ref|ZP_05628351.1| 50S ribosomal protein L22P [Fusobacterium sp. D12]
 gi|317061489|ref|ZP_07925974.1| LSU ribosomal protein L22P [Fusobacterium sp. D12]
 gi|313687165|gb|EFS24000.1| LSU ribosomal protein L22P [Fusobacterium sp. D12]
          Length = 110

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 45/108 (41%), Positives = 64/108 (59%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AI   +R+SP+K  LVA ++RGK    AL  LEF+ K+ A  ++KTL SA+ANA NN
Sbjct: 2   EARAITRYVRLSPRKARLVADLVRGKSALQALDILEFTNKKAARVIQKTLASAIANATNN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
             +D D+L+VS   + +   +KR   R   R   I +P + + V V E
Sbjct: 62  FKMDEDKLVVSTIMINEGPVLKRIMPRAMGRADIIRKPTAHIMVAVSE 109


>gi|54307546|ref|YP_128566.1| 50S ribosomal protein L22 [Photobacterium profundum SS9]
 gi|51316623|sp|Q6LVB1|RL22_PHOPR RecName: Full=50S ribosomal protein L22
 gi|46911966|emb|CAG18764.1| putative ribosomal protein L22 [Photobacterium profundum SS9]
          Length = 110

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 65/106 (61%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A     R+SPQK  LVA  +RGK V+ AL  L FS K+ A  ++K L SA+ANAE+N
Sbjct: 2   EAIAKHRFARISPQKARLVADQLRGKPVAQALEILNFSNKKAAELIKKVLESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L V++ +V +   MKR   R + R  RI++  S +TV+V
Sbjct: 62  EGADIDDLNVAKIFVDEGPTMKRIMPRAKGRADRILKRSSHITVVV 107


>gi|114319624|ref|YP_741307.1| 50S ribosomal protein L22P [Alkalilimnicola ehrlichii MLHE-1]
 gi|122312452|sp|Q0ABH0|RL22_ALHEH RecName: Full=50S ribosomal protein L22
 gi|114226018|gb|ABI55817.1| LSU ribosomal protein L22P [Alkalilimnicola ehrlichii MLHE-1]
          Length = 111

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 63/108 (58%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E +A     R+SPQK  LVA  +RG  V  AL  LEFS K+ A  VRK L SAVANAE+N
Sbjct: 2   ETSAKLKFSRLSPQKARLVADQVRGLPVEKALEILEFSPKKAAAIVRKVLDSAVANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
              D+D L V+  +V +   +KR   R + R  RI++  S +TV V E
Sbjct: 62  DGADIDALRVARIFVDEGPMLKRIRPRAKGRANRILKRTSHITVTVAE 109


>gi|81429372|ref|YP_396373.1| 50S ribosomal protein L22 [Lactobacillus sakei subsp. sakei 23K]
 gi|109893203|sp|Q38UR7|RL22_LACSS RecName: Full=50S ribosomal protein L22
 gi|78611015|emb|CAI56067.1| 50S ribosomal protein L22 [Lactobacillus sakei subsp. sakei 23K]
          Length = 117

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 71/114 (62%), Gaps = 2/114 (1%)

Query: 12  MGDNEANAIASML--RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           M D   +A AS +  R+  +K+ +V  +IRGK V++A+A LEF+ +  +  V K L SA+
Sbjct: 1   MADQITSATASAMSVRMPARKVRMVIDLIRGKSVAEAIAILEFTPRAASPVVIKVLKSAI 60

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           ANAE+N+DLD + L+V++AY  +   +KRF  R +     I +  S +TV+V E
Sbjct: 61  ANAEHNYDLDAENLVVTKAYANEGPTLKRFRPRAKGSASPINKRTSHITVVVSE 114


>gi|16077189|ref|NP_388002.1| 50S ribosomal protein L22 [Bacillus subtilis subsp. subtilis str.
           168]
 gi|154684639|ref|YP_001419800.1| 50S ribosomal protein L22 [Bacillus amyloliquefaciens FZB42]
 gi|221307933|ref|ZP_03589780.1| 50S ribosomal protein L22 [Bacillus subtilis subsp. subtilis str.
           168]
 gi|221312254|ref|ZP_03594059.1| 50S ribosomal protein L22 [Bacillus subtilis subsp. subtilis str.
           NCIB 3610]
 gi|221317188|ref|ZP_03598482.1| 50S ribosomal protein L22 [Bacillus subtilis subsp. subtilis str.
           JH642]
 gi|221321451|ref|ZP_03602745.1| 50S ribosomal protein L22 [Bacillus subtilis subsp. subtilis str.
           SMY]
 gi|308172012|ref|YP_003918717.1| 50S ribosomal protein L22 (BL17) [Bacillus amyloliquefaciens DSM 7]
 gi|321313792|ref|YP_004206079.1| 50S ribosomal protein L22 [Bacillus subtilis BSn5]
 gi|1172992|sp|P42060|RL22_BACSU RecName: Full=50S ribosomal protein L22
 gi|166220825|sp|A7Z0P3|RL22_BACA2 RecName: Full=50S ribosomal protein L22
 gi|786158|dbj|BAA08836.1| ribosomal protein L22 [Bacillus subtilis]
 gi|1165308|gb|AAC45961.1| L22 [Bacillus subtilis]
 gi|2632388|emb|CAB11897.1| ribosomal protein L22 (BL17) [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|154350490|gb|ABS72569.1| RplV [Bacillus amyloliquefaciens FZB42]
 gi|291482493|dbj|BAI83568.1| 50S ribosomal protein L22 [Bacillus subtilis subsp. natto BEST195]
 gi|307604876|emb|CBI41247.1| ribosomal protein L22 (BL17) [Bacillus amyloliquefaciens DSM 7]
 gi|320020066|gb|ADV95052.1| 50S ribosomal protein L22 [Bacillus subtilis BSn5]
 gi|328551822|gb|AEB22314.1| 50S ribosomal protein L22 [Bacillus amyloliquefaciens TA208]
          Length = 113

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 71/108 (65%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A A+A  +R++P+K  LV  +IRGK+V +A++ L  + +  +  + K L SA+ANAE+N
Sbjct: 2   QAKAVARTVRIAPRKARLVMDLIRGKQVGEAVSILNLTPRAASPIIEKVLKSAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           +++D + L++S+A+V +   +KRF  R   R  +I +  S +T++V E
Sbjct: 62  YEMDANNLVISQAFVDEGPTLKRFRPRAMGRASQINKRTSHITIVVSE 109


>gi|308047996|ref|YP_003911562.1| 50S ribosomal protein L22P [Ferrimonas balearica DSM 9799]
 gi|307630186|gb|ADN74488.1| LSU ribosomal protein L22P [Ferrimonas balearica DSM 9799]
          Length = 110

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 60/97 (61%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R SPQK  LVA  IRG  V  AL  L FS K+ A  V+K L SA+ANAE+N  LD+D L 
Sbjct: 11  RTSPQKARLVADQIRGLPVDRALDILAFSPKKAASLVKKVLESAIANAEHNEGLDIDDLK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           V++ YV +   MKR   R + R  RI++  S +TV+V
Sbjct: 71  VAKIYVDEGPTMKRIMPRAKGRADRILKRSSHITVVV 107


>gi|94266248|ref|ZP_01289955.1| Ribosomal protein L22 [delta proteobacterium MLMS-1]
 gi|93453174|gb|EAT03638.1| Ribosomal protein L22 [delta proteobacterium MLMS-1]
          Length = 112

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/108 (42%), Positives = 64/108 (59%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  +R+SPQK  LVA ++RGK+V  AL  L F  K+ A  +RK + SAVANA  N
Sbjct: 4   EAKALARNIRISPQKARLVADLVRGKQVETALNTLRFMPKKGARILRKVIESAVANASQN 63

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
             +DVD L V   ++     +KR       R GRI++  S +TV++ E
Sbjct: 64  EAIDVDSLYVKTIFIDGGPMLKRIRPMAMGRAGRILKRSSHITVVLDE 111


>gi|163859268|ref|YP_001633566.1| 50S ribosomal protein L22 [Bordetella petrii DSM 12804]
 gi|226733438|sp|A9IIZ3|RL22_BORPD RecName: Full=50S ribosomal protein L22
 gi|163262996|emb|CAP45299.1| 50S ribosomal protein L22 [Bordetella petrii]
          Length = 109

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 64/106 (60%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  AI   + +S QK  LVA +IRGK V+ AL  L FS K+ AG ++K + SA+ANAE+N
Sbjct: 2   ETTAIIRGVHISAQKTRLVADLIRGKSVAQALNILTFSPKKAAGILKKAVESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L ++  +V K+  MKRF  R + R  RI +    +TV V
Sbjct: 62  DGADIDELKITTIFVDKAQSMKRFSARAKGRGNRIEKQTCHITVKV 107


>gi|311070768|ref|YP_003975691.1| 50S ribosomal protein L22 [Bacillus atrophaeus 1942]
 gi|310871285|gb|ADP34760.1| 50S ribosomal protein L22 [Bacillus atrophaeus 1942]
          Length = 113

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 71/108 (65%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A A+A  +R++P+K  LV  +IRGK+V +A++ L  + +  +  + K L SA+ANAE+N
Sbjct: 2   QAKAVARTVRIAPRKARLVMDLIRGKQVGEAVSILNLTPRAASPIIEKVLKSAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           ++LD + L++++A+V +   +KRF  R   R  +I +  S +T++V E
Sbjct: 62  YELDANSLVITQAFVDEGPTLKRFRPRAMGRASQINKRTSHITIVVSE 109


>gi|257065028|ref|YP_003144700.1| LSU ribosomal protein L22P [Slackia heliotrinireducens DSM 20476]
 gi|256792681|gb|ACV23351.1| LSU ribosomal protein L22P [Slackia heliotrinireducens DSM 20476]
          Length = 113

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 61/106 (57%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A  +RVSP+K  +V   IRGK V+ A   L FS + I+  + K L SAVANA NN
Sbjct: 2   EAKATAKYVRVSPRKARIVLDQIRGKDVARAREILMFSERAISETILKVLDSAVANATNN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           HD+  + L+V   Y  +   MKRF  R +    RI +  S +TVIV
Sbjct: 62  HDMSANNLVVKTTYADEGPTMKRFTPRAKGSASRIRKRTSHITVIV 107


>gi|237736175|ref|ZP_04566656.1| LSU ribosomal protein L22P [Fusobacterium mortiferum ATCC 9817]
 gi|229421728|gb|EEO36775.1| LSU ribosomal protein L22P [Fusobacterium mortiferum ATCC 9817]
          Length = 110

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 45/108 (41%), Positives = 64/108 (59%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AI   +R+SP+K  LVA ++RGK   +AL  LEF+ K+ A  ++KTL SA+ANA NN
Sbjct: 2   EARAITRYVRMSPRKARLVADLVRGKSALEALDILEFTNKKAARLIKKTLASAIANATNN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
             +D D+L+VS   +     +KR   R   R   I +P + + V V E
Sbjct: 62  FKMDEDKLVVSTIMINDGPALKRIMPRAMGRADIIRKPTAHIVVAVSE 109


>gi|71902238|ref|ZP_00684245.1| Ribosomal protein L22, bacterial and organelle form [Xylella
           fastidiosa Ann-1]
 gi|71728012|gb|EAO30226.1| Ribosomal protein L22, bacterial and organelle form [Xylella
           fastidiosa Ann-1]
          Length = 113

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 64/106 (60%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AI    R+SPQK  LVAA +RG     A+  L FS K+ A  ++K + SA+ANAENN
Sbjct: 4   EATAILRGARISPQKARLVAAQVRGLSADSAVNLLRFSSKKAACLIKKVVESAIANAENN 63

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           H  ++D L ++   V +   +KRF  R + R  RIV+  S +TV+V
Sbjct: 64  HGSNIDDLRINTIIVDEGRMLKRFMARAKGRSSRIVKRSSHITVVV 109


>gi|218294759|ref|ZP_03495613.1| ribosomal protein L22 [Thermus aquaticus Y51MC23]
 gi|218244667|gb|EED11191.1| ribosomal protein L22 [Thermus aquaticus Y51MC23]
          Length = 113

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 47/108 (43%), Positives = 66/108 (61%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AIA  +R++P+K+ LV  +IRGK + +A A L ++ KR A  V K L SA ANA NN
Sbjct: 2   EAKAIARYVRIAPRKVRLVVDLIRGKSLEEARAILRYTNKRGAYHVAKVLESAAANAVNN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           HD+  DRL V  A+V +   +KR   R R R   + +  S +T+I+ E
Sbjct: 62  HDMLEDRLFVKAAFVDEGPALKRVLPRARGRADIVKKKTSHITIILGE 109


>gi|89100344|ref|ZP_01173209.1| 50S ribosomal protein L22 [Bacillus sp. NRRL B-14911]
 gi|89084965|gb|EAR64101.1| 50S ribosomal protein L22 [Bacillus sp. NRRL B-14911]
          Length = 113

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 70/108 (64%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A A+A  +R++P+K  LV  +IRGK+V +A+A L  + K  +  V K L SA+ANAE+N
Sbjct: 2   QAKAVARTVRIAPRKARLVVDLIRGKQVGEAVAILNHTPKAASPVVEKLLKSALANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           +++DV+ L+VS+ +V +   +KRF  R   R   I +  S +T+++ E
Sbjct: 62  YEMDVNNLVVSQVFVDEGPTLKRFRPRAMGRASAINKRTSHITIVLSE 109


>gi|291544465|emb|CBL17574.1| LSU ribosomal protein L22P [Ruminococcus sp. 18P13]
          Length = 111

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/108 (42%), Positives = 66/108 (61%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A     R++P+K+ +V  +IR K V  ALA LE + K  +  V K L SA+ANAENN
Sbjct: 2   EARAYLRNARIAPRKVQIVLDLIRNKPVDIALATLELTPKAASPMVAKLLKSAMANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           H+++ D L VSE +V     MKR   R + R  RI++  S +T++V+E
Sbjct: 62  HNMNKDDLYVSECFVCPGPIMKRVMPRAQGRAFRILKRTSHITLVVKE 109


>gi|115314176|ref|YP_762899.1| 50S ribosomal protein L22 [Francisella tularensis subsp. holarctica
           OSU18]
 gi|115129075|gb|ABI82262.1| ribosomal protein L22 [Francisella tularensis subsp. holarctica
           OSU18]
          Length = 116

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/112 (43%), Positives = 64/112 (57%)

Query: 12  MGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVAN 71
           +G  E  A     R+S QK  LVA  IRG  V  A+  L FS K+ A  ++  L SAVAN
Sbjct: 3   LGYMEVQAKLKFARISAQKCRLVADQIRGLPVEQAINLLTFSNKKAAVLIKGVLNSAVAN 62

Query: 72  AENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           AE+N  +DVD L+VS  +V +   MKRF  R + R  RI++  S +TV V E
Sbjct: 63  AEHNDGMDVDSLVVSTIFVDEGPTMKRFEARAKGRGNRILKRTSHITVKVAE 114


>gi|90962401|ref|YP_536317.1| 50S ribosomal protein L22 [Lactobacillus salivarius UCC118]
 gi|227891549|ref|ZP_04009354.1| 50S ribosomal protein L22 [Lactobacillus salivarius ATCC 11741]
 gi|301300223|ref|ZP_07206435.1| ribosomal protein L22 [Lactobacillus salivarius ACS-116-V-Col5a]
 gi|123269879|sp|Q1WS95|RL22_LACS1 RecName: Full=50S ribosomal protein L22
 gi|90821595|gb|ABE00234.1| LSU ribosomal protein L22P [Lactobacillus salivarius UCC118]
 gi|227866696|gb|EEJ74117.1| 50S ribosomal protein L22 [Lactobacillus salivarius ATCC 11741]
 gi|300852164|gb|EFK79836.1| ribosomal protein L22 [Lactobacillus salivarius ACS-116-V-Col5a]
          Length = 115

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/105 (43%), Positives = 64/105 (60%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A A  +R+  +K  LV  +IRGK V++A   L+F+ +  A  + K L SAVANAENN 
Sbjct: 8   AKATAKTVRIPARKARLVIDLIRGKSVAEAFGILKFTPRSGAYLIEKVLKSAVANAENNF 67

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           DLDV+ L VSEA+V +   +KRF  R +     I +  S +TV+V
Sbjct: 68  DLDVEDLYVSEAFVNEGPTLKRFRPRAKGSASPINKRTSHITVVV 112


>gi|160932196|ref|ZP_02079587.1| hypothetical protein CLOLEP_01031 [Clostridium leptum DSM 753]
 gi|156868798|gb|EDO62170.1| hypothetical protein CLOLEP_01031 [Clostridium leptum DSM 753]
          Length = 111

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 68/108 (62%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A     R+SP+K+++V  +IR K V  A+A L+ + K    ++ K L SA+ANAENN
Sbjct: 2   EARAYLKYARISPRKVSVVLDLIRNKPVDYAMAVLKHTPKAACEDLEKLLKSAIANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           H++DV RL V+E +V +   +KR   R + R  RI +  S +T++++E
Sbjct: 62  HNMDVSRLYVAECHVSQGPILKRIRPRAQGRAFRIDKKTSHVTLVLKE 109


>gi|24114593|ref|NP_709103.1| 50S ribosomal protein L22 [Shigella flexneri 2a str. 301]
 gi|30065384|ref|NP_839555.1| 50S ribosomal protein L22 [Shigella flexneri 2a str. 2457T]
 gi|110807163|ref|YP_690683.1| 50S ribosomal protein L22 [Shigella flexneri 5 str. 8401]
 gi|51316815|sp|Q83PY5|RL22_SHIFL RecName: Full=50S ribosomal protein L22
 gi|123146636|sp|Q0SZY7|RL22_SHIF8 RecName: Full=50S ribosomal protein L22
 gi|24053791|gb|AAN44810.1| 50S ribosomal subunit protein L22 [Shigella flexneri 2a str. 301]
 gi|30043646|gb|AAP19366.1| 50S ribosomal subunit protein L22 [Shigella flexneri 2a str. 2457T]
 gi|110616711|gb|ABF05378.1| 50S ribosomal subunit protein L22 [Shigella flexneri 5 str. 8401]
 gi|281602680|gb|ADA75664.1| 50S ribosomal protein L22 [Shigella flexneri 2002017]
 gi|313647375|gb|EFS11827.1| ribosomal protein L22 [Shigella flexneri 2a str. 2457T]
          Length = 110

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 65/99 (65%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R S QK+ LVA +IRGK+VS AL  L ++ K+ A +V+K L SA+ANAE+N   D+D L 
Sbjct: 11  RSSAQKVRLVADLIRGKKVSQALDILTYTNKKAAVQVKKVLESAIANAEHNDGADIDDLK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           V++ +V +   MKR   R + R  RI++  S +TV+V +
Sbjct: 71  VTKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSD 109


>gi|77918320|ref|YP_356135.1| 50S ribosomal protein L22 [Pelobacter carbinolicus DSM 2380]
 gi|109893216|sp|Q3A6P2|RL22_PELCD RecName: Full=50S ribosomal protein L22
 gi|77544403|gb|ABA87965.1| LSU ribosomal protein L22P [Pelobacter carbinolicus DSM 2380]
          Length = 110

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/108 (42%), Positives = 64/108 (59%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A    +R+SP+K  LV  M+RGK+V +AL  L FS ++ A  V + + SAVANAE  
Sbjct: 2   EAKAKLRYVRLSPRKTRLVVDMVRGKKVQEALNILRFSPQKAASIVYQLVGSAVANAEQK 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
              DVDRL +    V +   +KRF  R + R  RI +P S +TV++ E
Sbjct: 62  GVADVDRLFIESISVDQGPVLKRFMPRAQGRATRIRKPTSHITVVLNE 109


>gi|154249812|ref|YP_001410637.1| 50S ribosomal protein L22 [Fervidobacterium nodosum Rt17-B1]
 gi|215274859|sp|A7HM47|RL22_FERNB RecName: Full=50S ribosomal protein L22
 gi|154153748|gb|ABS60980.1| ribosomal protein L22 [Fervidobacterium nodosum Rt17-B1]
          Length = 147

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 64/115 (55%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  +R+SP+K   V   IRGK VS+A   LEFS K+ A  V   L SAVANA NN
Sbjct: 30  EARAVARFVRISPRKARSVINSIRGKNVSEAFNLLEFSSKKAARIVYNVLKSAVANATNN 89

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEGKV 130
             L  + L V+  YV     MKR   RGR R   I +  S +TVIVR+   E + 
Sbjct: 90  LGLSEENLYVAACYVNDGPRMKRVWPRGRGRADIIQKRMSHITVIVRDREKENET 144


>gi|295677927|ref|YP_003606451.1| ribosomal protein L22 [Burkholderia sp. CCGE1002]
 gi|295437770|gb|ADG16940.1| ribosomal protein L22 [Burkholderia sp. CCGE1002]
          Length = 109

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 61/106 (57%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  AI    R+S QK  LVA  IRG  V  AL  L FS K+ AG V+K + SA+ANAE+N
Sbjct: 2   EVKAIHRGARISAQKTRLVADQIRGLPVDKALNVLTFSPKKAAGIVKKVVLSAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L ++  YV K+  +KRF  R + R  RI +    +TV V
Sbjct: 62  EGADIDELKITSIYVDKAASLKRFTARAKGRGNRIEKQSCHITVTV 107


>gi|258513645|ref|YP_003189867.1| 50S ribosomal protein L22 [Desulfotomaculum acetoxidans DSM 771]
 gi|257777350|gb|ACV61244.1| ribosomal protein L22 [Desulfotomaculum acetoxidans DSM 771]
          Length = 113

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 45/108 (41%), Positives = 70/108 (64%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  +R++P+K+  V  +IRGK+V++ALA L++   R +  V K + SA ANAE+N
Sbjct: 2   EARAVAKYIRIAPRKVRQVVDLIRGKQVAEALAILKYIPNRGSVAVAKVVKSASANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           +D + D L V+EA+V +   +KRF+ R   R     R  S +T++VRE
Sbjct: 62  NDANKDNLYVAEAFVDQGPTLKRFNPRAMGRADLKRRKTSHITIVVRE 109


>gi|53803409|ref|YP_114783.1| 50S ribosomal protein L22 [Methylococcus capsulatus str. Bath]
 gi|81681360|sp|Q605B7|RL22_METCA RecName: Full=50S ribosomal protein L22
 gi|53757170|gb|AAU91461.1| ribosomal protein L22 [Methylococcus capsulatus str. Bath]
          Length = 110

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 61/99 (61%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R+SPQK  LVA  IRG  V+ AL  L FS K+ AG V+K L +A+ANAE+N   DVD L 
Sbjct: 11  RISPQKCRLVADQIRGLNVAAALDLLTFSNKKAAGLVKKVLQAAIANAEHNEGADVDELR 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           V   +V +   +KR   R + R  RI++  S +TV+V +
Sbjct: 71  VKTVFVDEGPVLKRMSPRAKGRANRILKRTSHITVLVSD 109


>gi|167854926|ref|ZP_02477702.1| 50S ribosomal protein L22 [Haemophilus parasuis 29755]
 gi|219871735|ref|YP_002476110.1| 50S ribosomal protein L22 [Haemophilus parasuis SH0165]
 gi|223041822|ref|ZP_03612012.1| 50S ribosomal protein L22 [Actinobacillus minor 202]
 gi|240947879|ref|ZP_04752319.1| 50S ribosomal protein L22 [Actinobacillus minor NM305]
 gi|254800440|sp|B8F760|RL22_HAEPS RecName: Full=50S ribosomal protein L22
 gi|167853993|gb|EDS25231.1| 50S ribosomal protein L22 [Haemophilus parasuis 29755]
 gi|219691939|gb|ACL33162.1| 50S ribosomal protein L22 [Haemophilus parasuis SH0165]
 gi|223017391|gb|EEF15812.1| 50S ribosomal protein L22 [Actinobacillus minor 202]
 gi|240297841|gb|EER48277.1| 50S ribosomal protein L22 [Actinobacillus minor NM305]
          Length = 110

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 63/99 (63%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R S QK  LVA +IRGK+VS AL  L F+ K+ A  V+K L SA+ANAE+N   DVD L 
Sbjct: 11  RTSAQKARLVADLIRGKKVSAALEILTFTNKKAAALVKKVLESAIANAEHNDGADVDDLK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           V++ +V +   MKR   R + R  RI++  S +TV+V +
Sbjct: 71  VAKIFVDEGPSMKRVMPRAKGRADRILKRTSHITVVVSD 109


>gi|169823857|ref|YP_001691468.1| 50S ribosomal protein L22 [Finegoldia magna ATCC 29328]
 gi|297588196|ref|ZP_06946840.1| 50S ribosomal protein L22 [Finegoldia magna ATCC 53516]
 gi|302379833|ref|ZP_07268317.1| ribosomal protein L22 [Finegoldia magna ACS-171-V-Col3]
 gi|303234787|ref|ZP_07321413.1| ribosomal protein L22 [Finegoldia magna BVS033A4]
 gi|226733467|sp|B0RZU5|RL22_FINM2 RecName: Full=50S ribosomal protein L22
 gi|167830662|dbj|BAG07578.1| 50S ribosomal protein L22 [Finegoldia magna ATCC 29328]
 gi|297574885|gb|EFH93605.1| 50S ribosomal protein L22 [Finegoldia magna ATCC 53516]
 gi|302312421|gb|EFK94418.1| ribosomal protein L22 [Finegoldia magna ACS-171-V-Col3]
 gi|302494128|gb|EFL53908.1| ribosomal protein L22 [Finegoldia magna BVS033A4]
          Length = 112

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/108 (40%), Positives = 68/108 (62%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A AIA  +R+SP K+N +   IRGK+V +ALA L+F+ K+ A  + K L SA+ANAE+N
Sbjct: 2   QAKAIAKYVRISPLKVNFICKEIRGKQVDEALAILKFTPKKGARILEKVLNSAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
             L+ + L VS+AY   +  MKR+  + +     I++  S + V+V E
Sbjct: 62  FGLNREDLFVSQAYANNAPVMKRWRPKAKGMAYPILKRSSHVGVVVEE 109


>gi|270291128|ref|ZP_06197351.1| 50S ribosomal protein L22 [Pediococcus acidilactici 7_4]
 gi|304385409|ref|ZP_07367754.1| 50S ribosomal protein L22 [Pediococcus acidilactici DSM 20284]
 gi|270280524|gb|EFA26359.1| 50S ribosomal protein L22 [Pediococcus acidilactici 7_4]
 gi|304328616|gb|EFL95837.1| 50S ribosomal protein L22 [Pediococcus acidilactici DSM 20284]
          Length = 115

 Score = 78.6 bits (192), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 67/107 (62%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A A  +R++ +K+ LV  +IRGK V++A A L+F+ +  +  V K L SAVANAENN 
Sbjct: 8   AQATAKTVRIAARKVRLVVDLIRGKSVAEAFAILKFTPRSASPIVEKVLKSAVANAENNF 67

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           DLD + L++S+ +V +   +KRF  R +     I +  S +TV+V E
Sbjct: 68  DLDREDLVISKVFVNEGPTLKRFRPRAKGSASPINKRTSHITVVVSE 114


>gi|283768457|ref|ZP_06341369.1| ribosomal protein L22 [Bulleidia extructa W1219]
 gi|283104849|gb|EFC06221.1| ribosomal protein L22 [Bulleidia extructa W1219]
          Length = 111

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 62/104 (59%)

Query: 21  ASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDV 80
           A  +R +P+K+ LV  ++RGK V +ALA L+F     A  V K + SA ANA +NH L+ 
Sbjct: 7   AKTVRYTPRKVRLVLDLVRGKSVEEALAILQFMPNHAATAVAKVVKSAAANATHNHQLNA 66

Query: 81  DRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV 124
           + L V E Y  + V MKRF  R +    +I++  S +TV+V +V
Sbjct: 67  EALYVKECYANEGVVMKRFMPRAKGNAAQILKRTSHITVVVSDV 110


>gi|254483417|ref|ZP_05096646.1| ribosomal protein L22 [marine gamma proteobacterium HTCC2148]
 gi|214036291|gb|EEB76969.1| ribosomal protein L22 [marine gamma proteobacterium HTCC2148]
          Length = 112

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 60/97 (61%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           ++S QK  LVA  +RGK V +AL  LEFS K+ A  V+K L SA+ANAENN   DVD L 
Sbjct: 11  QISAQKARLVADQVRGKPVEEALILLEFSNKKAAHLVKKVLDSAIANAENNEGADVDELK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           VS  +V + + MKR   R + R  RI++    +TV V
Sbjct: 71  VSTVFVDEGMTMKRLRPRAKGRADRILKRSCHITVKV 107


>gi|325267184|ref|ZP_08133851.1| 50S ribosomal protein L22 [Kingella denitrificans ATCC 33394]
 gi|324981347|gb|EGC16992.1| 50S ribosomal protein L22 [Kingella denitrificans ATCC 33394]
          Length = 109

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 60/97 (61%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R+S QK  LVA MIRGK V+ AL  L FS K+ A  ++K L SA+ANAE+N+  D+D L 
Sbjct: 11  RISAQKARLVADMIRGKDVAQALNILTFSPKKGAELIKKVLESAIANAEHNNGADIDELK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           V   YV K+  +KRF  R + R  RI +    + V+V
Sbjct: 71  VVTIYVDKAASLKRFQARAKGRGNRIEKQTCHINVVV 107


>gi|46199625|ref|YP_005292.1| 50S ribosomal protein L22 [Thermus thermophilus HB27]
 gi|55981656|ref|YP_144953.1| 50S ribosomal protein L22 [Thermus thermophilus HB8]
 gi|1350696|sp|P48286|RL22_THETH RecName: Full=50S ribosomal protein L22
 gi|51316685|sp|Q72I09|RL22_THET2 RecName: Full=50S ribosomal protein L22
 gi|62287398|sp|Q5SHP3|RL22_THET8 RecName: Full=50S ribosomal protein L22
 gi|2120600|pir||S66512 ribosomal protein L22 - Thermus aquaticus
 gi|14278049|pdb|1GIY|S Chain S, Crystal Structure Of The Ribosome At 5.5 A Resolution.
           This File, 1giy, Contains The 50s Ribosome Subunit. The
           30s Ribosome Subunit, Three Trna, And Mrna Molecules Are
           In The File 1gix
 gi|28373735|pdb|1ML5|SS Chain s, Structure Of The E. Coli Ribosomal Termination Complex
           With Release Factor 2
 gi|66361035|pdb|1YL3|S Chain S, Crystal Structure Of 70s Ribosome With Thrs Operator And
           Trnas. Large Subunit. The Coordinates For The Small
           Subunit Are In The Pdb Entry 1yl4.
 gi|88192272|pdb|2B66|W Chain W, 50s Ribosomal Subunit From A Crystal Structure Of Release
           Factor Rf1, Trnas And Mrna Bound To The Ribosome. This
           File Contains The 50s Subunit From A Crystal Structure
           Of Release Factor Rf1, Trnas And Mrna Bound To The
           Ribosome And Is Described In Remark 400
 gi|88192335|pdb|2B9N|W Chain W, 50s Ribosomal Subunit From A Crystal Structure Of Release
           Factor Rf2, Trnas And Mrna Bound To The Ribosome. This
           File Contains The 50s Subunit From A Crystal Structure
           Of Release Factor Rf1, Trnas And Mrna Bound To The
           Ribosome And Is Described In Remark 400.
 gi|88192390|pdb|2B9P|W Chain W, 50s Ribosomal Subunit From A Crystal Structure Of The
           Ribosome In Complex With Trnas And Mrna With A Stop
           Codon In The A-Site. This File Contains The 50s Subunit
           From A Crystal Structure Of The Ribosome In Complex With
           Trnas And Mrna With A Stop Codon In The A-Site And Is
           Described In Remark 400.
 gi|116668254|pdb|2J01|W Chain W, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Mrna, Trna And Paromomycin (Part 2 Of 4).
           This File Contains The 50s Subunit From Molecule I.
 gi|116668315|pdb|2J03|W Chain W, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Mrna, Trna And Paromomycin (Part 4 Of 4).
           This File Contains The 50s Subunit From Molecule Ii.
 gi|119389752|pdb|2HGJ|V Chain V, Crystal Structure Of The 70s Thermus Thermophilus Ribosome
           Showing How The 16s 3'-End Mimicks Mrna E And P Codons.
           This Entry 2hgj Contains 50s Ribosomal Subunit. The 30s
           Ribosomal Subunit Can Be Found In Pdb Entry 2hgi.
 gi|119389809|pdb|2HGQ|V Chain V, Crystal Structure Of The 70s Thermus Thermophilus Ribosome
           With Translocated And Rotated Shine-Dalgarno Duplex.
           This Entry 2hgq Contains 50s Ribosomal Subunit. The 30s
           Ribosomal Subunit Can Be Found In Pdb Entry 2hgp.
 gi|119389865|pdb|2HGU|V Chain V, 70s T.Th. Ribosome Functional Complex With Mrna And E- And
           P-Site Trnas At 4.5a. This Entry 2hgu Contains 50s
           Ribosomal Subunit. The 30s Ribosomal Subunit Can Be
           Found In Pdb Entry 2hgr.
 gi|149240902|pdb|1VSA|Q Chain Q, Crystal Structure Of A 70s Ribosome-Trna Complex Reveals
           Functional Interactions And Rearrangements. This File,
           1vsa, Contains The 50s Ribosome Subunit. 30s Ribosome
           Subunit Is In The File 2ow8
 gi|157836537|pdb|2V47|W Chain W, Structure Of The Ribosome Recycling Factor Bound To The
           Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe And
           Trna-Fmet (Part 2 Of 4). This File Contains The 50s
           Subunit For Molecule 1.
 gi|157836593|pdb|2V49|W Chain W, Structure Of The Ribosome Recycling Factor Bound To The
           Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe And
           Trna-Fmet (Part 4 Of 4). This File Contains The 50s
           Subunit Of Molecule 2.
 gi|160285444|pdb|1VSP|Q Chain Q, Interactions And Dynamics Of The Shine-Dalgarno Helix In
           The 70s Ribosome. This File, 1vsp, Contains The 50s
           Ribosome Subunit. 30s Ribosome Subunit Is In The File
           2qnh
 gi|209156536|pdb|3D5B|W Chain W, Structural Basis For Translation Termination On The 70s
           Ribosome. This File Contains The 50s Subunit Of One 70s
           Ribosome. The Entire Crystal Structure Contains Two 70s
           Ribosomes As Described In Remark 400.
 gi|209156590|pdb|3D5D|W Chain W, Structural Basis For Translation Termination On The 70s
           Ribosome. This File Contains The 50s Subunit Of The
           Second 70s Ribosome. The Entire Crystal Structure
           Contains Two 70s Ribosomes As Described In Remark 400.
 gi|211938873|pdb|2JL6|W Chain W, Insights Into Translational Termination From The Structure
           Of Rf2 Bound To The Ribosome (Part 2 Of 4). This File
           Contains The 50s Subunit.
 gi|211938931|pdb|2JL8|W Chain W, Insights Into Translational Termination From The Structure
           Of Rf2 Bound To The Ribosome (Part 4 Of 4). This File
           Contains The 50s Subunit.
 gi|218766813|pdb|3F1F|W Chain W, Crystal Structure Of A Translation Termination Complex
           Formed With Release Factor Rf2. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes As Described In
           Remark 400.
 gi|218766869|pdb|3F1H|W Chain W, Crystal Structure Of A Translation Termination Complex
           Formed With Release Factor Rf2. This File Contains The
           50s Subunit Of The Second 70s Ribosome. The Entire
           Crystal Structure Contains Two 70s Ribosomes As
           Described In Remark 400.
 gi|224510798|pdb|3FIN|W Chain W, T. Thermophilus 70s Ribosome In Complex With Mrna, Trnas
           And Ef-Tu.Gdp.Kirromycin Ternary Complex, Fitted To A
           6.4 A Cryo-Em Map. This File Contains The 50s Subunit.
 gi|226887452|pdb|2WDI|W Chain W, Structure Of The Thermus Thermophilus 70s Ribosome In
           Complex With Mrna, Paromomycin, Acylated A-Site Trna,
           Deacylated P-Site Trna, And E-Site Trna. This File
           Contains The 50s Subunit For Molecule I.
 gi|226887484|pdb|2WDJ|W Chain W, Structure Of The Thermus Thermophilus 70s Ribosome In
           Complex With Mrna, Paromomycin, Acylated A-Site Trna,
           Deacylated P-Site Trna, And E-Site Trna. This File
           Contains The 50s Subunit For Molecule Ii.
 gi|226887541|pdb|2WDL|W Chain W, Structure Of The Thermus Thermophilus 70s Ribosome In
           Complex With Mrna, Paromomycin, Acylated A- And P-Site
           Trnas, And E-Site Trna.  This File Contains The 50s
           Subunit For Molecule I.
 gi|226887598|pdb|2WDN|W Chain W, Structure Of The Thermus Thermophilus 70s Ribosome In
           Complex With Mrna, Paromomycin, Acylated A- And P-Site
           Trnas, And E-Site Trna.  This File Contains The 50s
           Subunit For Molecule Ii.
 gi|237823584|pdb|2WH2|W Chain W, Insights Into Translational Termination From The Structure
           Of Rf2 Bound To The Ribosome
 gi|237823643|pdb|2WH4|W Chain W, Insights Into Translational Termination From The Structure
           Of Rf2 Bound To The Ribosome
 gi|260100028|pdb|3HUX|W Chain W, Structure Of Ef-P Bound To The 70s Ribosome; This File
           Contains The 50s Subunit For Molecule I.
 gi|260100084|pdb|3HUZ|W Chain W, Structure Of Ef-P Bound To The 70s Ribosome; This File
           Contains The 50s Subunit For Molecule Ii.
 gi|261824542|pdb|2WRJ|W Chain W, The Structure Of The Ribosome With Elongation Factor G
           Trapped In The Post-Translocational State (Part 2 Of 4).
 gi|261824604|pdb|2WRL|W Chain W, The Structure Of The Ribosome With Elongation Factor G
           Trapped In The Post-Translocational State. (Part 4 Of
           4).
 gi|261824663|pdb|2WRO|W Chain W, The Crystal Structure Of The 70s Ribosome Bound To Ef-Tu
           And Trna (Part 2 Of 4).
 gi|261824722|pdb|2WRR|W Chain W, The Crystal Structure Of The 70s Ribosome Bound To Ef-Tu
           And Trna (Part 4 Of 4).
 gi|281307210|pdb|3KIR|W Chain W, Structure Of Rele Nuclease Bound To The 70s Ribosome
           (Precleavage State; Part 2 Of 4)
 gi|281307268|pdb|3KIT|W Chain W, Structure Of Rele Nuclease Bound To The 70s Ribosome
           (Precleavage State; Part 4 Of 4)
 gi|281307326|pdb|3KIW|W Chain W, Structure Of Rele Nuclease Bound To The 70s Ribosome
           (Postcleavage State; Part 2 Of 4)
 gi|281307384|pdb|3KIY|W Chain W, Structure Of Rele Nuclease Bound To The 70s Ribosome
           (Postcleavage State; Part 4 Of 4)
 gi|288965647|pdb|3KNI|W Chain W, The Structures Of Viomycin Bound To The 70s Ribosome. This
           File Contains The 50s Subunit For Molecule I
 gi|288965679|pdb|3KNK|W Chain W, The Structures Of Viomycin Bound To The 70s Ribosome. This
           File Contains The 50s Subunit For Molecule Ii.
 gi|288965711|pdb|3KNM|W Chain W, The Structures Of Capreomycin Bound To The 70s Ribosome.
           Thi Contains The 50s Subunit For Molecule I.
 gi|288965743|pdb|3KNO|W Chain W, The Structures Of Capreomycin Bound To The 70s Ribosome.
           Thi Contains The 50s Subunit For Molecule Ii
 gi|294979491|pdb|3I8F|S Chain S, Elongation Complex Of The 70s Ribosome With Three Trnas
           And Entry 3i8f Contains 50s Ribosomal Subunit. The 30s
           Ribosoma Can Be Found In Pdb Entry 3i8g. Molecule B In
           The Same Asym Unit Is Deposited As 3i8g (30s) And 3i8f
           (50s).
 gi|294979575|pdb|3I8I|S Chain S, Elongation Complex Of The 70s Ribosome With Three Trnas
           And Entry 3i8i Contains 50s Ribosomal Subnit. The 30s
           Ribosomal Can Be Found In Pdb Entry 3i8h. Molecule A In
           The Same Asym Unit Is Deposited As 3i8f (50s) And 3i8g
           (30s).
 gi|294979629|pdb|3I9C|S Chain S, Initiation Complex Of 70s Ribosome With Two Trnas And
           Mrna. 3i9c Contains 50s Ribosomal Subunit Of Molecule B.
           The 30s Subunit Can Be Found In Pdb Entry 3i9b. Molecule
           A In The S Asymmetric Unit Is Deposited As 3i9d (30s)
           And 3i9e (50s)
 gi|294979683|pdb|3I9E|S Chain S, Initiation Complex Of 70s Ribosome With Two Trnas And
           Mrna. 3i9e Contains 50s Ribosomal Subunit Of Molecule A.
           The 30s Subunit Can Be Found In Pdb Entry 3i9d. Molecule
           B In The S Asymmetric Unit Is Deposited As 3i9b (30s)
           And 3i9c (50s)
 gi|295982130|pdb|2X9S|W Chain W, Structure Of The 70s Ribosome Bound To Release Factor 2
           And A Substrate Analog Provides Insights Into Catalysis
           Of Peptide Release
 gi|295982189|pdb|2X9U|W Chain W, Structure Of The 70s Ribosome Bound To Release Factor 2
           And A Substrate Analog Provides Insights Into Catalysis
           Of Peptide Release
 gi|307568016|pdb|2XG0|W Chain W, Structure Of Cytotoxic Domain Of Colicin E3 Bound To The
           70s Ribosome (Part 2 Of 4)
 gi|307568074|pdb|2XG2|W Chain W, Structure Of Cytotoxic Domain Of Colicin E3 Bound To The
           70s Ribosome (Part 4 Of 4)
 gi|309320303|pdb|3OH5|W Chain W, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Chloramphenicol. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 gi|309320333|pdb|3OH7|W Chain W, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Chloramphenicol. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 gi|309320405|pdb|3OHJ|W Chain W, Structure Of The Thermus Thermophilus Ribosome Complexed
           With Erythromycin. This File Contains The 50s Subunit Of
           One 70s Ribosome. The Entire Crystal Structure Contains
           Two 70s Ribosomes.
 gi|309320435|pdb|3OHK|W Chain W, Structure Of The Thermus Thermophilus Ribosome Complexed
           With Erythromycin. This File Contains The 50s Subunit Of
           One 70s Ribosome. The Entire Crystal Structure Contains
           Two 70s Ribosomes.
 gi|309320486|pdb|3OHZ|W Chain W, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Azithromycin. This File Contains The 50s
           Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 gi|309320537|pdb|3OI1|W Chain W, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Azithromycin. This File Contains The 50s
           Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 gi|309320588|pdb|3OI3|W Chain W, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Telithromycin. This File Contains The 50s
           Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 gi|309320639|pdb|3OI5|W Chain W, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Telithromycin. This File Contains The 50s
           Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 gi|312207728|pdb|2XQE|W Chain W, The Structure Of Ef-Tu And Aminoacyl-Trna Bound To The 70s
           Ribosome With A Gtp Analog
 gi|313754052|pdb|2XTG|W Chain W, Trna Tranlocation On The 70s Ribosome: The        Pre-
           Translocational Translocation Intermediate Ti(Pre)
 gi|313754110|pdb|2XUX|W Chain W, Trna Tranlocation On The 70s Ribosome: The Post-
           Translocational Translocation Intermediate Ti(Post)
 gi|325533457|pdb|2Y0V|W Chain W, The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bound To A
           Near-Cognate Codon On The 70s Ribosome
 gi|325533516|pdb|2Y0X|W Chain W, The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bound To A
           Near-Cognate Codon On The 70s Ribosome
 gi|325533575|pdb|2Y0Z|W Chain W, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound To
           A Near-Cognate Codon On The 70s Ribosome
 gi|325533634|pdb|2Y11|W Chain W, The Crystal Structure Of Ef-Tu And Trp-Trna-Trp Bound To A
           Cognate Codon On The 70s Ribosome.
 gi|325533693|pdb|2Y13|W Chain W, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound To
           A Near-Cognate Codon On The 70s Ribosome
 gi|325533752|pdb|2Y15|W Chain W, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound To
           A Cognate Codon On The 70s Ribosome.
 gi|325533811|pdb|2Y17|W Chain W, Ef-Tu Complex 3
 gi|325533870|pdb|2Y19|W Chain W, The Crystal Structure Of Ef-Tu And Trp-Trna-Trp Bound To A
           Cognate Codon On The 70s Ribosome.
 gi|1001933|emb|CAA59196.1| ribosomal protein L22 [Thermus thermophilus]
 gi|46197251|gb|AAS81665.1| LSU ribosomal protein L22P [Thermus thermophilus HB27]
 gi|55773069|dbj|BAD71510.1| 50S ribosomal protein L22 [Thermus thermophilus HB8]
 gi|1582219|prf||2118246A ribosomal protein L22
          Length = 113

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 65/108 (60%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AIA  +R+SP+K+ LV  +IRGK + +A   L ++ KR A  V K L SA ANA NN
Sbjct: 2   EAKAIARYVRISPRKVRLVVDLIRGKSLEEARNILRYTNKRGAYFVAKVLESAAANAVNN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           HD+  DRL V  AYV +   +KR   R R R   I +  S +TVI+ E
Sbjct: 62  HDMLEDRLYVKAAYVDEGPALKRVLPRARGRADIIKKRTSHITVILGE 109


>gi|269925836|ref|YP_003322459.1| ribosomal protein L22 [Thermobaculum terrenum ATCC BAA-798]
 gi|269789496|gb|ACZ41637.1| ribosomal protein L22 [Thermobaculum terrenum ATCC BAA-798]
          Length = 110

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 45/103 (43%), Positives = 61/103 (59%)

Query: 19  AIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDL 78
           A    +R SP+K  LVA +IRGK V +ALA L ++ K +A +  K L SA+ANAENN++L
Sbjct: 5   ATTRYVRTSPRKARLVADVIRGKSVGEALAILRYTNKAVARDFDKLLRSAIANAENNYEL 64

Query: 79  DVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           D D L V+E Y       KR+    R R    V+  S LTV++
Sbjct: 65  DADTLYVAEVYADDGPRFKRWRPASRGRAHPYVKRTSHLTVVL 107


>gi|300508647|pdb|3MRZ|S Chain S, Recognition Of The Amber Stop Codon By Release Factor Rf1.
           This Entry 3mrz Contains 50s Ribosomal Subunit. The 30s
           Ribosomal Subunit Can Be Found In Pdb Entry 3ms0.
           Molecule A In The Same Asymmetric Unit Is Deposited As
           3mr8 (50s) And 3ms1 (30s).
 gi|300508702|pdb|3MS1|S Chain S, Recognition Of The Amber Stop Codon By Release Factor Rf1.
           This Entry 3ms1 Contains 50s Ribosomal Subunit. The 30s
           Ribosomal Subunit Can Be Found In Pdb Entry 3mr8.
           Molecule B In The Same Asymmetric Unit Is Deposited As
           3mrz (50s) And 3ms0 (30s).
 gi|322812590|pdb|3PYO|S Chain S, Crystal Structure Of A Complex Containing Domain 3 From
           The Psiv Igr Ires Rna Bound To The 70s Ribosome. This
           File Contains The 50s Subunit Of The First 70s Ribosome.
 gi|322812643|pdb|3PYR|S Chain S, Crystal Structure Of A Complex Containing Domain 3 From
           The Psiv Igr Ires Rna Bound To The 70s Ribosome. This
           File Contains The 50s Subunit Of The Second 70s
           Ribosome.
 gi|322812696|pdb|3PYT|S Chain S, Crystal Structure Of A Complex Containing Domain 3 Of Crpv
           Igr Ires Rna Bound To The 70s Ribosome. This File
           Contains The 50s Subunit Of The First 70s Ribosome.
 gi|322812749|pdb|3PYV|S Chain S, Crystal Structure Of A Complex Containing Domain 3 Of Crpv
           Igr Ires Rna Bound To The 70s Ribosome. This File
           Contains The 50s Subunit Of The Second 70s Ribosome
          Length = 112

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 65/108 (60%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AIA  +R+SP+K+ LV  +IRGK + +A   L ++ KR A  V K L SA ANA NN
Sbjct: 2   EAKAIARYVRISPRKVRLVVDLIRGKSLEEARNILRYTNKRGAYFVAKVLESAAANAVNN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           HD+  DRL V  AYV +   +KR   R R R   I +  S +TVI+ E
Sbjct: 62  HDMLEDRLYVKAAYVDEGPALKRVLPRARGRADIIKKRTSHITVILGE 109


>gi|288942067|ref|YP_003444307.1| 50S ribosomal protein L22 [Allochromatium vinosum DSM 180]
 gi|288897439|gb|ADC63275.1| ribosomal protein L22 [Allochromatium vinosum DSM 180]
          Length = 110

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 47/108 (43%), Positives = 64/108 (59%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A A     R+S QK  LVA +IRGKRV +AL  L FS K+ A  ++K L SA+ANAE+N
Sbjct: 2   QAVATHKYARISAQKARLVADLIRGKRVEEALNTLSFSPKKGADIIKKVLESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
              D+D L V+   V +   MKR   R + R  RI++  S +T+ V E
Sbjct: 62  EGADIDELKVAAIQVNEGPTMKRIMPRAKGRANRIMKRTSHITLTVAE 109


>gi|254875931|ref|ZP_05248641.1| 50S ribosomal protein L22 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254841952|gb|EET20366.1| 50S ribosomal protein L22 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
          Length = 116

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 64/113 (56%)

Query: 11  RMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVA 70
           R+G  E  A     ++S QK  LVA  IRG  V  A+  L FS K+ A  ++  L SA+A
Sbjct: 2   RLGYMEVQAKLKFAKISAQKCRLVADQIRGLPVEKAINLLTFSNKKAAVLIKDVLNSAIA 61

Query: 71  NAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           NAE+N  +DVD L VS  +V +   MKRF  R + R  RI++  S +TV V E
Sbjct: 62  NAEHNDGMDVDSLFVSTVFVDEGPTMKRFEARAKGRGNRILKRTSHITVKVAE 114


>gi|62257620|gb|AAX77727.1| unknown protein [synthetic construct]
          Length = 151

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 49/112 (43%), Positives = 64/112 (57%)

Query: 12  MGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVAN 71
           +G  E  A     R+S QK  LVA  IRG  V  A+  L FS K+ A  ++  L SAVAN
Sbjct: 29  LGYMEVQAKLKFARISAQKCRLVADQIRGLPVEQAINLLTFSNKKAAVLIKGVLNSAVAN 88

Query: 72  AENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           AE+N  +DVD L+VS  +V +   MKRF  R + R  RI++  S +TV V E
Sbjct: 89  AEHNDGMDVDSLVVSTIFVDEGPTMKRFEARAKGRGNRILKRTSHITVKVAE 140


>gi|319761143|ref|YP_004125080.1| ribosomal protein l22 [Alicycliphilus denitrificans BC]
 gi|330823001|ref|YP_004386304.1| 50S ribosomal protein L22 [Alicycliphilus denitrificans K601]
 gi|317115704|gb|ADU98192.1| ribosomal protein L22 [Alicycliphilus denitrificans BC]
 gi|329308373|gb|AEB82788.1| ribosomal protein L22 [Alicycliphilus denitrificans K601]
          Length = 110

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 64/107 (59%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
           +E  A+   +R+S  K  LVA +IRGK+V  AL  L F++K+ AG V+K L SA+ANAE+
Sbjct: 2   SETRAVLRGVRLSVDKGRLVADLIRGKKVDQALDILTFTQKKAAGIVKKVLESAIANAEH 61

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           N   D+D L V   +V +   +KRF  R + R  RI +P   + V V
Sbjct: 62  NDGADIDELKVKTIFVEQGTTLKRFTARAKGRGNRISKPTCHIYVTV 108


>gi|256380593|ref|YP_003104253.1| ribosomal protein L22 [Actinosynnema mirum DSM 43827]
 gi|255924896|gb|ACU40407.1| ribosomal protein L22 [Actinosynnema mirum DSM 43827]
          Length = 133

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 47/103 (45%), Positives = 63/103 (61%)

Query: 19  AIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDL 78
           A A  +R +P K+  V  +IRG+  S+ALA L+F+ +  +  VRK L SAVANAENN  L
Sbjct: 17  ARARYVRDTPMKVRRVVELIRGRSASEALAVLQFAPQAASEPVRKVLASAVANAENNLSL 76

Query: 79  DVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           D D L VS+ YV +   +KRF  R + R  RI +  S +TV V
Sbjct: 77  DPDTLWVSKVYVDEGPTLKRFRPRAQGRAYRIRKRTSHITVEV 119


>gi|226309813|ref|YP_002769707.1| 50S ribosomal protein L22 [Brevibacillus brevis NBRC 100599]
 gi|254800424|sp|C0ZII5|RL22_BREBN RecName: Full=50S ribosomal protein L22
 gi|226092761|dbj|BAH41203.1| 50S ribosomal protein L22 [Brevibacillus brevis NBRC 100599]
          Length = 110

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 70/108 (64%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  +R++ +K+ LV  +IRGK+V +ALA L+ + K  +  V K L SA+ANAE+N
Sbjct: 2   EAKAVARNIRIASRKVRLVVDLIRGKQVGEALAILKHTPKAASPVVEKLLKSAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           +++D + L+V + +V +   +KRF  R   R  RI +  S +TV++ E
Sbjct: 62  YEMDPNSLVVGKVFVDQGPTLKRFRPRAMGRASRIHKRTSHITVVLNE 109


>gi|91785460|ref|YP_560666.1| 50S ribosomal protein L22 [Burkholderia xenovorans LB400]
 gi|307731250|ref|YP_003908474.1| 50S ribosomal protein L22 [Burkholderia sp. CCGE1003]
 gi|323527597|ref|YP_004229750.1| 50S ribosomal protein L22 [Burkholderia sp. CCGE1001]
 gi|123167986|sp|Q13TH5|RL22_BURXL RecName: Full=50S ribosomal protein L22
 gi|91689414|gb|ABE32614.1| LSU ribosomal protein L22P [Burkholderia xenovorans LB400]
 gi|307585785|gb|ADN59183.1| ribosomal protein L22 [Burkholderia sp. CCGE1003]
 gi|323384599|gb|ADX56690.1| ribosomal protein L22 [Burkholderia sp. CCGE1001]
          Length = 109

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 61/106 (57%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  AI    R+S QK  LVA  IRG  V  AL  L FS K+ AG V+K + SA+ANAE+N
Sbjct: 2   EVKAIHRGARISAQKTRLVADQIRGLPVDKALNVLTFSPKKAAGIVKKVVLSAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L ++  Y+ K+  +KRF  R + R  RI +    +TV V
Sbjct: 62  EGADIDELKITSIYIDKAASLKRFTARAKGRGNRIEKQSCHITVTV 107


>gi|50364943|ref|YP_053368.1| 50S ribosomal protein L22 [Mesoplasma florum L1]
 gi|81695699|sp|Q6F1Y9|RL22_MESFL RecName: Full=50S ribosomal protein L22
 gi|50363499|gb|AAT75484.1| 50S ribosomal protein L22 [Mesoplasma florum L1]
          Length = 112

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 49/112 (43%), Positives = 67/112 (59%), Gaps = 3/112 (2%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A  +M+R+SP+K+ LVA  IR K V+ A+A L    KR A  V K L SA+ANA NN
Sbjct: 2   EAKAYLNMIRISPRKVRLVADTIRNKPVAAAIATLYNLDKRSAEPVLKLLNSAIANAVNN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           + +D D+L V   +V +   +KRF  R   R   I++  S +T+I   VSDE
Sbjct: 62  NGMDADKLFVKTIFVNEGPTLKRFRPRAHGRAYEILKRTSHVTII---VSDE 110


>gi|167629472|ref|YP_001679971.1| 50S ribosomal protein l22 [Heliobacterium modesticaldum Ice1]
 gi|215274824|sp|B0TC61|RL22_HELMI RecName: Full=50S ribosomal protein L22
 gi|167592212|gb|ABZ83960.1| 50S ribosomal protein l22 [Heliobacterium modesticaldum Ice1]
          Length = 140

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 66/112 (58%)

Query: 12  MGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVAN 71
           M    A A+A  +R SP+K+  V  +IRGK V+DA A L+F+  + A +V K L SAVAN
Sbjct: 1   MEAKTAQAVAKYVRTSPRKVRQVIDLIRGKSVADAFAILKFTPVKSAADVAKVLKSAVAN 60

Query: 72  AENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           AE+N++++   L V   +V +   MKR   R + R   I +  S +TVIV E
Sbjct: 61  AEHNYEMNTADLYVQTCFVDQGPSMKRISPRAQGRADVIKKRMSHITVIVAE 112


>gi|88812752|ref|ZP_01127998.1| 50S ribosomal protein L22 [Nitrococcus mobilis Nb-231]
 gi|88789990|gb|EAR21111.1| 50S ribosomal protein L22 [Nitrococcus mobilis Nb-231]
          Length = 110

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 63/108 (58%), Gaps = 3/108 (2%)

Query: 19  AIASMLR---VSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           A A+ LR   +SPQK  LVA  IRG  V+ AL  LEFS K+ A  +RK L SA+ANAE+N
Sbjct: 2   ATAAKLRYSLISPQKARLVADQIRGLPVAQALQMLEFSSKKAARVIRKILESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
              D+D L V+  +V +    KR   R + R  RI +  S +TV V E
Sbjct: 62  EGADIDELTVARVFVDEGPMYKRIQPRAKGRANRIRKRTSHITVAVAE 109


>gi|253581387|ref|ZP_04858613.1| LSU ribosomal protein L22P [Fusobacterium varium ATCC 27725]
 gi|251836751|gb|EES65285.1| LSU ribosomal protein L22P [Fusobacterium varium ATCC 27725]
          Length = 110

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 45/108 (41%), Positives = 64/108 (59%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AI   +R+SP+K  LVA ++RGK   +AL  L+F+ K+ A  ++KTL SAVANA NN
Sbjct: 2   EARAITRFVRLSPRKARLVADLVRGKSALEALDILDFTNKKAARIIKKTLASAVANATNN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
             +D D+L+VS   +     +KR   R   R   I +P + + V V E
Sbjct: 62  FKMDEDKLVVSTIMINDGPALKRIMPRAMGRADIIRKPTAHIVVAVSE 109


>gi|160947695|ref|ZP_02094862.1| hypothetical protein PEPMIC_01630 [Parvimonas micra ATCC 33270]
 gi|158446829|gb|EDP23824.1| hypothetical protein PEPMIC_01630 [Parvimonas micra ATCC 33270]
          Length = 110

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 47/108 (43%), Positives = 63/108 (58%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A AIA   R+SP K+N +   IRGK V +AL+ L F+ K  A  + K L SAVANAENN
Sbjct: 2   QAKAIAKYQRISPLKVNFICREIRGKHVDEALSILRFTPKAGARLLEKVLKSAVANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           H+LD   L V EAY   +  MKR+  + +     I++  S + V V E
Sbjct: 62  HNLDRKDLYVLEAYANDAPVMKRWRPKAKGSAYPILKRSSHIGVTVAE 109


>gi|32035718|ref|ZP_00135599.1| COG0091: Ribosomal protein L22 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|126209229|ref|YP_001054454.1| 50S ribosomal protein L22 [Actinobacillus pleuropneumoniae L20]
 gi|165977201|ref|YP_001652794.1| 50S ribosomal protein L22 [Actinobacillus pleuropneumoniae serovar
           3 str. JL03]
 gi|190151119|ref|YP_001969644.1| 50S ribosomal protein L22 [Actinobacillus pleuropneumoniae serovar
           7 str. AP76]
 gi|303253191|ref|ZP_07339340.1| 50S ribosomal protein L22 [Actinobacillus pleuropneumoniae serovar
           2 str. 4226]
 gi|307246694|ref|ZP_07528764.1| 50S ribosomal protein L22 [Actinobacillus pleuropneumoniae serovar
           1 str. 4074]
 gi|307248836|ref|ZP_07530849.1| 50S ribosomal protein L22 [Actinobacillus pleuropneumoniae serovar
           2 str. S1536]
 gi|307251063|ref|ZP_07532987.1| 50S ribosomal protein L22 [Actinobacillus pleuropneumoniae serovar
           4 str. M62]
 gi|307255679|ref|ZP_07537483.1| 50S ribosomal protein L22 [Actinobacillus pleuropneumoniae serovar
           9 str. CVJ13261]
 gi|307257862|ref|ZP_07539619.1| 50S ribosomal protein L22 [Actinobacillus pleuropneumoniae serovar
           10 str. D13039]
 gi|307260131|ref|ZP_07541841.1| 50S ribosomal protein L22 [Actinobacillus pleuropneumoniae serovar
           11 str. 56153]
 gi|307262260|ref|ZP_07543909.1| 50S ribosomal protein L22 [Actinobacillus pleuropneumoniae serovar
           12 str. 1096]
 gi|307264469|ref|ZP_07546054.1| 50S ribosomal protein L22 [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
 gi|322515630|ref|ZP_08068608.1| 50S ribosomal protein L22 [Actinobacillus ureae ATCC 25976]
 gi|166220820|sp|A3N363|RL22_ACTP2 RecName: Full=50S ribosomal protein L22
 gi|226733421|sp|B3GZ16|RL22_ACTP7 RecName: Full=50S ribosomal protein L22
 gi|226733422|sp|B0BST6|RL22_ACTPJ RecName: Full=50S ribosomal protein L22
 gi|126098021|gb|ABN74849.1| 50S ribosomal protein L22 [Actinobacillus pleuropneumoniae serovar
           5b str. L20]
 gi|165877302|gb|ABY70350.1| 50S ribosomal protein L22 [Actinobacillus pleuropneumoniae serovar
           3 str. JL03]
 gi|189916250|gb|ACE62502.1| 50S ribosomal protein L22 [Actinobacillus pleuropneumoniae serovar
           7 str. AP76]
 gi|302647873|gb|EFL78080.1| 50S ribosomal protein L22 [Actinobacillus pleuropneumoniae serovar
           2 str. 4226]
 gi|306852394|gb|EFM84629.1| 50S ribosomal protein L22 [Actinobacillus pleuropneumoniae serovar
           1 str. 4074]
 gi|306854763|gb|EFM86953.1| 50S ribosomal protein L22 [Actinobacillus pleuropneumoniae serovar
           2 str. S1536]
 gi|306856893|gb|EFM89025.1| 50S ribosomal protein L22 [Actinobacillus pleuropneumoniae serovar
           4 str. M62]
 gi|306861356|gb|EFM93346.1| 50S ribosomal protein L22 [Actinobacillus pleuropneumoniae serovar
           9 str. CVJ13261]
 gi|306863768|gb|EFM95694.1| 50S ribosomal protein L22 [Actinobacillus pleuropneumoniae serovar
           10 str. D13039]
 gi|306865777|gb|EFM97655.1| 50S ribosomal protein L22 [Actinobacillus pleuropneumoniae serovar
           11 str. 56153]
 gi|306868023|gb|EFM99850.1| 50S ribosomal protein L22 [Actinobacillus pleuropneumoniae serovar
           12 str. 1096]
 gi|306870166|gb|EFN01925.1| 50S ribosomal protein L22 [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
 gi|322118281|gb|EFX90564.1| 50S ribosomal protein L22 [Actinobacillus ureae ATCC 25976]
          Length = 110

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 63/99 (63%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R S QK  LVA +IRGK+V+ AL  L F+ K+ A  V+K L SA+ANAE+N   DVD L 
Sbjct: 11  RTSAQKARLVADLIRGKKVAQALEILTFTNKKAAALVKKVLESAIANAEHNDGADVDDLK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           V++ +V +   MKR   R + R  RI++  S +TV+V +
Sbjct: 71  VAKIFVDEGPSMKRVMPRAKGRADRILKRTSHITVVVSD 109


>gi|187925611|ref|YP_001897253.1| 50S ribosomal protein L22 [Burkholderia phytofirmans PsJN]
 gi|296163316|ref|ZP_06846077.1| ribosomal protein L22 [Burkholderia sp. Ch1-1]
 gi|215274810|sp|B2T746|RL22_BURPP RecName: Full=50S ribosomal protein L22
 gi|187716805|gb|ACD18029.1| ribosomal protein L22 [Burkholderia phytofirmans PsJN]
 gi|295886455|gb|EFG66312.1| ribosomal protein L22 [Burkholderia sp. Ch1-1]
          Length = 110

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 61/106 (57%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  AI    R+S QK  LVA  IRG  V  AL  L FS K+ AG V+K + SA+ANAE+N
Sbjct: 3   EVKAIHRGARISAQKTRLVADQIRGLPVDKALNVLTFSPKKAAGIVKKVVLSAIANAEHN 62

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L ++  Y+ K+  +KRF  R + R  RI +    +TV V
Sbjct: 63  EGADIDELKITSIYIDKAASLKRFTARAKGRGNRIEKQSCHITVTV 108


>gi|328675412|gb|AEB28087.1| LSU ribosomal protein L22p (L17e) [Francisella cf. novicida 3523]
          Length = 111

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 62/108 (57%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A     R+S QK  LVA  IRG  V  A+  L FS K+ A  ++  L SAVANAE+N
Sbjct: 2   EVQAKLKFARISAQKCRLVADQIRGLPVEQAINLLTFSNKKAAVLIKGVLSSAVANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
             +DVD L+VS  +V +   MKRF  R + R  RI++  S +TV V E
Sbjct: 62  DGMDVDSLVVSTIFVDEGPTMKRFEARAKGRGNRILKRTSHITVKVAE 109


>gi|326793563|ref|YP_004311383.1| ribosomal protein L22 [Marinomonas mediterranea MMB-1]
 gi|326544327|gb|ADZ89547.1| ribosomal protein L22 [Marinomonas mediterranea MMB-1]
          Length = 110

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 61/97 (62%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R+S QK  LVA  IRGK VSDAL  L FS K+ A  V+K L SAVANAE+N   D+D L 
Sbjct: 12  RLSAQKARLVADQIRGKSVSDALNILAFSPKKAAAIVKKVLESAVANAEHNEGADIDDLR 71

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           VS  YV +++ +KR   R + R  RI++    +TV V
Sbjct: 72  VSTIYVDEAMTLKRIMPRAKGRADRILKRGCHITVKV 108


>gi|301630256|ref|XP_002944238.1| PREDICTED: 50S ribosomal protein L22-like, partial [Xenopus
           (Silurana) tropicalis]
          Length = 105

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 45/103 (43%), Positives = 62/103 (60%)

Query: 19  AIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDL 78
           A+   +R+S  K  LVA +IRGK+V  AL  L F++K+ AG V+K L SA+ANAE+N   
Sbjct: 1   AVLRGVRLSVDKGRLVADLIRGKKVDQALNILTFTQKKAAGIVKKVLESAIANAEHNDGA 60

Query: 79  DVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           D+D L V   YV +   +KRF  R + R  RI +P   + V V
Sbjct: 61  DIDELKVKTIYVEQGATLKRFTARAKGRGNRISKPTCHIYVTV 103


>gi|309389928|gb|ADO77808.1| LSU ribosomal protein L22P [Halanaerobium praevalens DSM 2228]
          Length = 113

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 45/111 (40%), Positives = 66/111 (59%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  LR++ +K  LV  +I+GK V  A+A L+ + K+ A  V K L SA ANAENN
Sbjct: 2   EARAVAKHLRITARKARLVTDLIKGKDVDTAVAILKSTPKKAAKIVEKVLNSATANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           HD+ VD L V  A+V +   MKR+  R +     I +  S +TV++ +  +
Sbjct: 62  HDMFVDDLYVKRAFVDEGPTMKRWKARAQGSASPINKRTSHITVVLSDTKE 112


>gi|294786416|ref|ZP_06751670.1| ribosomal protein L22 [Parascardovia denticolens F0305]
 gi|315225978|ref|ZP_07867766.1| 50S ribosomal protein L22 [Parascardovia denticolens DSM 10105]
 gi|294485249|gb|EFG32883.1| ribosomal protein L22 [Parascardovia denticolens F0305]
 gi|315120110|gb|EFT83242.1| 50S ribosomal protein L22 [Parascardovia denticolens DSM 10105]
          Length = 119

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 68/111 (61%), Gaps = 5/111 (4%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANA--- 72
           EA AIA  +RV+P+K   +  +IRGK+ ++A+  L+F+ +  A  VRKTL SAVANA   
Sbjct: 2   EAKAIARHVRVTPRKARRMVDLIRGKKATEAITILKFAPQAAAVPVRKTLESAVANARVL 61

Query: 73  --ENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
             + N     + L+V E YV + V +KRF  R + R GRI +  S +TV+V
Sbjct: 62  ADKENAPFRENELVVKETYVDEGVTLKRFRARAQGRAGRINKRTSHITVVV 112


>gi|642166|emb|CAA88014.1| ribosomal protein L22 [Bacillus subtilis]
          Length = 113

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 70/108 (64%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A A+A  +R++P+K  LV  +IRGK+V +A+++L  +    +  + K L SA+ANAE+N
Sbjct: 2   QAKAVARTVRIAPRKARLVMDLIRGKQVGEAVSNLNLTPISASPIIEKVLKSAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           +++D + L++S+A+V +   +KR   R   R  +I +  S +TV+V E
Sbjct: 62  YEMDANNLVISQAFVDEGPTLKRLRPRAMGRASQINKRTSHITVVVSE 109


>gi|33322100|gb|AAQ06770.1|AF496111_1 50s ribosomal protein L22 [Lactobacillus delbrueckii subsp. lactis]
          Length = 98

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 43/88 (48%), Positives = 59/88 (67%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A A  +R++P+K  LV  +IRGK V++ALA L+F+ K  +  V K L SAVANAE+N+
Sbjct: 8   ARAEARTVRIAPRKARLVVDLIRGKSVAEALAILKFTPKAASPIVEKVLRSAVANAEHNY 67

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGR 104
           DL+   L VSEAYV +   +KRF  R +
Sbjct: 68  DLESANLTVSEAYVNEGATLKRFRPRAK 95


>gi|309812463|ref|ZP_07706218.1| ribosomal protein L22 [Dermacoccus sp. Ellin185]
 gi|308433768|gb|EFP57645.1| ribosomal protein L22 [Dermacoccus sp. Ellin185]
          Length = 122

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 47/118 (39%), Positives = 71/118 (60%), Gaps = 5/118 (4%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANA--- 72
           EA A A  +RV+P K   V  MIRGK+ +DA+A L+F+ +  +  V KTL SA+ANA   
Sbjct: 2   EAKAQARHVRVTPMKARRVVDMIRGKQAADAIALLQFAPQTASEPVLKTLNSAIANARFT 61

Query: 73  --ENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
             +N+   D + L+V+ A+V +   MKRF  R + R  RI++  S +T++V E   +G
Sbjct: 62  ADKNSAPFDENALVVTTAFVDEGPTMKRFRPRAQGRASRILKRTSHITIVVGERDSKG 119


>gi|294638047|ref|ZP_06716307.1| ribosomal protein L22 [Edwardsiella tarda ATCC 23685]
 gi|291088839|gb|EFE21400.1| ribosomal protein L22 [Edwardsiella tarda ATCC 23685]
          Length = 110

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 64/99 (64%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R S QK+ LVA +IRGK+VS AL  L ++ K+ A  V+K L SA+ANAE+N   D+D L 
Sbjct: 11  RSSAQKVRLVADLIRGKKVSQALEILTYTNKKAAVLVKKVLESAIANAEHNDGADIDDLK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           VS+ +V +   MKR   R + R  RI++  S +TV+V +
Sbjct: 71  VSKIFVDEGPTMKRIMPRAKGRADRILKRTSHITVVVSD 109


>gi|319787920|ref|YP_004147395.1| ribosomal protein L22 [Pseudoxanthomonas suwonensis 11-1]
 gi|317466432|gb|ADV28164.1| ribosomal protein L22 [Pseudoxanthomonas suwonensis 11-1]
          Length = 111

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 47/108 (43%), Positives = 64/108 (59%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AI    R+SPQK  LVA  +RG     A+  L+FS K+ A  ++K + SA+ANAENN
Sbjct: 2   EAKAILRTARISPQKARLVADQVRGLPAERAVNLLKFSDKKAAALIKKVVESAIANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           +  DVD L V    V +   +KRF  R + R  RI++  S +TV+V E
Sbjct: 62  NGADVDALKVKTIMVDEGPTLKRFMARAKGRGTRILKRTSHITVVVGE 109


>gi|148263145|ref|YP_001229851.1| 50S ribosomal protein L22 [Geobacter uraniireducens Rf4]
 gi|189041952|sp|A5GAX0|RL22_GEOUR RecName: Full=50S ribosomal protein L22
 gi|146396645|gb|ABQ25278.1| LSU ribosomal protein L22P [Geobacter uraniireducens Rf4]
          Length = 111

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 47/108 (43%), Positives = 61/108 (56%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E++A  S  R+SP+K  LV  M+RGK + +AL  L FS +  A  V K L SAVANAE  
Sbjct: 2   ESSAKLSFARLSPRKTRLVVDMVRGKGIQNALNTLRFSPQPSAKLVSKLLSSAVANAEQK 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
              DVDRL V   YV     +KRF  R   R  +I +P S + V++ E
Sbjct: 62  GVADVDRLYVKTIYVNGGTVLKRFVPRAMGRASKIRKPTSHICVVLAE 109


>gi|307105625|gb|EFN53873.1| hypothetical protein CHLNCDRAFT_136009 [Chlorella variabilis]
          Length = 231

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 47/105 (44%), Positives = 63/105 (60%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A AIA  + +SP KLN  A ++RG  + DAL     S K+ A  V K L SA ANA NN 
Sbjct: 92  ARAIARGISISPHKLNDFAKVVRGLPIQDALIQCRMSPKKSAKLVEKALLSAQANAVNNQ 151

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
            L+ +RL V+EA+VGK   +KR    GR R G+ ++  S LTV++
Sbjct: 152 GLEAERLRVAEAWVGKGQNLKRTSMHGRGRSGKRLKYRSHLTVLL 196


>gi|312795779|ref|YP_004028701.1| LSU ribosomal protein L22P [Burkholderia rhizoxinica HKI 454]
 gi|312167554|emb|CBW74557.1| LSU ribosomal protein L22P [Burkholderia rhizoxinica HKI 454]
          Length = 109

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 60/106 (56%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  AI    R+S QK  LVA  IRG  V  AL  L FS K+ AG V+K + SA+ANAE+N
Sbjct: 2   EVKAIHRGARISAQKTRLVADQIRGLPVDKALNILTFSPKKAAGIVKKVVLSAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L +   YV K+  +KRF  R + R  RI +    +TV V
Sbjct: 62  EGADIDELKIKTIYVDKAASLKRFTARAKGRGNRIEKQSCHITVTV 107


>gi|269140566|ref|YP_003297267.1| 50S ribosomal protein L22 [Edwardsiella tarda EIB202]
 gi|267986227|gb|ACY86056.1| 50S ribosomal protein L22 [Edwardsiella tarda EIB202]
 gi|304560354|gb|ADM43018.1| LSU ribosomal protein L22p (L17e) [Edwardsiella tarda FL6-60]
          Length = 110

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 64/99 (64%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R S QK+ LVA +IRGK+VS AL  L ++ K+ A  V+K L SA+ANAE+N   D+D L 
Sbjct: 11  RSSAQKVRLVADLIRGKKVSQALEVLTYTNKKAAVLVKKVLESAIANAEHNDGADIDDLK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           VS+ +V +   MKR   R + R  RI++  S +TV+V +
Sbjct: 71  VSKIFVDEGPTMKRIMPRAKGRADRILKRTSHITVVVSD 109


>gi|53720816|ref|YP_109802.1| 50S ribosomal protein L22 [Burkholderia pseudomallei K96243]
 gi|53723849|ref|YP_104161.1| 50S ribosomal protein L22 [Burkholderia mallei ATCC 23344]
 gi|76810236|ref|YP_335135.1| 50S ribosomal protein L22 [Burkholderia pseudomallei 1710b]
 gi|78064929|ref|YP_367698.1| 50S ribosomal protein L22 [Burkholderia sp. 383]
 gi|83719721|ref|YP_443567.1| 50S ribosomal protein L22 [Burkholderia thailandensis E264]
 gi|107024298|ref|YP_622625.1| 50S ribosomal protein L22 [Burkholderia cenocepacia AU 1054]
 gi|115350327|ref|YP_772166.1| 50S ribosomal protein L22 [Burkholderia ambifaria AMMD]
 gi|116688377|ref|YP_834000.1| 50S ribosomal protein L22 [Burkholderia cenocepacia HI2424]
 gi|121600815|ref|YP_994451.1| 50S ribosomal protein L22 [Burkholderia mallei SAVP1]
 gi|124384181|ref|YP_001027900.1| 50S ribosomal protein L22 [Burkholderia mallei NCTC 10229]
 gi|126440213|ref|YP_001060745.1| 50S ribosomal protein L22 [Burkholderia pseudomallei 668]
 gi|126450928|ref|YP_001082995.1| 50S ribosomal protein L22 [Burkholderia mallei NCTC 10247]
 gi|126453662|ref|YP_001068029.1| 50S ribosomal protein L22 [Burkholderia pseudomallei 1106a]
 gi|134283235|ref|ZP_01769936.1| 50S ribosomal protein L22 [Burkholderia pseudomallei 305]
 gi|134294448|ref|YP_001118183.1| 50S ribosomal protein L22 [Burkholderia vietnamiensis G4]
 gi|161523434|ref|YP_001578446.1| 50S ribosomal protein L22 [Burkholderia multivorans ATCC 17616]
 gi|167001694|ref|ZP_02267486.1| 50S ribosomal protein L22 [Burkholderia mallei PRL-20]
 gi|167564412|ref|ZP_02357328.1| ribosomal protein L22 [Burkholderia oklahomensis EO147]
 gi|167571558|ref|ZP_02364432.1| ribosomal protein L22 [Burkholderia oklahomensis C6786]
 gi|167582618|ref|ZP_02375492.1| ribosomal protein L22 [Burkholderia thailandensis TXDOH]
 gi|167587767|ref|ZP_02380155.1| ribosomal protein L22 [Burkholderia ubonensis Bu]
 gi|167620732|ref|ZP_02389363.1| ribosomal protein L22 [Burkholderia thailandensis Bt4]
 gi|167721572|ref|ZP_02404808.1| ribosomal protein L22 [Burkholderia pseudomallei DM98]
 gi|167740546|ref|ZP_02413320.1| ribosomal protein L22 [Burkholderia pseudomallei 14]
 gi|167817751|ref|ZP_02449431.1| ribosomal protein L22 [Burkholderia pseudomallei 91]
 gi|167826148|ref|ZP_02457619.1| ribosomal protein L22 [Burkholderia pseudomallei 9]
 gi|167838207|ref|ZP_02465066.1| ribosomal protein L22 [Burkholderia thailandensis MSMB43]
 gi|167847660|ref|ZP_02473168.1| ribosomal protein L22 [Burkholderia pseudomallei B7210]
 gi|167896232|ref|ZP_02483634.1| ribosomal protein L22 [Burkholderia pseudomallei 7894]
 gi|167904614|ref|ZP_02491819.1| ribosomal protein L22 [Burkholderia pseudomallei NCTC 13177]
 gi|167912879|ref|ZP_02499970.1| ribosomal protein L22 [Burkholderia pseudomallei 112]
 gi|167920839|ref|ZP_02507930.1| ribosomal protein L22 [Burkholderia pseudomallei BCC215]
 gi|170700699|ref|ZP_02891694.1| ribosomal protein L22 [Burkholderia ambifaria IOP40-10]
 gi|170731687|ref|YP_001763634.1| 50S ribosomal protein L22 [Burkholderia cenocepacia MC0-3]
 gi|171318353|ref|ZP_02907511.1| ribosomal protein L22 [Burkholderia ambifaria MEX-5]
 gi|172059346|ref|YP_001806998.1| 50S ribosomal protein L22 [Burkholderia ambifaria MC40-6]
 gi|186477583|ref|YP_001859053.1| 50S ribosomal protein L22 [Burkholderia phymatum STM815]
 gi|189351793|ref|YP_001947421.1| 50S ribosomal protein L22 [Burkholderia multivorans ATCC 17616]
 gi|206558646|ref|YP_002229406.1| 50S ribosomal protein L22 [Burkholderia cenocepacia J2315]
 gi|209521380|ref|ZP_03270093.1| ribosomal protein L22 [Burkholderia sp. H160]
 gi|217424861|ref|ZP_03456358.1| 50S ribosomal protein L22 [Burkholderia pseudomallei 576]
 gi|221201570|ref|ZP_03574608.1| 50S ribosomal protein L22 [Burkholderia multivorans CGD2M]
 gi|221207355|ref|ZP_03580365.1| 50S ribosomal protein L22 [Burkholderia multivorans CGD2]
 gi|221213493|ref|ZP_03586468.1| 50S ribosomal protein L22 [Burkholderia multivorans CGD1]
 gi|226198196|ref|ZP_03793767.1| 50S ribosomal protein L22 [Burkholderia pseudomallei Pakistan 9]
 gi|237814140|ref|YP_002898591.1| ribosomal protein L22 [Burkholderia pseudomallei MSHR346]
 gi|238025937|ref|YP_002910168.1| 50S ribosomal protein L22 [Burkholderia glumae BGR1]
 gi|238563918|ref|ZP_00438026.2| 50S ribosomal protein L22 [Burkholderia mallei GB8 horse 4]
 gi|242315373|ref|ZP_04814389.1| 50S ribosomal protein L22 [Burkholderia pseudomallei 1106b]
 gi|254174724|ref|ZP_04881385.1| 50S ribosomal protein L22 [Burkholderia mallei ATCC 10399]
 gi|254180344|ref|ZP_04886942.1| 50S ribosomal protein L22 [Burkholderia pseudomallei 1655]
 gi|254190307|ref|ZP_04896815.1| 50S ribosomal protein L22 [Burkholderia pseudomallei Pasteur 52237]
 gi|254198582|ref|ZP_04905003.1| 50S ribosomal protein L22 [Burkholderia pseudomallei S13]
 gi|254201234|ref|ZP_04907598.1| 50S ribosomal protein L22 [Burkholderia mallei FMH]
 gi|254206575|ref|ZP_04912926.1| 50S ribosomal protein L22 [Burkholderia mallei JHU]
 gi|254253512|ref|ZP_04946830.1| Ribosomal protein L22 [Burkholderia dolosa AUO158]
 gi|254260979|ref|ZP_04952033.1| 50S ribosomal protein L22 [Burkholderia pseudomallei 1710a]
 gi|254300581|ref|ZP_04968026.1| 50S ribosomal protein L22 [Burkholderia pseudomallei 406e]
 gi|254357113|ref|ZP_04973387.1| 50S ribosomal protein L22 [Burkholderia mallei 2002721280]
 gi|330815254|ref|YP_004358959.1| 50S ribosomal protein L22 [Burkholderia gladioli BSR3]
 gi|81684957|sp|Q62GL0|RL22_BURMA RecName: Full=50S ribosomal protein L22
 gi|81690199|sp|Q63Q16|RL22_BURPS RecName: Full=50S ribosomal protein L22
 gi|109893185|sp|Q3JMR8|RL22_BURP1 RecName: Full=50S ribosomal protein L22
 gi|109893186|sp|Q39KG2|RL22_BURS3 RecName: Full=50S ribosomal protein L22
 gi|109893187|sp|Q2SU32|RL22_BURTA RecName: Full=50S ribosomal protein L22
 gi|122324261|sp|Q0BJ41|RL22_BURCM RecName: Full=50S ribosomal protein L22
 gi|123244309|sp|Q1BRV3|RL22_BURCA RecName: Full=50S ribosomal protein L22
 gi|166220829|sp|A0K3N0|RL22_BURCH RecName: Full=50S ribosomal protein L22
 gi|166220830|sp|A3MRV9|RL22_BURM7 RecName: Full=50S ribosomal protein L22
 gi|166220831|sp|A2S7I1|RL22_BURM9 RecName: Full=50S ribosomal protein L22
 gi|166220832|sp|A1V898|RL22_BURMS RecName: Full=50S ribosomal protein L22
 gi|166220833|sp|A3P0A8|RL22_BURP0 RecName: Full=50S ribosomal protein L22
 gi|166220834|sp|A3NEH4|RL22_BURP6 RecName: Full=50S ribosomal protein L22
 gi|166220835|sp|A4JAP5|RL22_BURVG RecName: Full=50S ribosomal protein L22
 gi|226733440|sp|B1YRD5|RL22_BURA4 RecName: Full=50S ribosomal protein L22
 gi|226733441|sp|B1JU27|RL22_BURCC RecName: Full=50S ribosomal protein L22
 gi|226733442|sp|B4E5C5|RL22_BURCJ RecName: Full=50S ribosomal protein L22
 gi|226733443|sp|A9ADJ8|RL22_BURM1 RecName: Full=50S ribosomal protein L22
 gi|226733444|sp|B2JI61|RL22_BURP8 RecName: Full=50S ribosomal protein L22
 gi|52211230|emb|CAH37219.1| 50S ribosomal protein L22 [Burkholderia pseudomallei K96243]
 gi|52427272|gb|AAU47865.1| ribosomal protein L22 [Burkholderia mallei ATCC 23344]
 gi|76579689|gb|ABA49164.1| ribosomal protein L22 [Burkholderia pseudomallei 1710b]
 gi|77965674|gb|ABB07054.1| LSU ribosomal protein L22P [Burkholderia sp. 383]
 gi|83653546|gb|ABC37609.1| ribosomal protein L22 [Burkholderia thailandensis E264]
 gi|105894487|gb|ABF77652.1| LSU ribosomal protein L22P [Burkholderia cenocepacia AU 1054]
 gi|115280315|gb|ABI85832.1| LSU ribosomal protein L22P [Burkholderia ambifaria AMMD]
 gi|116646466|gb|ABK07107.1| LSU ribosomal protein L22P [Burkholderia cenocepacia HI2424]
 gi|121229625|gb|ABM52143.1| 50S ribosomal protein L22 [Burkholderia mallei SAVP1]
 gi|124292201|gb|ABN01470.1| 50S ribosomal protein L22 [Burkholderia mallei NCTC 10229]
 gi|124896121|gb|EAY70001.1| Ribosomal protein L22 [Burkholderia dolosa AUO158]
 gi|126219706|gb|ABN83212.1| 50S ribosomal protein L22 [Burkholderia pseudomallei 668]
 gi|126227304|gb|ABN90844.1| 50S ribosomal protein L22 [Burkholderia pseudomallei 1106a]
 gi|126243798|gb|ABO06891.1| 50S ribosomal protein L22 [Burkholderia mallei NCTC 10247]
 gi|134137605|gb|ABO53348.1| LSU ribosomal protein L22P [Burkholderia vietnamiensis G4]
 gi|134245430|gb|EBA45523.1| 50S ribosomal protein L22 [Burkholderia pseudomallei 305]
 gi|147747128|gb|EDK54204.1| 50S ribosomal protein L22 [Burkholderia mallei FMH]
 gi|147752117|gb|EDK59183.1| 50S ribosomal protein L22 [Burkholderia mallei JHU]
 gi|148026177|gb|EDK84262.1| 50S ribosomal protein L22 [Burkholderia mallei 2002721280]
 gi|157810567|gb|EDO87737.1| 50S ribosomal protein L22 [Burkholderia pseudomallei 406e]
 gi|157937983|gb|EDO93653.1| 50S ribosomal protein L22 [Burkholderia pseudomallei Pasteur 52237]
 gi|160340863|gb|ABX13949.1| ribosomal protein L22 [Burkholderia multivorans ATCC 17616]
 gi|160695769|gb|EDP85739.1| 50S ribosomal protein L22 [Burkholderia mallei ATCC 10399]
 gi|169655322|gb|EDS88015.1| 50S ribosomal protein L22 [Burkholderia pseudomallei S13]
 gi|169814929|gb|ACA89512.1| ribosomal protein L22 [Burkholderia cenocepacia MC0-3]
 gi|170134369|gb|EDT02702.1| ribosomal protein L22 [Burkholderia ambifaria IOP40-10]
 gi|171096431|gb|EDT41330.1| ribosomal protein L22 [Burkholderia ambifaria MEX-5]
 gi|171991863|gb|ACB62782.1| ribosomal protein L22 [Burkholderia ambifaria MC40-6]
 gi|184194042|gb|ACC72007.1| ribosomal protein L22 [Burkholderia phymatum STM815]
 gi|184210883|gb|EDU07926.1| 50S ribosomal protein L22 [Burkholderia pseudomallei 1655]
 gi|189335815|dbj|BAG44885.1| large subunit ribosomal protein L22 [Burkholderia multivorans ATCC
           17616]
 gi|198034683|emb|CAR50550.1| 50S ribosomal protein L22 [Burkholderia cenocepacia J2315]
 gi|209498200|gb|EDZ98342.1| ribosomal protein L22 [Burkholderia sp. H160]
 gi|217392317|gb|EEC32342.1| 50S ribosomal protein L22 [Burkholderia pseudomallei 576]
 gi|221166945|gb|EED99416.1| 50S ribosomal protein L22 [Burkholderia multivorans CGD1]
 gi|221172943|gb|EEE05380.1| 50S ribosomal protein L22 [Burkholderia multivorans CGD2]
 gi|221178386|gb|EEE10795.1| 50S ribosomal protein L22 [Burkholderia multivorans CGD2M]
 gi|225929716|gb|EEH25732.1| 50S ribosomal protein L22 [Burkholderia pseudomallei Pakistan 9]
 gi|237503384|gb|ACQ95702.1| ribosomal protein L22 [Burkholderia pseudomallei MSHR346]
 gi|237875131|gb|ACR27464.1| 50S ribosomal protein L22 [Burkholderia glumae BGR1]
 gi|238519671|gb|EEP83140.1| 50S ribosomal protein L22 [Burkholderia mallei GB8 horse 4]
 gi|242138612|gb|EES25014.1| 50S ribosomal protein L22 [Burkholderia pseudomallei 1106b]
 gi|243062591|gb|EES44777.1| 50S ribosomal protein L22 [Burkholderia mallei PRL-20]
 gi|254219668|gb|EET09052.1| 50S ribosomal protein L22 [Burkholderia pseudomallei 1710a]
 gi|325529683|gb|EGD06546.1| 50S ribosomal protein L22 [Burkholderia sp. TJI49]
 gi|327367647|gb|AEA59003.1| 50S ribosomal protein L22 [Burkholderia gladioli BSR3]
          Length = 109

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 60/106 (56%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  AI    R+S QK  LVA  IRG  V  AL  L FS K+ AG V+K + SA+ANAE+N
Sbjct: 2   EVKAIHRGARISAQKTRLVADQIRGLPVDKALNVLTFSPKKAAGIVKKVVLSAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L +   YV K+  +KRF  R + R  RI +    +TV V
Sbjct: 62  EGADIDELKIKSIYVDKAASLKRFTARAKGRGNRIEKQSCHITVTV 107


>gi|16272723|ref|NP_438941.1| 50S ribosomal protein L22 [Haemophilus influenzae Rd KW20]
 gi|68249378|ref|YP_248490.1| 50S ribosomal protein L22 [Haemophilus influenzae 86-028NP]
 gi|145628327|ref|ZP_01784128.1| 50S ribosomal protein L22 [Haemophilus influenzae 22.1-21]
 gi|145630527|ref|ZP_01786307.1| 50S ribosomal protein L2 [Haemophilus influenzae R3021]
 gi|145632136|ref|ZP_01787871.1| 50S ribosomal protein L2 [Haemophilus influenzae 3655]
 gi|145634807|ref|ZP_01790515.1| 50S ribosomal protein L22 [Haemophilus influenzae PittAA]
 gi|145638418|ref|ZP_01794028.1| 50S ribosomal protein L22 [Haemophilus influenzae PittII]
 gi|145640877|ref|ZP_01796459.1| 50S ribosomal protein L2 [Haemophilus influenzae R3021]
 gi|148826573|ref|YP_001291326.1| 50S ribosomal protein L22 [Haemophilus influenzae PittEE]
 gi|148827971|ref|YP_001292724.1| 50S ribosomal protein L22 [Haemophilus influenzae PittGG]
 gi|229844649|ref|ZP_04464788.1| 50S ribosomal protein L22 [Haemophilus influenzae 6P18H1]
 gi|229845832|ref|ZP_04465944.1| 50S ribosomal protein L22 [Haemophilus influenzae 7P49H1]
 gi|260579873|ref|ZP_05847703.1| ribosomal protein L22 [Haemophilus influenzae RdAW]
 gi|260581600|ref|ZP_05849397.1| ribosomal protein L22 [Haemophilus influenzae NT127]
 gi|260914675|ref|ZP_05921141.1| 50S ribosomal protein L22 [Pasteurella dagmatis ATCC 43325]
 gi|319775284|ref|YP_004137772.1| 50S ribosomal subunit protein L22 [Haemophilus influenzae F3047]
 gi|319897724|ref|YP_004135921.1| 50S ribosomal subunit protein l22 [Haemophilus influenzae F3031]
 gi|325577132|ref|ZP_08147616.1| 50S ribosomal protein L22 [Haemophilus parainfluenzae ATCC 33392]
 gi|329122788|ref|ZP_08251360.1| 50S ribosomal protein L22 [Haemophilus aegyptius ATCC 11116]
 gi|1172993|sp|P44360|RL22_HAEIN RecName: Full=50S ribosomal protein L22
 gi|81336195|sp|Q4QMB7|RL22_HAEI8 RecName: Full=50S ribosomal protein L22
 gi|166199499|sp|A5UDU2|RL22_HAEIE RecName: Full=50S ribosomal protein L22
 gi|166199500|sp|A5UHT5|RL22_HAEIG RecName: Full=50S ribosomal protein L22
 gi|1573792|gb|AAC22441.1| ribosomal protein L22 (rpL22) [Haemophilus influenzae Rd KW20]
 gi|68057577|gb|AAX87830.1| 50S ribosomal protein L22 [Haemophilus influenzae 86-028NP]
 gi|144980102|gb|EDJ89761.1| 50S ribosomal protein L22 [Haemophilus influenzae 22.1-21]
 gi|144983917|gb|EDJ91359.1| 50S ribosomal protein L2 [Haemophilus influenzae R3021]
 gi|144987043|gb|EDJ93573.1| 50S ribosomal protein L2 [Haemophilus influenzae 3655]
 gi|145267973|gb|EDK07969.1| 50S ribosomal protein L22 [Haemophilus influenzae PittAA]
 gi|145272747|gb|EDK12654.1| 50S ribosomal protein L22 [Haemophilus influenzae PittII]
 gi|145274391|gb|EDK14255.1| 50S ribosomal protein L2 [Haemophilus influenzae 22.4-21]
 gi|148716733|gb|ABQ98943.1| 50S ribosomal protein L22 [Haemophilus influenzae PittEE]
 gi|148719213|gb|ABR00341.1| 50S ribosomal protein L22 [Haemophilus influenzae PittGG]
 gi|229810836|gb|EEP46553.1| 50S ribosomal protein L22 [Haemophilus influenzae 7P49H1]
 gi|229812363|gb|EEP48053.1| 50S ribosomal protein L22 [Haemophilus influenzae 6P18H1]
 gi|260093157|gb|EEW77090.1| ribosomal protein L22 [Haemophilus influenzae RdAW]
 gi|260095193|gb|EEW79084.1| ribosomal protein L22 [Haemophilus influenzae NT127]
 gi|260631274|gb|EEX49459.1| 50S ribosomal protein L22 [Pasteurella dagmatis ATCC 43325]
 gi|301155335|emb|CBW14801.1| 50S ribosomal subunit protein L22 [Haemophilus parainfluenzae T3T1]
 gi|301169499|emb|CBW29100.1| 50S ribosomal subunit protein L22 [Haemophilus influenzae 10810]
 gi|309751557|gb|ADO81541.1| 50S ribosomal protein L22 [Haemophilus influenzae R2866]
 gi|309973727|gb|ADO96928.1| 50S ribosomal protein L22 [Haemophilus influenzae R2846]
 gi|317433230|emb|CBY81605.1| 50S ribosomal subunit protein L22 [Haemophilus influenzae F3031]
 gi|317449875|emb|CBY86086.1| 50S ribosomal subunit protein L22 [Haemophilus influenzae F3047]
 gi|325160714|gb|EGC72835.1| 50S ribosomal protein L22 [Haemophilus parainfluenzae ATCC 33392]
 gi|327472052|gb|EGF17490.1| 50S ribosomal protein L22 [Haemophilus aegyptius ATCC 11116]
          Length = 110

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 63/99 (63%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R S QK  LVA +IRGK+V+ AL  L F+ K+ A  V+K L SA+ANAE+N   D+D L 
Sbjct: 11  RTSAQKARLVADLIRGKKVAQALEILTFTNKKAAALVKKVLESAIANAEHNDGADIDDLK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           V++ +V +   MKR   R + R  RI++  S +TV+V +
Sbjct: 71  VAKIFVDEGPSMKRVMPRAKGRADRILKRTSHITVVVSD 109


>gi|317050533|ref|YP_004111649.1| 50S ribosomal protein L22 [Desulfurispirillum indicum S5]
 gi|316945617|gb|ADU65093.1| ribosomal protein L22 [Desulfurispirillum indicum S5]
          Length = 109

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 66/107 (61%), Gaps = 1/107 (0%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A A  +RVSP+K  LV   IRGK+V+DA   L+FS K  A +++K L SAVANA  N
Sbjct: 2   EVKAKARFVRVSPRKARLVIDQIRGKKVNDANNILKFSPKGAAEDIKKVLDSAVANAREN 61

Query: 76  HDL-DVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
             L ++D ++V+EAYV +   MKRF  R   R   I +  S +T+++
Sbjct: 62  FQLTNIDEMVVTEAYVDQGPTMKRFMPRAMGRAYEIKKRTSHITIVL 108


>gi|302344351|ref|YP_003808880.1| ribosomal protein L22 [Desulfarculus baarsii DSM 2075]
 gi|301640964|gb|ADK86286.1| ribosomal protein L22 [Desulfarculus baarsii DSM 2075]
          Length = 110

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 45/108 (41%), Positives = 65/108 (60%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A  +R+SP+K+ LVA  +RG +V +AL  L+F+ K+ AG + K + SA ANA  N
Sbjct: 2   EATAKAKFVRISPRKVRLVADAVRGMKVEEALNKLKFTPKKAAGLMAKVIHSAAANATQN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
             +DVD+L V  A+V     +KR+  R   R   I +  S +TV+V E
Sbjct: 62  SSIDVDKLYVKVAFVDGGPSLKRWRPRAMGRAFSIRKRTSHITVVVAE 109


>gi|116624197|ref|YP_826353.1| 50S ribosomal protein L22P [Candidatus Solibacter usitatus
           Ellin6076]
 gi|122253087|sp|Q01W97|RL22_SOLUE RecName: Full=50S ribosomal protein L22
 gi|116227359|gb|ABJ86068.1| LSU ribosomal protein L22P [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 113

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 67/113 (59%), Gaps = 4/113 (3%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN- 74
           +  A A  +RVSPQK  LV  +IRG++   AL  L  + KRIA  V K L SA+ANA N 
Sbjct: 2   QVKAEARYIRVSPQKARLVVDLIRGQQAGKALTTLRTTNKRIAPTVEKVLQSAIANATNR 61

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           N ++DVD+L V+EAYV +   MKR        +GR  R   RL  IV +V+++
Sbjct: 62  NENVDVDQLFVTEAYVNEGPRMKRVRPAP---MGRAYRYQRRLAHIVIKVTEK 111


>gi|256825881|ref|YP_003149841.1| 50S ribosomal protein L22P [Kytococcus sedentarius DSM 20547]
 gi|256689274|gb|ACV07076.1| LSU ribosomal protein L22P [Kytococcus sedentarius DSM 20547]
          Length = 125

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 69/117 (58%), Gaps = 5/117 (4%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A  +RV+P K   V  +IRGK+ S+ALA L+F+ +  +  V K L SA+ANA   
Sbjct: 2   EAKAQARYVRVTPMKARRVVDLIRGKQASEALAVLQFAPQGASEPVMKVLQSAIANARFM 61

Query: 76  HD-----LDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
            D      D   L++SEAYV +   MKRF  R + R  +I++  S +TV+V + +DE
Sbjct: 62  ADRDATAFDESSLVISEAYVDEGPSMKRFRPRAQGRASKILKRTSHITVLVSQETDE 118


>gi|319948718|ref|ZP_08022839.1| 50S ribosomal protein L22 [Dietzia cinnamea P4]
 gi|319437620|gb|EFV92619.1| 50S ribosomal protein L22 [Dietzia cinnamea P4]
          Length = 142

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 64/112 (57%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A A  +RV+P K   V  ++RGK  SDAL  L F+ +  +  V K L SA+ANAENN 
Sbjct: 18  ARATAKFVRVTPMKARRVIDLVRGKDASDALDILRFAPQAASEPVAKVLASAIANAENNL 77

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           DLD   L+V+ AY  +   +KRF  R + R  R+ +  S +TV V  V ++ 
Sbjct: 78  DLDPRTLVVTTAYADEGPTLKRFRPRAQGRAFRVRKRTSHITVEVTSVPEKA 129


>gi|299768671|ref|YP_003730697.1| 50S ribosomal protein L22 [Acinetobacter sp. DR1]
 gi|298698759|gb|ADI89324.1| 50S ribosomal protein L22 [Acinetobacter sp. DR1]
          Length = 109

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 60/96 (62%)

Query: 26  VSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLIV 85
           +S QK  LVA +IRGK V+ AL  L FS K+ A  V+K L SA+ANAE+N+ LDVD L V
Sbjct: 12  ISAQKARLVADLIRGKSVAHALNILNFSNKKAAVLVKKALESAIANAEHNNSLDVDDLKV 71

Query: 86  SEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           S  YV + V +KR   R + R  RI +    +TV V
Sbjct: 72  STIYVDEGVSLKRIMPRAKGRADRITKRTCHITVKV 107


>gi|78221851|ref|YP_383598.1| 50S ribosomal protein L22 [Geobacter metallireducens GS-15]
 gi|109893200|sp|Q39Y01|RL22_GEOMG RecName: Full=50S ribosomal protein L22
 gi|78193106|gb|ABB30873.1| LSU ribosomal protein L22P [Geobacter metallireducens GS-15]
          Length = 110

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 60/106 (56%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A  S  R+SP+K  LV  M+RG+ + DAL  L FS +  A  V K L SAVANAE  
Sbjct: 2   EARAKLSFARLSPRKTRLVVDMVRGRGIQDALTILRFSPQPSAKLVSKLLQSAVANAEQK 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              DVDRL V   +V     +KRF  R   R  +I +P S +TV++
Sbjct: 62  GASDVDRLFVKTIFVDAGPVLKRFTPRAMGRASKIRKPTSHVTVVL 107


>gi|262280220|ref|ZP_06058004.1| predicted protein [Acinetobacter calcoaceticus RUH2202]
 gi|262257998|gb|EEY76732.1| predicted protein [Acinetobacter calcoaceticus RUH2202]
          Length = 110

 Score = 77.4 bits (189), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 60/96 (62%)

Query: 26  VSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLIV 85
           +S QK  LVA +IRGK V+ AL  L FS K+ A  V+K L SA+ANAE+N+ LDVD L V
Sbjct: 13  ISAQKARLVADLIRGKSVAHALNILNFSNKKAAVLVKKALESAIANAEHNNSLDVDDLKV 72

Query: 86  SEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           S  YV + V +KR   R + R  RI +    +TV V
Sbjct: 73  STIYVDEGVSLKRIMPRAKGRADRITKRTCHITVKV 108


>gi|254281632|ref|ZP_04956600.1| ribosomal protein L22 [gamma proteobacterium NOR51-B]
 gi|219677835|gb|EED34184.1| ribosomal protein L22 [gamma proteobacterium NOR51-B]
          Length = 112

 Score = 77.4 bits (189), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 49/105 (46%), Positives = 64/105 (60%), Gaps = 3/105 (2%)

Query: 20  IASMLR---VSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           IA+ LR   +S QK+ LVA  +RGK V +AL  LEFS K+ A  VRK L SA+ANAENN 
Sbjct: 3   IAAKLRGASISAQKVRLVADQVRGKPVGEALNVLEFSPKKAAHLVRKLLNSAIANAENNE 62

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
             DVD L +S  +V + +  KR   R + R  RI++    +TV V
Sbjct: 63  GADVDELRISTIFVDEGITQKRMRARAKGRGDRILKRSCHITVKV 107


>gi|260891589|ref|ZP_05902852.1| hypothetical protein GCWU000323_02804 [Leptotrichia hofstadii
           F0254]
 gi|260858697|gb|EEX73197.1| ribosomal protein L22 [Leptotrichia hofstadii F0254]
          Length = 112

 Score = 77.4 bits (189), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 63/102 (61%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R+SPQK  LVA ++RGK    AL  L+F+ K+ A  + KTL SA+ANAE+N+++D D+L 
Sbjct: 11  RLSPQKARLVADIVRGKNALQALNILKFTNKKAALYIEKTLRSAIANAEHNNNMDPDKLF 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           +S+  + K   +KR   R   R   I +P + +TV V E  D
Sbjct: 71  ISKILIDKGPVLKRISPRAMGRADVIRKPTAHITVEVDERED 112


>gi|83591271|ref|YP_431280.1| 50S ribosomal protein L22P [Moorella thermoacetica ATCC 39073]
 gi|109893208|sp|Q2RFQ2|RL22_MOOTA RecName: Full=50S ribosomal protein L22
 gi|83574185|gb|ABC20737.1| LSU ribosomal protein L22P [Moorella thermoacetica ATCC 39073]
          Length = 112

 Score = 77.4 bits (189), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 70/113 (61%), Gaps = 4/113 (3%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  +R+SP+++  V  +IRGK V +A A L  + KR +  V K L SAVANAE+N
Sbjct: 2   EAKAVARYIRISPRRVRQVIDLIRGKGVREAEAILMVTPKRGSRVVAKVLKSAVANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCR--GRQRIGRIVRPFSRLTVIVREVSD 126
           +DLD   L+VS AYV +   +KR+  R  GR  I R  +  S +TV+V E  D
Sbjct: 62  YDLDASNLVVSRAYVDEGPTLKRYQPRAMGRANIRR--KRTSHITVVVGEKED 112


>gi|330720677|gb|EGG98920.1| LSU ribosomal protein L22p (L17e) [gamma proteobacterium IMCC2047]
          Length = 110

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 61/97 (62%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           ++S QK+ LVA  IRGK V +AL  L+FS K+ A  V+K L SAVANAE+N   D+D L 
Sbjct: 11  QISAQKVRLVADQIRGKDVGEALEILQFSNKKAAALVKKILDSAVANAEHNEGADIDELK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           VS  +V + + MKR   R + R  RI++    +TV V
Sbjct: 71  VSTVFVDEGMTMKRVKPRAKGRADRILKRSCHITVKV 107


>gi|119899701|ref|YP_934914.1| 50S ribosomal protein L22 [Azoarcus sp. BH72]
 gi|166220824|sp|A1KB22|RL22_AZOSB RecName: Full=50S ribosomal protein L22
 gi|119672114|emb|CAL96028.1| 50S ribosomal protein L22 [Azoarcus sp. BH72]
          Length = 109

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 47/108 (43%), Positives = 63/108 (58%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  AI   +R+S QK  LVA ++RGK V  AL  L FS K+ A  +RK + SA+ANAE+N
Sbjct: 2   ETKAILRGVRLSAQKGRLVADLVRGKSVDQALNILAFSPKKGAKIIRKVVESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
              D+D L V   YV +   +KRF  R + R  RI++P   + V V E
Sbjct: 62  DGADIDALKVKTIYVEEGTTLKRFTARAKGRGNRILKPTCHVFVTVGE 109


>gi|139438585|ref|ZP_01772101.1| Hypothetical protein COLAER_01099 [Collinsella aerofaciens ATCC
           25986]
 gi|133776124|gb|EBA39944.1| Hypothetical protein COLAER_01099 [Collinsella aerofaciens ATCC
           25986]
          Length = 123

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 63/107 (58%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
            E  A+A  +RVSP K  LV  +IR K V+ A   L F  + +A +V K L SAVANAEN
Sbjct: 11  TEVRAVAKYVRVSPSKARLVVDLIRRKPVAQAFDILHFCDRAVAVDVEKVLRSAVANAEN 70

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           N+ L  D L+V+ AYV +   +KR   R +    RI++  S +TV+V
Sbjct: 71  NNGLRADNLVVAAAYVDEGPTLKRIRPRAKGSASRILKRTSHITVVV 117


>gi|330430096|gb|AEC21430.1| 50S ribosomal protein L22 [Pusillimonas sp. T7-7]
          Length = 109

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 63/106 (59%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  AI   + +S QK  LVA +IRGK V+ AL  L F+ K+ AG ++K L SA+ANAE+N
Sbjct: 2   ETTAIIRGVHISAQKTRLVADLIRGKSVAQALNILTFTPKKAAGILKKALESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L V+  +V K+  MKRF  R + R  RI +    + V V
Sbjct: 62  DGADIDELKVTTIHVDKAQSMKRFSARAKGRGNRIEKQTCHIVVKV 107


>gi|222056700|ref|YP_002539062.1| ribosomal protein L22 [Geobacter sp. FRC-32]
 gi|254800439|sp|B9M6H3|RL22_GEOSF RecName: Full=50S ribosomal protein L22
 gi|221565989|gb|ACM21961.1| ribosomal protein L22 [Geobacter sp. FRC-32]
          Length = 111

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 47/108 (43%), Positives = 60/108 (55%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E+ A  S  R+SP+K  LV  M+RGK + +AL  L FS +  A  V K L SAVANAE  
Sbjct: 2   ESTAKLSFARLSPRKTRLVVDMVRGKGIQNALNTLRFSPQPSAKLVSKLLSSAVANAEQK 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
              DVDRL V   YV     +KRF  R   R  +I +P S + V++ E
Sbjct: 62  GVADVDRLYVKTIYVDGGTVLKRFVPRAMGRASKIRKPTSHICVVLAE 109


>gi|23476457|gb|AAN18256.1| 50S ribosomal protein L22 [Streptococcus pneumoniae]
          Length = 120

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 51/114 (44%), Positives = 66/114 (57%), Gaps = 8/114 (7%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A+A  +RVSP+K  LV   IRGK V+DA+A L F+  + A  + K L SAVANAENN 
Sbjct: 7   AKAMARTVRVSPRKSRLVLDNIRGKSVADAIAILTFTPNKAAEIILKVLNSAVANAENNF 66

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGR-------QRIGRIVRPFSRLTVIVRE 123
            LD   L+VSEA+  +   MKRF  R +       +R   I R  + +TV V E
Sbjct: 67  GLDKANLVVSEAFANEGPTMKRFRPRAKGSASPINKRTAHITR-TAHITVAVAE 119


>gi|257125041|ref|YP_003163155.1| ribosomal protein L22 [Leptotrichia buccalis C-1013-b]
 gi|257048980|gb|ACV38164.1| ribosomal protein L22 [Leptotrichia buccalis C-1013-b]
          Length = 112

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 63/102 (61%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R+SPQK  LVA ++RGK    AL  L+F+ K+ A  + KTL SA+ANAE+N+++D D+L 
Sbjct: 11  RLSPQKARLVADIVRGKNALQALNILKFTNKKAALYIEKTLRSAIANAEHNNNMDPDKLF 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           +S+  + K   +KR   R   R   I +P + +TV V E  D
Sbjct: 71  ISKILIDKGPVLKRISPRAMGRADIIRKPTAHITVEVDERED 112


>gi|254362069|ref|ZP_04978194.1| ribosomal protein L22 [Mannheimia haemolytica PHL213]
 gi|261493004|ref|ZP_05989546.1| ribosomal protein L22 [Mannheimia haemolytica serotype A2 str.
           BOVINE]
 gi|261495176|ref|ZP_05991639.1| ribosomal protein L22 [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|153093625|gb|EDN74590.1| ribosomal protein L22 [Mannheimia haemolytica PHL213]
 gi|261309152|gb|EEY10392.1| ribosomal protein L22 [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|261311348|gb|EEY12509.1| ribosomal protein L22 [Mannheimia haemolytica serotype A2 str.
           BOVINE]
          Length = 110

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 63/99 (63%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R S QK  LVA +IRGK+VS AL  L F+ K+ A  V+K L SA+ANAE+N   DVD L 
Sbjct: 11  RTSAQKARLVADLIRGKKVSVALEILTFTNKKAATLVKKVLESAIANAEHNDGADVDDLK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           V++ +V +   MKR   R + R  RI++  S +TV+V +
Sbjct: 71  VAKIFVDEGPSMKRVMPRAKGRADRILKRTSHITVVVSD 109


>gi|303250017|ref|ZP_07336219.1| 50S ribosomal protein L22 [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|307253449|ref|ZP_07535320.1| 50S ribosomal protein L22 [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|302651080|gb|EFL81234.1| 50S ribosomal protein L22 [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|306859128|gb|EFM91170.1| 50S ribosomal protein L22 [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
          Length = 110

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 63/99 (63%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R S QK  LVA +IRGK+V+ AL  L F+ K+ A  V+K L SA+ANAE+N   DVD L 
Sbjct: 11  RTSAQKARLVADLIRGKKVAQALEILTFTNKKAAALVKKVLESAIANAEHNDGADVDDLK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           V++ +V +   MKR   R + R  R+++  S +TV+V +
Sbjct: 71  VAKIFVDEGPSMKRVMPRAKGRADRVLKRTSHITVVVSD 109


>gi|257791919|ref|YP_003182525.1| 50S ribosomal protein L22 [Eggerthella lenta DSM 2243]
 gi|317489925|ref|ZP_07948417.1| ribosomal protein L22 [Eggerthella sp. 1_3_56FAA]
 gi|325829923|ref|ZP_08163381.1| ribosomal protein L22 [Eggerthella sp. HGA1]
 gi|257475816|gb|ACV56136.1| ribosomal protein L22 [Eggerthella lenta DSM 2243]
 gi|316910923|gb|EFV32540.1| ribosomal protein L22 [Eggerthella sp. 1_3_56FAA]
 gi|325488090|gb|EGC90527.1| ribosomal protein L22 [Eggerthella sp. HGA1]
          Length = 113

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 63/106 (59%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AIA  +RVSP+K  +V  +IRGK V  A   L+FS + IA  V KTL SAVANAEN 
Sbjct: 2   EAKAIARYVRVSPRKARIVIDLIRGKSVPAAREILQFSDRAIAEVVAKTLNSAVANAENQ 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           H +  + LIV  A+  +   +KR   R +    RI +  S +T+IV
Sbjct: 62  HHVRPETLIVKAAFADEGPTLKRIRPRAKGSASRIRKRTSHITIIV 107


>gi|56707483|ref|YP_169379.1| 50S ribosomal protein L22 [Francisella tularensis subsp. tularensis
           SCHU S4]
 gi|89255675|ref|YP_513036.1| 50S ribosomal protein L22 [Francisella tularensis subsp. holarctica
           LVS]
 gi|110669954|ref|YP_666511.1| 50S ribosomal protein L22 [Francisella tularensis subsp. tularensis
           FSC198]
 gi|118496857|ref|YP_897907.1| 50S ribosomal protein L22 [Francisella tularensis subsp. novicida
           U112]
 gi|134302580|ref|YP_001122551.1| 50S ribosomal protein L22 [Francisella tularensis subsp. tularensis
           WY96-3418]
 gi|156501625|ref|YP_001427690.1| 50S ribosomal protein L22 [Francisella tularensis subsp. holarctica
           FTNF002-00]
 gi|167009884|ref|ZP_02274815.1| 50S ribosomal protein L22 [Francisella tularensis subsp. holarctica
           FSC200]
 gi|187932138|ref|YP_001892123.1| 50S ribosomal protein L22 [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|290953207|ref|ZP_06557828.1| 50S ribosomal protein L22 [Francisella tularensis subsp. holarctica
           URFT1]
 gi|295313575|ref|ZP_06804164.1| 50S ribosomal protein L22 [Francisella tularensis subsp. holarctica
           URFT1]
 gi|81677112|sp|Q5NHW3|RL22_FRATT RecName: Full=50S ribosomal protein L22
 gi|109893199|sp|Q2A5G5|RL22_FRATH RecName: Full=50S ribosomal protein L22
 gi|122971066|sp|Q14JB5|RL22_FRAT1 RecName: Full=50S ribosomal protein L22
 gi|166199465|sp|A7N9T1|RL22_FRATF RecName: Full=50S ribosomal protein L22
 gi|166199466|sp|A0Q4I8|RL22_FRATN RecName: Full=50S ribosomal protein L22
 gi|166199467|sp|A4IZS9|RL22_FRATW RecName: Full=50S ribosomal protein L22
 gi|215274931|sp|Q0BNS2|RL22_FRATO RecName: Full=50S ribosomal protein L22
 gi|226733468|sp|B2SDY0|RL22_FRATM RecName: Full=50S ribosomal protein L22
 gi|54113559|gb|AAV29413.1| NT02FT0103 [synthetic construct]
 gi|56603975|emb|CAG44963.1| 50S ribosomal protein L22 [Francisella tularensis subsp. tularensis
           SCHU S4]
 gi|89143506|emb|CAJ78682.1| 50S ribosomal protein L22 [Francisella tularensis subsp. holarctica
           LVS]
 gi|110320287|emb|CAL08346.1| 50S ribosomal protein L22 [Francisella tularensis subsp. tularensis
           FSC198]
 gi|118422763|gb|ABK89153.1| 50S ribosomal protein L22 [Francisella novicida U112]
 gi|134050357|gb|ABO47428.1| ribosomal protein L22 [Francisella tularensis subsp. tularensis
           WY96-3418]
 gi|156252228|gb|ABU60734.1| ribosomal protein L22 [Francisella tularensis subsp. holarctica
           FTNF002-00]
 gi|187713047|gb|ACD31344.1| 50S ribosomal protein L22 [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|282158627|gb|ADA78018.1| 50S ribosomal protein L22 [Francisella tularensis subsp. tularensis
           NE061598]
 gi|328676326|gb|AEB27196.1| LSU ribosomal protein L22p (L17e) [Francisella cf. novicida Fx1]
          Length = 111

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 62/108 (57%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A     R+S QK  LVA  IRG  V  A+  L FS K+ A  ++  L SAVANAE+N
Sbjct: 2   EVQAKLKFARISAQKCRLVADQIRGLPVEQAINLLTFSNKKAAVLIKGVLNSAVANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
             +DVD L+VS  +V +   MKRF  R + R  RI++  S +TV V E
Sbjct: 62  DGMDVDSLVVSTIFVDEGPTMKRFEARAKGRGNRILKRTSHITVKVAE 109


>gi|21672765|ref|NP_660832.1| 50S ribosomal protein L22 [Buchnera aphidicola str. Sg (Schizaphis
           graminum)]
 gi|25009075|sp|Q8K955|RL22_BUCAP RecName: Full=50S ribosomal protein L22
 gi|21623412|gb|AAM68043.1| 50S ribosomal protein L22 [Buchnera aphidicola str. Sg (Schizaphis
           graminum)]
          Length = 110

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 63/99 (63%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R S QK+ L+A +IRGK+V  AL  L F+ K+ A  V+K L SA+ANAE+N  LDVD+L 
Sbjct: 11  RCSAQKIRLIADLIRGKKVPKALNILNFNNKKAAILVKKVLESALANAEHNDGLDVDQLR 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           +   +V +   MKR   R + R  RI++  S +TVIV +
Sbjct: 71  IKNIFVDEGSTMKRMMPRAKGRADRILKRTSHITVIVSD 109


>gi|296141110|ref|YP_003648353.1| ribosomal protein L22 [Tsukamurella paurometabola DSM 20162]
 gi|296029244|gb|ADG80014.1| ribosomal protein L22 [Tsukamurella paurometabola DSM 20162]
          Length = 136

 Score = 77.4 bits (189), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 64/113 (56%), Gaps = 2/113 (1%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A+A A  +RV+P K   V  ++RGK    ALA L F+ +  +  V K L SA+ANA+NN 
Sbjct: 15  ASATAKFVRVTPMKARRVIDLVRGKDAEQALAILRFAPQAASEPVAKVLASAIANAQNNL 74

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEGK 129
            LD   L+VSEAY  +   MKR   R + R  RI +  S +TV+V   S E K
Sbjct: 75  GLDPRTLVVSEAYANEGPTMKRIQPRAQGRAYRIRKRTSHITVVVE--SQESK 125


>gi|221069445|ref|ZP_03545550.1| ribosomal protein L22 [Comamonas testosteroni KF-1]
 gi|264676447|ref|YP_003276353.1| ribosomal protein L22 [Comamonas testosteroni CNB-2]
 gi|299531231|ref|ZP_07044642.1| 50S ribosomal protein L22 [Comamonas testosteroni S44]
 gi|220714468|gb|EED69836.1| ribosomal protein L22 [Comamonas testosteroni KF-1]
 gi|262206959|gb|ACY31057.1| ribosomal protein L22 [Comamonas testosteroni CNB-2]
 gi|298720814|gb|EFI61760.1| 50S ribosomal protein L22 [Comamonas testosteroni S44]
          Length = 110

 Score = 77.4 bits (189), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 64/107 (59%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
           +E  A+   +R+S  K  LVA +IRGK+V  AL  L+F++K+ A  V+K L SA+ANAE+
Sbjct: 2   SETRAVLRGVRLSVDKGRLVADLIRGKKVDQALNILQFTQKKAAVIVKKVLESAIANAEH 61

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           N   D+D L V   YV +   +KRF  R + R  RI +P   + V V
Sbjct: 62  NDGADIDELKVKTIYVEQGTTLKRFTARAKGRGNRISKPTCHIYVTV 108


>gi|56416998|ref|YP_154072.1| 50S ribosomal protein L22 [Anaplasma marginale str. St. Maries]
 gi|222475366|ref|YP_002563783.1| 50S ribosomal subunit L22 (rplV) [Anaplasma marginale str. Florida]
 gi|254995174|ref|ZP_05277364.1| 50S ribosomal protein L22 [Anaplasma marginale str. Mississippi]
 gi|255003348|ref|ZP_05278312.1| 50S ribosomal protein L22 [Anaplasma marginale str. Puerto Rico]
 gi|255004472|ref|ZP_05279273.1| 50S ribosomal protein L22 [Anaplasma marginale str. Virginia]
 gi|81358975|sp|Q5PA63|RL22_ANAMM RecName: Full=50S ribosomal protein L22
 gi|254800415|sp|B9KJ65|RL22_ANAMF RecName: Full=50S ribosomal protein L22
 gi|56388230|gb|AAV86817.1| 50S ribosomal subunit L22 [Anaplasma marginale str. St. Maries]
 gi|222419504|gb|ACM49527.1| 50S ribosomal subunit L22 (rplV) [Anaplasma marginale str. Florida]
          Length = 112

 Score = 77.4 bits (189), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 61/97 (62%), Gaps = 7/97 (7%)

Query: 22  SMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVD 81
           S LR +P KLNLVA +IRG+ VS A+  L+F RK+ A  V K L SAVANA  N+D+D+D
Sbjct: 10  SGLRSTPSKLNLVADLIRGQDVSTAVMYLKFCRKKAAFLVGKVLKSAVANARANYDVDLD 69

Query: 82  RLIVSEAYVGKSVFMKRFH-------CRGRQRIGRIV 111
            L V E  VGKS  ++R         CR R+R G +V
Sbjct: 70  SLYVKEVLVGKSFTLRRVRPRARGRACRIRKRYGSVV 106


>gi|58583201|ref|YP_202217.1| 50S ribosomal protein L22 [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84625039|ref|YP_452411.1| 50S ribosomal protein L22 [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|166710836|ref|ZP_02242043.1| 50S ribosomal protein L22 [Xanthomonas oryzae pv. oryzicola BLS256]
 gi|289665142|ref|ZP_06486723.1| 50S ribosomal protein L22 [Xanthomonas campestris pv. vasculorum
           NCPPB702]
 gi|325916492|ref|ZP_08178761.1| LSU ribosomal protein L22P [Xanthomonas vesicatoria ATCC 35937]
 gi|325921486|ref|ZP_08183341.1| LSU ribosomal protein L22P [Xanthomonas gardneri ATCC 19865]
 gi|75508101|sp|Q5GWT9|RL22_XANOR RecName: Full=50S ribosomal protein L22
 gi|109893255|sp|Q2NZZ0|RL22_XANOM RecName: Full=50S ribosomal protein L22
 gi|58427795|gb|AAW76832.1| 50S ribosomal protein L22 [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84368979|dbj|BAE70137.1| 50S ribosomal protein L22 [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|325537281|gb|EGD09008.1| LSU ribosomal protein L22P [Xanthomonas vesicatoria ATCC 35937]
 gi|325548033|gb|EGD19032.1| LSU ribosomal protein L22P [Xanthomonas gardneri ATCC 19865]
          Length = 113

 Score = 77.4 bits (189), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 62/106 (58%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AI    R+SPQK  LVA  +RG     A+  L+FS K+ A  ++K + SA+ANAENN
Sbjct: 4   EAKAILRTARISPQKARLVADQVRGLSAERAVNLLKFSDKKAAHLIKKVVESAIANAENN 63

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              DVD L V    V +   +KRF  R + R  RI++  S +TVIV
Sbjct: 64  QGADVDELKVKTIMVDEGPSLKRFMARAKGRGTRILKRTSHITVIV 109


>gi|317153953|ref|YP_004122001.1| 50S ribosomal protein L22 [Desulfovibrio aespoeensis Aspo-2]
 gi|316944204|gb|ADU63255.1| ribosomal protein L22 [Desulfovibrio aespoeensis Aspo-2]
          Length = 110

 Score = 77.4 bits (189), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 64/109 (58%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  +RVSP+K  +VA  I+GK V DAL  L F+ K+ A  + K L SA++NAE  
Sbjct: 2   EAKAVAKYIRVSPRKTRIVAENIKGKGVEDALNILRFTPKKAAKILSKVLFSAISNAEQM 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV 124
             +DVD LIV    V +    KR   R   R  RI +  S +T++V+E+
Sbjct: 62  PGVDVDSLIVDTVMVNEGPSWKRIQPRAMGRAYRIRKRTSHITIVVKEM 110


>gi|188575495|ref|YP_001912424.1| 50S ribosomal protein L22 [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|289669349|ref|ZP_06490424.1| 50S ribosomal protein L22 [Xanthomonas campestris pv. musacearum
           NCPPB4381]
 gi|226734753|sp|B2SQR5|RL22_XANOP RecName: Full=50S ribosomal protein L22
 gi|188519947|gb|ACD57892.1| ribosomal protein L22 [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 111

 Score = 77.4 bits (189), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 62/106 (58%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AI    R+SPQK  LVA  +RG     A+  L+FS K+ A  ++K + SA+ANAENN
Sbjct: 2   EAKAILRTARISPQKARLVADQVRGLSAERAVNLLKFSDKKAAHLIKKVVESAIANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              DVD L V    V +   +KRF  R + R  RI++  S +TVIV
Sbjct: 62  QGADVDELKVKTIMVDEGPSLKRFMARAKGRGTRILKRTSHITVIV 107


>gi|6729761|pdb|1BXE|A Chain A, Ribosomal Protein L22 From Thermus Thermophilus
          Length = 113

 Score = 77.4 bits (189), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 64/108 (59%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AIA  +R+SP+K+ LV  +IRGK + +A   L ++ KR A  V K L SA ANA NN
Sbjct: 2   EAKAIARYVRISPRKVRLVVDLIRGKSLEEARNILRYTNKRGAYFVAKVLESAAANAVNN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           HD   DRL V  AYV +   +KR   R R R   I +  S +TVI+ E
Sbjct: 62  HDXLEDRLYVKAAYVDEGPALKRVLPRARGRADIIKKRTSHITVILGE 109


>gi|59710848|ref|YP_203624.1| 50S ribosomal protein L22 [Vibrio fischeri ES114]
 gi|197334104|ref|YP_002155001.1| ribosomal protein L22 [Vibrio fischeri MJ11]
 gi|75507110|sp|Q5E8B0|RL22_VIBF1 RecName: Full=50S ribosomal protein L22
 gi|226734750|sp|B5FG14|RL22_VIBFM RecName: Full=50S ribosomal protein L22
 gi|59478949|gb|AAW84736.1| 50S ribosomal subunit protein L22 [Vibrio fischeri ES114]
 gi|197315594|gb|ACH65041.1| ribosomal protein L22 [Vibrio fischeri MJ11]
          Length = 110

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 60/96 (62%)

Query: 26  VSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLIV 85
           +SPQK  LVA  +RGK V  AL  L FS K+ A  V+K L SA+ANAE+N   D+D L V
Sbjct: 12  ISPQKARLVADQVRGKSVDQALEILTFSNKKAAVLVKKVLESAIANAEHNEGADIDDLNV 71

Query: 86  SEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           ++ +V +   MKR   R + R  RI++  S +T++V
Sbjct: 72  AKIFVDEGPIMKRIMPRAKGRADRILKRSSHITIVV 107


>gi|50086210|ref|YP_047720.1| 50S ribosomal protein L22 [Acinetobacter sp. ADP1]
 gi|81695747|sp|Q6F7R7|RL22_ACIAD RecName: Full=50S ribosomal protein L22
 gi|49532186|emb|CAG69898.1| 50S ribosomal protein L22 [Acinetobacter sp. ADP1]
          Length = 110

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 60/96 (62%)

Query: 26  VSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLIV 85
           +S QK  LVA +IRGK V+ AL  L FS K+ A  V+K L SA+ANAE+N+ LDVD L V
Sbjct: 13  ISAQKARLVADLIRGKSVAHALNILNFSNKKAAVLVKKALESAIANAEHNNSLDVDDLKV 72

Query: 86  SEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           S  YV + + +KR   R + R  RI +    +TV V
Sbjct: 73  STIYVDEGISLKRIMPRAKGRADRITKRTCHITVKV 108


>gi|95931438|ref|ZP_01314144.1| ribosomal protein L22 [Desulfuromonas acetoxidans DSM 684]
 gi|95132506|gb|EAT14199.1| ribosomal protein L22 [Desulfuromonas acetoxidans DSM 684]
          Length = 110

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 64/109 (58%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A    +R+SPQK  LV  MIRGK V +AL  L FS ++ AG V + + SAVANAE  
Sbjct: 2   EAKAKLRFVRMSPQKARLVVDMIRGKNVQEALNILRFSPQKPAGIVAELVKSAVANAEQK 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV 124
              DVD+L V    V +   +KRF  R + R  +I +P S + V++ E+
Sbjct: 62  GVADVDKLYVKTITVDQGPALKRFIPRAQGRASKIRKPTSHVQVVLDEI 110


>gi|328953153|ref|YP_004370487.1| ribosomal protein L22 [Desulfobacca acetoxidans DSM 11109]
 gi|328453477|gb|AEB09306.1| ribosomal protein L22 [Desulfobacca acetoxidans DSM 11109]
          Length = 110

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 45/108 (41%), Positives = 63/108 (58%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A A  + +SPQK+ LV   I+ K+V +AL  L+F  K+ A  VR+ + SAVANA   
Sbjct: 2   EIRAQAKFVHISPQKVRLVTRAIKDKKVDEALGALQFIPKKAARLVRRLVESAVANASQR 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
             +DVD L +  AYV     +KRF  R   R+ RIV+  S +TV++ E
Sbjct: 62  SQVDVDSLFIKRAYVDGGPSLKRFMSRAMGRVNRIVKRTSHITVVLDE 109


>gi|260893367|ref|YP_003239464.1| ribosomal protein L22 [Ammonifex degensii KC4]
 gi|260865508|gb|ACX52614.1| ribosomal protein L22 [Ammonifex degensii KC4]
          Length = 116

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 48/112 (42%), Positives = 64/112 (57%)

Query: 12  MGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVAN 71
           M   EA A A  +R+SP K   V  +IRGKRV +A A L F+ ++ A  + K L SAVAN
Sbjct: 1   MNGKEARATAKYVRISPFKARQVIDLIRGKRVDEAFAILRFTPRKAARLIEKVLRSAVAN 60

Query: 72  AENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           AE+N+DL    L+V  AYV +   +KR+  R   R     R  S +TV+V E
Sbjct: 61  AEHNYDLIASELVVLRAYVDEGPTLKRYRPRAYGRADLRRRRTSHITVVVGE 112


>gi|15603275|ref|NP_246349.1| 50S ribosomal protein L22 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|51316915|sp|Q9CL36|RL22_PASMU RecName: Full=50S ribosomal protein L22
 gi|12721785|gb|AAK03494.1| RpL22 [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 110

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 63/99 (63%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R S QK  LVA +IRGK+V+ AL  L F+ K+ A  V+K L SA+ANAE+N   D+D L 
Sbjct: 11  RTSAQKARLVADLIRGKKVAAALEILTFTNKKAAALVKKVLESAIANAEHNDGADIDDLK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           V++ +V +   MKR   R + R  RI++  S +TV+V +
Sbjct: 71  VAKIFVDEGPSMKRVMPRAKGRADRILKRTSHITVVVSD 109


>gi|257042497|gb|ACV32784.1| 50S ribosomal protein L22 [Streptococcus pneumoniae]
          Length = 111

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 49/107 (45%), Positives = 64/107 (59%), Gaps = 3/107 (2%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A+A  +RVSP+K  LV   IRGK V+DA+A L F+  + A  + K L SAVANAENN 
Sbjct: 7   AKAMARTVRVSPRKSRLVLDNIRGKSVADAIAILTFTPNKAAEIILKVLNSAVANAENNF 66

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            LD   L+VSEA+  +   MKRF  R +   G   +  + +TV V E
Sbjct: 67  GLDKANLVVSEAFANEGPTMKRFRPRAK---GSASKRTAHITVAVAE 110


>gi|164686532|ref|ZP_02210560.1| hypothetical protein CLOBAR_00099 [Clostridium bartlettii DSM
           16795]
 gi|164604401|gb|EDQ97866.1| hypothetical protein CLOBAR_00099 [Clostridium bartlettii DSM
           16795]
          Length = 111

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 67/108 (62%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA +IA  +RVSP+K   V +++RGK V +ALA L+F+ +  A  + K + SA ANAENN
Sbjct: 2   EARSIAKYVRVSPRKAGQVCSLVRGKNVDEALAILKFTPRGAADIIAKVVKSAKANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           H++D D+L ++     +   +KRF  R + R   I +  S + V+++E
Sbjct: 62  HEMDADKLYIASIVANQGPTIKRFMPRAQGRATMIRKRTSHIEVVLKE 109


>gi|113460213|ref|YP_718270.1| 50S ribosomal protein L22 [Haemophilus somnus 129PT]
 gi|123131901|sp|Q0I158|RL22_HAES1 RecName: Full=50S ribosomal protein L22
 gi|112822256|gb|ABI24345.1| LSU ribosomal protein L22P [Haemophilus somnus 129PT]
          Length = 110

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 63/99 (63%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R S QK  LVA ++RGK+V+ AL  L F+ K+ A  V+K L SA+ANAE+N   D+D L 
Sbjct: 11  RTSAQKARLVADLVRGKKVAQALEILTFTNKKAAALVKKVLESAIANAEHNDGADIDDLK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           V++ +V +   MKR   R + R  RI++  S +TV+V +
Sbjct: 71  VAKIFVDEGPSMKRVMPRAKGRADRILKRTSHITVVVSD 109


>gi|94500988|ref|ZP_01307513.1| ribosomal protein L22 [Oceanobacter sp. RED65]
 gi|94426928|gb|EAT11911.1| ribosomal protein L22 [Oceanobacter sp. RED65]
          Length = 110

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 49/109 (44%), Positives = 65/109 (59%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A   M R+S QK  LVA  IRGK V++AL  L FS ++ A  ++K L SA+ANAE+N
Sbjct: 2   ETVAKLKMARISAQKARLVADQIRGKSVAEALNILTFSPRKGADLLKKVLESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV 124
              DVD L VS  +V + + MKR   R + R  RI++    +TV V EV
Sbjct: 62  DGADVDELKVSTVFVDEGMTMKRIRPRAKGRADRILKRTCHITVKVAEV 110


>gi|218135276|ref|ZP_03464080.1| hypothetical protein BACPEC_03181 [Bacteroides pectinophilus ATCC
           43243]
 gi|217990661|gb|EEC56672.1| hypothetical protein BACPEC_03181 [Bacteroides pectinophilus ATCC
           43243]
          Length = 128

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 69/125 (55%), Gaps = 3/125 (2%)

Query: 2   SGKRSVSKRR---MGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIA 58
           SG RS  KR    + D   +A  S  RVS QK   V   IRGK V+ AL  + ++ +  +
Sbjct: 3   SGHRSKIKRERNAVKDTRPSAKLSYARVSVQKACFVLDAIRGKDVATALGIVTYNPRYAS 62

Query: 59  GEVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLT 118
             ++K L SA+ANAENN+ +D  +L + E Y  K   MKR H R + R  RI +  S +T
Sbjct: 63  SLIKKLLESAIANAENNNGMDPSKLYIEECYANKGPTMKRIHPRAQGRAYRIEKRMSHIT 122

Query: 119 VIVRE 123
           +++ E
Sbjct: 123 IVLNE 127


>gi|296449794|ref|ZP_06891563.1| 50S ribosomal protein L22 [Clostridium difficile NAP08]
 gi|296261392|gb|EFH08218.1| 50S ribosomal protein L22 [Clostridium difficile NAP08]
          Length = 119

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 64/108 (59%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A  +RVSP+K   +  ++RGK V +ALA L+F+ +  A  + K + SA ANAENN
Sbjct: 10  EAKATAKYVRVSPRKAGQICDLVRGKNVDEALAILKFTPRGAASIIAKVVKSAKANAENN 69

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           H++D ++L ++     +   MKRF  R   R   I +  S + V+V+E
Sbjct: 70  HEMDTEKLYIASIVANQGPTMKRFMPRAMGRATTIRKRTSHIEVVVKE 117


>gi|269122576|ref|YP_003310753.1| ribosomal protein L22 [Sebaldella termitidis ATCC 33386]
 gi|268616454|gb|ACZ10822.1| ribosomal protein L22 [Sebaldella termitidis ATCC 33386]
          Length = 111

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 61/99 (61%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R+SPQK  LVA ++RGK    ALA L+F+ K+ A  + KTL SA+ANAE+N  +D D+L 
Sbjct: 11  RLSPQKARLVADIVRGKDALPALAMLKFTNKKAAVYIEKTLKSAIANAEHNFGMDPDKLY 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           VS   + K   +KR + R   R   I +P + +TV V E
Sbjct: 71  VSRILIDKGPVLKRVNPRAMGRADIIRKPTAHITVEVSE 109


>gi|127511097|ref|YP_001092294.1| 50S ribosomal protein L22 [Shewanella loihica PV-4]
 gi|166221995|sp|A3Q987|RL22_SHELP RecName: Full=50S ribosomal protein L22
 gi|126636392|gb|ABO22035.1| LSU ribosomal protein L22P [Shewanella loihica PV-4]
          Length = 110

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 60/99 (60%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R SPQK  LVA  IRG  V+ AL  L FS K+ A  V+K L SA+ANAE+N   D+D L 
Sbjct: 11  RTSPQKCRLVADQIRGLPVAKALEILTFSPKKAAVLVKKVLDSAIANAEHNEGADIDELK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           V + +V +   MKR   R + R  RI++  S +TV+V +
Sbjct: 71  VGKVFVDEGPTMKRIMPRAKGRADRIIKRTSHITVVVSD 109


>gi|257784958|ref|YP_003180175.1| 50S ribosomal protein L22 [Atopobium parvulum DSM 20469]
 gi|257473465|gb|ACV51584.1| ribosomal protein L22 [Atopobium parvulum DSM 20469]
          Length = 120

 Score = 77.0 bits (188), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 63/106 (59%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A A  +RV+P+K   V A++RGK V  AL  L+FS +  A +V K L SAVANAENN
Sbjct: 9   EVRATAKYVRVAPRKARAVVALVRGKSVEKALEVLQFSTRAAATDVAKVLRSAVANAENN 68

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           + L  + L+V  A+V +   +KR   R +    RI +  S +TV+V
Sbjct: 69  NGLRANNLVVKTAFVDEGPTLKRIRPRAKGSASRINKRMSHITVVV 114


>gi|302869967|ref|YP_003838604.1| 50S ribosomal protein L22 [Micromonospora aurantiaca ATCC 27029]
 gi|315501428|ref|YP_004080315.1| ribosomal protein l22 [Micromonospora sp. L5]
 gi|302572826|gb|ADL49028.1| ribosomal protein L22 [Micromonospora aurantiaca ATCC 27029]
 gi|315408047|gb|ADU06164.1| ribosomal protein L22 [Micromonospora sp. L5]
          Length = 149

 Score = 77.0 bits (188), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 42/94 (44%), Positives = 58/94 (61%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A+A  +R+SP K   V  ++RG    +AL  L+F+ +  + +V K L SA+ANAENN 
Sbjct: 13  ARAVARHVRISPMKARRVVNLVRGLPAKEALTVLQFAPQAASEQVYKVLASAIANAENNE 72

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRI 110
            LD D L+VSEA+V +   MKRF  R + R  RI
Sbjct: 73  RLDPDALLVSEAFVDEGPTMKRFRPRAQGRAYRI 106


>gi|239905863|ref|YP_002952602.1| 50S ribosomal protein L22 [Desulfovibrio magneticus RS-1]
 gi|259646243|sp|C4XLX8|RL22_DESMR RecName: Full=50S ribosomal protein L22
 gi|239795727|dbj|BAH74716.1| 50S ribosomal protein L22 [Desulfovibrio magneticus RS-1]
          Length = 110

 Score = 77.0 bits (188), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 47/108 (43%), Positives = 63/108 (58%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AIA  +R+SPQK  LVAA I G+ V +A+  L+F+ K+ A  + K L SAVANAE  
Sbjct: 2   EAKAIAKYIRLSPQKARLVAANILGRPVEEAMNILKFTPKKSAKIIGKVLHSAVANAEQI 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
             +D+D L V +  +      KR   R   R  RIV+  S +TV+V E
Sbjct: 62  SGVDIDNLTVKQVIINPGPTHKRIMTRSMGRAFRIVKRTSHITVVVAE 109


>gi|190572949|ref|YP_001970794.1| 50S ribosomal protein L22 [Stenotrophomonas maltophilia K279a]
 gi|226733516|sp|B2FQ50|RL22_STRMK RecName: Full=50S ribosomal protein L22
 gi|190010871|emb|CAQ44480.1| putative 50S ribosomal protein L22 [Stenotrophomonas maltophilia
           K279a]
          Length = 113

 Score = 77.0 bits (188), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 62/106 (58%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AI    R+SPQK  LVA  +RG     A+  L+FS K+ A  ++K + SA+ANAENN
Sbjct: 4   EAKAILRTARISPQKARLVADQVRGLPAERAVNLLKFSDKKAAHLIKKVVESAIANAENN 63

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              DVD L V    V +   +KRF  R + R  RI++  S +TV+V
Sbjct: 64  QGADVDELKVQTIMVDEGPTLKRFMARAKGRGTRILKRTSHITVVV 109


>gi|227501139|ref|ZP_03931188.1| ribosomal protein L22 [Anaerococcus tetradius ATCC 35098]
 gi|227216724|gb|EEI82125.1| ribosomal protein L22 [Anaerococcus tetradius ATCC 35098]
          Length = 115

 Score = 77.0 bits (188), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 43/111 (38%), Positives = 66/111 (59%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  AIA   R+SP K++ +A  IRGK+V +AL  L F+ K+ A  +   L SA+ANAENN
Sbjct: 2   EVKAIAKYQRISPLKVHYIAREIRGKQVDEALNILRFTNKKGAKLLSDVLKSAIANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           + LD   L V +AY   +  MKR+H + +     I++  S + V++ ++ D
Sbjct: 62  NGLDRANLYVKKAYANDAPTMKRWHPKAKGAAYPILKRSSHIGVVLADIED 112


>gi|33152953|ref|NP_874306.1| 50S ribosomal protein L22 [Haemophilus ducreyi 35000HP]
 gi|51316361|sp|Q7VKD6|RL22_HAEDU RecName: Full=50S ribosomal protein L22
 gi|33149178|gb|AAP96695.1| 50S ribosomal protein L22 [Haemophilus ducreyi 35000HP]
          Length = 110

 Score = 77.0 bits (188), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 63/99 (63%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R S QK  LVA +IRGK+V+ AL  L F+ K+ +  V+K L SA+ANAE+N   DVD L 
Sbjct: 11  RTSAQKARLVADLIRGKKVAQALEILTFTNKKASALVKKVLESAIANAEHNDGADVDDLK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           V++ +V +   MKR   R + R  RI++  S +TV+V +
Sbjct: 71  VAKIFVDEGPSMKRVMPRAKGRADRILKRTSHITVVVSD 109


>gi|238061116|ref|ZP_04605825.1| 50S ribosomal protein L22 [Micromonospora sp. ATCC 39149]
 gi|237882927|gb|EEP71755.1| 50S ribosomal protein L22 [Micromonospora sp. ATCC 39149]
          Length = 152

 Score = 77.0 bits (188), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 42/94 (44%), Positives = 58/94 (61%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A+A  +R+SP K   V  ++RG    +AL  L+F+ +  + +V K L SA+ANAENN 
Sbjct: 13  ARAVARHVRISPMKARRVVNLVRGLPAKEALTVLQFAPQAASEQVYKVLASAIANAENNE 72

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRI 110
            LD D L+VSEA+V +   MKRF  R + R  RI
Sbjct: 73  RLDPDALLVSEAFVDEGPTMKRFRPRAQGRAYRI 106


>gi|311109607|ref|YP_003982460.1| 50S ribosomal protein L22 [Achromobacter xylosoxidans A8]
 gi|310764296|gb|ADP19745.1| ribosomal protein L22 [Achromobacter xylosoxidans A8]
          Length = 109

 Score = 76.6 bits (187), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 63/106 (59%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  AI   + +S QK  LVA +IRGK VS AL  L FS K+ A  ++K + SA+ANAE+N
Sbjct: 2   ETTAIIRGVHISAQKTRLVADLIRGKSVSQALNILTFSPKKAAVILKKAVESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L V+  +V K+  MKRF  R + R  RI +    +TV V
Sbjct: 62  DGADIDELKVTTIFVDKAQSMKRFSARAKGRGNRIEKQTCHITVKV 107


>gi|313673462|ref|YP_004051573.1| LSU ribosomal protein l22p [Calditerrivibrio nitroreducens DSM
           19672]
 gi|312940218|gb|ADR19410.1| LSU ribosomal protein L22P [Calditerrivibrio nitroreducens DSM
           19672]
          Length = 110

 Score = 76.6 bits (187), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 47/108 (43%), Positives = 67/108 (62%), Gaps = 1/108 (0%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           + A+A  +RVSP+K  LVA ++RGK V +A+A L+F+ K+ A E+ KTL SAVANAE N 
Sbjct: 3   SKAVARYIRVSPRKARLVADLVRGKTVDEAMALLKFTTKKAAQEIYKTLKSAVANAEENK 62

Query: 77  DL-DVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           ++ +V  L + E  V    F KR+  R   R   I R  S +TV++ E
Sbjct: 63  NVRNVSNLKLLEVKVDGGPFYKRYMPRAYGRASLIKRRTSHITVVLGE 110


>gi|161506013|ref|YP_001573125.1| 50S ribosomal protein L22 [Salmonella enterica subsp. arizonae
           serovar 62:z4,z23:-- str. RSK2980]
 gi|237728650|ref|ZP_04559131.1| 50S ribosomal protein L22 [Citrobacter sp. 30_2]
 gi|283835732|ref|ZP_06355473.1| hypothetical protein CIT292_10124 [Citrobacter youngae ATCC 29220]
 gi|189041963|sp|A9MN53|RL22_SALAR RecName: Full=50S ribosomal protein L22
 gi|160867360|gb|ABX23983.1| hypothetical protein SARI_04194 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
 gi|226909272|gb|EEH95190.1| 50S ribosomal protein L22 [Citrobacter sp. 30_2]
 gi|291068411|gb|EFE06520.1| ribosomal protein L22 [Citrobacter youngae ATCC 29220]
          Length = 110

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 64/99 (64%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R S QK+ LVA +IRGK+VS AL  L ++ K+ A  V+K L SA+ANAE+N   D+D L 
Sbjct: 11  RSSAQKVRLVADLIRGKKVSQALDILTYTNKKAAVLVKKVLESAIANAEHNDGADIDDLK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           V++ +V +   MKR   R + R  RI++  S +TV+V +
Sbjct: 71  VTKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSD 109


>gi|226939191|ref|YP_002794262.1| 50S ribosomal protein L22 [Laribacter hongkongensis HLHK9]
 gi|254800443|sp|C1DAS2|RL22_LARHH RecName: Full=50S ribosomal protein L22
 gi|226714115|gb|ACO73253.1| RplV [Laribacter hongkongensis HLHK9]
          Length = 109

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 62/104 (59%)

Query: 18  NAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHD 77
           +A+    RVS QK  LVA +IRGK V  AL  L F+ K+ A  ++K L SA+ANAE+N  
Sbjct: 4   SAVLKNARVSAQKARLVADLIRGKSVEQALNTLTFTPKKSAVLMKKVLESAIANAEHNEG 63

Query: 78  LDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
            D+D L V+  YV K   +KRF  R + R  RI +    +T++V
Sbjct: 64  ADIDTLKVATVYVDKGPSLKRFTARAKGRGNRIEKQTCHITLVV 107


>gi|194364539|ref|YP_002027149.1| 50S ribosomal protein L22 [Stenotrophomonas maltophilia R551-3]
 gi|254522094|ref|ZP_05134149.1| ribosomal protein L22 [Stenotrophomonas sp. SKA14]
 gi|226733515|sp|B4SKW8|RL22_STRM5 RecName: Full=50S ribosomal protein L22
 gi|194347343|gb|ACF50466.1| ribosomal protein L22 [Stenotrophomonas maltophilia R551-3]
 gi|219719685|gb|EED38210.1| ribosomal protein L22 [Stenotrophomonas sp. SKA14]
          Length = 111

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 62/106 (58%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AI    R+SPQK  LVA  +RG     A+  L+FS K+ A  ++K + SA+ANAENN
Sbjct: 2   EAKAILRTARISPQKARLVADQVRGLPAERAVNLLKFSDKKAAHLIKKVVESAIANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              DVD L V    V +   +KRF  R + R  RI++  S +TV+V
Sbjct: 62  QGADVDELKVQTIMVDEGPTLKRFMARAKGRGTRILKRTSHITVVV 107


>gi|15803842|ref|NP_289876.1| 50S ribosomal protein L22 [Escherichia coli O157:H7 EDL933]
 gi|15833434|ref|NP_312207.1| 50S ribosomal protein L22 [Escherichia coli O157:H7 str. Sakai]
 gi|16131194|ref|NP_417774.1| 50S ribosomal subunit protein L22 [Escherichia coli str. K-12
           substr. MG1655]
 gi|16762848|ref|NP_458465.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|16766724|ref|NP_462339.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|26249906|ref|NP_755946.1| 50S ribosomal protein L22 [Escherichia coli CFT073]
 gi|29144335|ref|NP_807677.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56415354|ref|YP_152429.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|74313834|ref|YP_312253.1| 50S ribosomal protein L22 [Shigella sonnei Ss046]
 gi|82545678|ref|YP_409625.1| 50S ribosomal protein L22 [Shigella boydii Sb227]
 gi|82778611|ref|YP_404960.1| 50S ribosomal protein L22 [Shigella dysenteriae Sd197]
 gi|89110695|ref|AP_004475.1| 50S ribosomal subunit protein L22 [Escherichia coli str. K-12
           substr. W3110]
 gi|91212749|ref|YP_542735.1| 50S ribosomal protein L22 [Escherichia coli UTI89]
 gi|110643554|ref|YP_671284.1| 50S ribosomal protein L22 [Escherichia coli 536]
 gi|117625594|ref|YP_858917.1| 50S ribosomal protein L22 [Escherichia coli APEC O1]
 gi|156932239|ref|YP_001436155.1| 50S ribosomal protein L22 [Cronobacter sakazakii ATCC BAA-894]
 gi|157148892|ref|YP_001456211.1| 50S ribosomal protein L22 [Citrobacter koseri ATCC BAA-895]
 gi|157155565|ref|YP_001464783.1| 50S ribosomal protein L22 [Escherichia coli E24377A]
 gi|157162789|ref|YP_001460107.1| 50S ribosomal protein L22 [Escherichia coli HS]
 gi|161616461|ref|YP_001590426.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Paratyphi B str. SPB7]
 gi|170018449|ref|YP_001723403.1| 50S ribosomal protein L22 [Escherichia coli ATCC 8739]
 gi|170082834|ref|YP_001732154.1| 50S ribosomal subunit protein L22 [Escherichia coli str. K-12
           substr. DH10B]
 gi|170683646|ref|YP_001745577.1| 50S ribosomal protein L22 [Escherichia coli SMS-3-5]
 gi|170769548|ref|ZP_02904001.1| ribosomal protein L22 [Escherichia albertii TW07627]
 gi|187733467|ref|YP_001881999.1| 50S ribosomal protein L22 [Shigella boydii CDC 3083-94]
 gi|188496232|ref|ZP_03003502.1| ribosomal protein L22 [Escherichia coli 53638]
 gi|189010796|ref|ZP_02809363.2| ribosomal protein L22 [Escherichia coli O157:H7 str. EC4076]
 gi|189401787|ref|ZP_02778088.2| ribosomal protein L22 [Escherichia coli O157:H7 str. EC4401]
 gi|189403229|ref|ZP_02794186.2| ribosomal protein L22 [Escherichia coli O157:H7 str. EC4486]
 gi|189404726|ref|ZP_02810139.2| ribosomal protein L22 [Escherichia coli O157:H7 str. EC869]
 gi|191174670|ref|ZP_03036145.1| ribosomal protein L22 [Escherichia coli F11]
 gi|194444021|ref|YP_002042685.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194449195|ref|YP_002047458.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194469110|ref|ZP_03075094.1| ribosomal protein L22 [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|194736097|ref|YP_002116377.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|195874423|ref|ZP_02701843.2| ribosomal protein L22 [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|197248946|ref|YP_002148354.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197264881|ref|ZP_03164955.1| ribosomal protein L22 [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|197364284|ref|YP_002143921.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|198246057|ref|YP_002217397.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|200387703|ref|ZP_03214315.1| ribosomal protein L22 [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|205354937|ref|YP_002228738.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|207858677|ref|YP_002245328.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|208806775|ref|ZP_03249112.1| ribosomal protein L22 [Escherichia coli O157:H7 str. EC4206]
 gi|208812846|ref|ZP_03254175.1| ribosomal protein L22 [Escherichia coli O157:H7 str. EC4045]
 gi|208821079|ref|ZP_03261399.1| ribosomal protein L22 [Escherichia coli O157:H7 str. EC4042]
 gi|209400254|ref|YP_002272771.1| ribosomal protein L22 [Escherichia coli O157:H7 str. EC4115]
 gi|209920781|ref|YP_002294865.1| 50S ribosomal protein L22 [Escherichia coli SE11]
 gi|213023087|ref|ZP_03337534.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Typhi str. 404ty]
 gi|213161927|ref|ZP_03347637.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
 gi|213417258|ref|ZP_03350402.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Typhi str. E01-6750]
 gi|213425755|ref|ZP_03358505.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
 gi|213581213|ref|ZP_03363039.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-0664]
 gi|213612414|ref|ZP_03370240.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-2068]
 gi|213646529|ref|ZP_03376582.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|213861393|ref|ZP_03385863.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Typhi str. M223]
 gi|215488615|ref|YP_002331046.1| 50S ribosomal protein L22 [Escherichia coli O127:H6 str. E2348/69]
 gi|217325355|ref|ZP_03441439.1| ribosomal protein L22 [Escherichia coli O157:H7 str. TW14588]
 gi|218550590|ref|YP_002384381.1| 50S ribosomal protein L22 [Escherichia fergusonii ATCC 35469]
 gi|218555872|ref|YP_002388785.1| 50S ribosomal protein L22 [Escherichia coli IAI1]
 gi|218560376|ref|YP_002393289.1| 50S ribosomal protein L22 [Escherichia coli S88]
 gi|218691601|ref|YP_002399813.1| 50S ribosomal protein L22 [Escherichia coli ED1a]
 gi|218697007|ref|YP_002404674.1| 50S ribosomal protein L22 [Escherichia coli 55989]
 gi|218702077|ref|YP_002409706.1| 50S ribosomal protein L22 [Escherichia coli IAI39]
 gi|218706922|ref|YP_002414441.1| 50S ribosomal protein L22 [Escherichia coli UMN026]
 gi|224585230|ref|YP_002639029.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|227883446|ref|ZP_04001251.1| 50S ribosomal protein L22 [Escherichia coli 83972]
 gi|237703045|ref|ZP_04533526.1| ribosomal protein L22 [Escherichia sp. 3_2_53FAA]
 gi|238902406|ref|YP_002928202.1| 50S ribosomal subunit protein L22 [Escherichia coli BW2952]
 gi|238913850|ref|ZP_04657687.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
 gi|253771861|ref|YP_003034692.1| 50S ribosomal protein L22 [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|254038476|ref|ZP_04872532.1| 50S ribosomal subunit protein L22 [Escherichia sp. 1_1_43]
 gi|254163243|ref|YP_003046351.1| 50S ribosomal protein L22 [Escherichia coli B str. REL606]
 gi|254795252|ref|YP_003080089.1| 50S ribosomal protein L22 [Escherichia coli O157:H7 str. TW14359]
 gi|256020674|ref|ZP_05434539.1| 50S ribosomal protein L22 [Shigella sp. D9]
 gi|256025957|ref|ZP_05439822.1| 50S ribosomal protein L22 [Escherichia sp. 4_1_40B]
 gi|260599634|ref|YP_003212205.1| 50S ribosomal protein L22 [Cronobacter turicensis z3032]
 gi|260846113|ref|YP_003223891.1| 50S ribosomal subunit protein L22 [Escherichia coli O103:H2 str.
           12009]
 gi|260857436|ref|YP_003231327.1| 50S ribosomal subunit protein L22 [Escherichia coli O26:H11 str.
           11368]
 gi|260870058|ref|YP_003236460.1| 50S ribosomal subunit protein L22 [Escherichia coli O111:H- str.
           11128]
 gi|261224620|ref|ZP_05938901.1| 50S ribosomal protein L22 [Escherichia coli O157:H7 str. FRIK2000]
 gi|261254486|ref|ZP_05947019.1| 50S ribosomal protein L22 [Escherichia coli O157:H7 str. FRIK966]
 gi|283788049|ref|YP_003367914.1| 50S ribosomal subunit protein L22 [Citrobacter rodentium ICC168]
 gi|289811446|ref|ZP_06542075.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Typhi str. AG3]
 gi|291284673|ref|YP_003501491.1| 50S ribosomal protein L22 [Escherichia coli O55:H7 str. CB9615]
 gi|293406912|ref|ZP_06650836.1| rplV [Escherichia coli FVEC1412]
 gi|293412734|ref|ZP_06655402.1| 50S ribosomal protein L22 [Escherichia coli B354]
 gi|293416732|ref|ZP_06659369.1| 50S ribosomal protein L22 [Escherichia coli B185]
 gi|293453633|ref|ZP_06664052.1| 50S ribosomal protein L22 [Escherichia coli B088]
 gi|297516601|ref|ZP_06934987.1| 50S ribosomal protein L22 [Escherichia coli OP50]
 gi|298382652|ref|ZP_06992247.1| 50S ribosomal protein L22 [Escherichia coli FVEC1302]
 gi|300815475|ref|ZP_07095700.1| ribosomal protein L22 [Escherichia coli MS 107-1]
 gi|300822882|ref|ZP_07103018.1| ribosomal protein L22 [Escherichia coli MS 119-7]
 gi|300896663|ref|ZP_07115179.1| ribosomal protein L22 [Escherichia coli MS 198-1]
 gi|300903563|ref|ZP_07121485.1| ribosomal protein L22 [Escherichia coli MS 84-1]
 gi|300918288|ref|ZP_07134892.1| ribosomal protein L22 [Escherichia coli MS 115-1]
 gi|300921876|ref|ZP_07138032.1| ribosomal protein L22 [Escherichia coli MS 182-1]
 gi|300932208|ref|ZP_07147487.1| ribosomal protein L22 [Escherichia coli MS 187-1]
 gi|300935313|ref|ZP_07150323.1| ribosomal protein L22 [Escherichia coli MS 21-1]
 gi|300946537|ref|ZP_07160802.1| ribosomal protein L22 [Escherichia coli MS 116-1]
 gi|300954810|ref|ZP_07167237.1| ribosomal protein L22 [Escherichia coli MS 175-1]
 gi|300973994|ref|ZP_07172401.1| ribosomal protein L22 [Escherichia coli MS 200-1]
 gi|300979886|ref|ZP_07174762.1| ribosomal protein L22 [Escherichia coli MS 45-1]
 gi|301018821|ref|ZP_07183065.1| ribosomal protein L22 [Escherichia coli MS 69-1]
 gi|301021135|ref|ZP_07185175.1| ribosomal protein L22 [Escherichia coli MS 196-1]
 gi|301046086|ref|ZP_07193264.1| ribosomal protein L22 [Escherichia coli MS 185-1]
 gi|301305524|ref|ZP_07211616.1| ribosomal protein L22 [Escherichia coli MS 124-1]
 gi|301325118|ref|ZP_07218652.1| ribosomal protein L22 [Escherichia coli MS 78-1]
 gi|301643865|ref|ZP_07243896.1| ribosomal protein L22 [Escherichia coli MS 146-1]
 gi|306816342|ref|ZP_07450480.1| 50S ribosomal protein L22 [Escherichia coli NC101]
 gi|307139998|ref|ZP_07499354.1| 50S ribosomal protein L22 [Escherichia coli H736]
 gi|307315106|ref|ZP_07594689.1| ribosomal protein L22 [Escherichia coli W]
 gi|309785637|ref|ZP_07680268.1| ribosomal protein L22 [Shigella dysenteriae 1617]
 gi|309794590|ref|ZP_07689012.1| ribosomal protein L22 [Escherichia coli MS 145-7]
 gi|312968360|ref|ZP_07782570.1| ribosomal protein L22 [Escherichia coli 2362-75]
 gi|312972424|ref|ZP_07786598.1| ribosomal protein L22 [Escherichia coli 1827-70]
 gi|331644011|ref|ZP_08345140.1| ribosomal protein L22 [Escherichia coli H736]
 gi|331649112|ref|ZP_08350198.1| ribosomal protein L22 [Escherichia coli M605]
 gi|331654908|ref|ZP_08355907.1| ribosomal protein L22 [Escherichia coli M718]
 gi|331659605|ref|ZP_08360543.1| ribosomal protein L22 [Escherichia coli TA206]
 gi|331664928|ref|ZP_08365829.1| ribosomal protein L22 [Escherichia coli TA143]
 gi|331670144|ref|ZP_08370983.1| ribosomal protein L22 [Escherichia coli TA271]
 gi|331679384|ref|ZP_08380054.1| ribosomal protein L22 [Escherichia coli H591]
 gi|331684957|ref|ZP_08385543.1| ribosomal protein L22 [Escherichia coli H299]
 gi|47117751|sp|P61175|RL22_ECOLI RecName: Full=50S ribosomal protein L22
 gi|47117752|sp|P61176|RL22_ECOL6 RecName: Full=50S ribosomal protein L22
 gi|47117753|sp|P61177|RL22_ECO57 RecName: Full=50S ribosomal protein L22
 gi|47117754|sp|P61178|RL22_SALTI RecName: Full=50S ribosomal protein L22
 gi|47117755|sp|P61179|RL22_SALTY RecName: Full=50S ribosomal protein L22
 gi|81677967|sp|Q5PIV7|RL22_SALPA RecName: Full=50S ribosomal protein L22
 gi|109893236|sp|Q31VW1|RL22_SHIBS RecName: Full=50S ribosomal protein L22
 gi|109893237|sp|Q32B36|RL22_SHIDS RecName: Full=50S ribosomal protein L22
 gi|109893238|sp|Q3YWU4|RL22_SHISS RecName: Full=50S ribosomal protein L22
 gi|122957941|sp|Q0TCE6|RL22_ECOL5 RecName: Full=50S ribosomal protein L22
 gi|123265974|sp|Q1R610|RL22_ECOUT RecName: Full=50S ribosomal protein L22
 gi|166199464|sp|A7MPI4|RL22_ENTS8 RecName: Full=50S ribosomal protein L22
 gi|166220840|sp|A8AQL2|RL22_CITK8 RecName: Full=50S ribosomal protein L22
 gi|166220846|sp|A1AGK3|RL22_ECOK1 RecName: Full=50S ribosomal protein L22
 gi|166986970|sp|A7ZSK4|RL22_ECO24 RecName: Full=50S ribosomal protein L22
 gi|166986971|sp|A8A5C0|RL22_ECOHS RecName: Full=50S ribosomal protein L22
 gi|189041950|sp|B1IPY4|RL22_ECOLC RecName: Full=50S ribosomal protein L22
 gi|189041964|sp|A9MSZ3|RL22_SALPB RecName: Full=50S ribosomal protein L22
 gi|226733456|sp|B7MCT0|RL22_ECO45 RecName: Full=50S ribosomal protein L22
 gi|226733457|sp|B5YTN6|RL22_ECO5E RecName: Full=50S ribosomal protein L22
 gi|226733458|sp|B7NLN4|RL22_ECO7I RecName: Full=50S ribosomal protein L22
 gi|226733459|sp|B7M1M9|RL22_ECO8A RecName: Full=50S ribosomal protein L22
 gi|226733460|sp|B1X6G6|RL22_ECODH RecName: Full=50S ribosomal protein L22
 gi|226733461|sp|B7NDT6|RL22_ECOLU RecName: Full=50S ribosomal protein L22
 gi|226733462|sp|B6I229|RL22_ECOSE RecName: Full=50S ribosomal protein L22
 gi|226733463|sp|B1LHC9|RL22_ECOSM RecName: Full=50S ribosomal protein L22
 gi|226733465|sp|B7LRT1|RL22_ESCF3 RecName: Full=50S ribosomal protein L22
 gi|226733503|sp|B5F8E7|RL22_SALA4 RecName: Full=50S ribosomal protein L22
 gi|226733504|sp|B5FJK9|RL22_SALDC RecName: Full=50S ribosomal protein L22
 gi|226733505|sp|B5R286|RL22_SALEP RecName: Full=50S ribosomal protein L22
 gi|226733506|sp|B5RH20|RL22_SALG2 RecName: Full=50S ribosomal protein L22
 gi|226733507|sp|B4TKL0|RL22_SALHS RecName: Full=50S ribosomal protein L22
 gi|226733508|sp|B4SUT5|RL22_SALNS RecName: Full=50S ribosomal protein L22
 gi|226733509|sp|B5BGY1|RL22_SALPK RecName: Full=50S ribosomal protein L22
 gi|226733510|sp|B4TXD7|RL22_SALSV RecName: Full=50S ribosomal protein L22
 gi|226733513|sp|B2U2T3|RL22_SHIB3 RecName: Full=50S ribosomal protein L22
 gi|254800436|sp|B7UK39|RL22_ECO27 RecName: Full=50S ribosomal protein L22
 gi|254800437|sp|B7L4K4|RL22_ECO55 RecName: Full=50S ribosomal protein L22
 gi|254800438|sp|B7N199|RL22_ECO81 RecName: Full=50S ribosomal protein L22
 gi|254800457|sp|C0Q0B1|RL22_SALPC RecName: Full=50S ribosomal protein L22
 gi|259646244|sp|C4ZUH0|RL22_ECOBW RecName: Full=50S ribosomal protein L22
 gi|25295403|pir||AF1006 50S ribosomal chain protein L22 [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|33357917|pdb|1P85|Q Chain Q, Real Space Refined Coordinates Of The 50s Subunit Fitted
           Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp
           State Of E. Coli 70s Ribosome
 gi|33357945|pdb|1P86|Q Chain Q, Real Space Refined Coordinates Of The 50s Subunit Fitted
           Into The Low Resolution Cryo-Em Map Of The
           Initiation-Like State Of E. Coli 70s Ribosome
 gi|83754079|pdb|2AW4|S Chain S, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli At 3.5 A Resolution. This File Contains
           The 50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 gi|83754135|pdb|2AWB|S Chain S, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli At 3.5 A Resolution. This File Contains
           The 50s Subunit Of The Second 70s Ribosome. The Entire
           Crystal Structure Contains Two 70s Ribosomes And Is
           Described In Remark 400.
 gi|116666588|pdb|1VS6|S Chain S, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With The Antibiotic
           Kasugamyin At 3.5a Resolution. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 gi|116666640|pdb|1VS8|S Chain S, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With The Antibiotic
           Kasugamyin At 3.5a Resolution. This File Contains The
           30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 gi|118138109|pdb|2I2T|S Chain S, Crystal Structure Of Ribosome With Messenger Rna And The
           Anticodon Stem-Loop Of P-Site Trna. This File Contains
           The 50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 gi|118138163|pdb|2I2V|S Chain S, Crystal Structure Of Ribosome With Messenger Rna And The
           Anticodon Stem-Loop Of P-Site Trna. This File Contains
           The 50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 gi|119390363|pdb|2J28|S Chain S, Model Of E. Coli Srp Bound To 70s Rncs
 gi|157836068|pdb|2QOV|S Chain S, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin. This
           File Contains The 50s Subunit Of The First 70s Ribosome.
           The Entire Crystal Structure Contains Two 70s Ribosomes.
 gi|157836120|pdb|2QOX|S Chain S, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin. This
           File Contains The 50s Subunit Of The Second 70s
           Ribosome. The Entire Crystal Structure Contains Two 70s
           Ribosomes.
 gi|157836172|pdb|2QOZ|S Chain S, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin And
           Neomycin. This File Contains The 50s Subunit Of The
           First 70s Ribosome, With Neomycin Bound. The Entire
           Crystal Structure Contains Two 70s Ribosomes.
 gi|157836224|pdb|2QP1|S Chain S, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin And
           Neomycin. This File Contains The 50s Subunit Of The
           Second 70s Ribosome, With Neomycin Bound. The Entire
           Crystal Structure Contains Two 70s Ribosomes.
 gi|158429743|pdb|2QAM|S Chain S, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Neomycin. This File
           Contains The 50s Subunit Of The First 70s Ribosome, With
           Neomycin Bound. The Entire Crystal Structure Contains
           Two 70s Ribosomes And Is Described In Remark 400.
 gi|158429795|pdb|2QAO|S Chain S, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Neomycin. This File
           Contains The 50s Subunit Of The Second 70s Ribosome,
           With Neomycin Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes And Is Described In Remark
           400.
 gi|158429853|pdb|2QBA|S Chain S, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin. This File
           Contains The 50s Subunit Of The First 70s Ribosome, With
           Gentamicin Bound. The Entire Crystal Structure Contains
           Two 70s Ribosomes And Is Described In Remark 400.
 gi|158429905|pdb|2QBC|S Chain S, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin. This File
           Contains The 50s Subunit Of The Second 70s Ribosome,
           With Gentamicin Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes And Is Described In Remark
           400.
 gi|158429957|pdb|2QBE|S Chain S, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Ribosome Recycling
           Factor (Rrf). This File Contains The 50s Subunit Of The
           First 70s Ribosome, With Rrf Bound. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 gi|158430010|pdb|2QBG|S Chain S, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Ribosome Recycling
           Factor (Rrf). This File Contains The 50s Subunit Of The
           Second 70s Ribosome, With Rrf Bound. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 gi|158430063|pdb|2QBI|S Chain S, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin And Ribosome
           Recycling Factor (Rrf). This File Contains The 50s
           Subunit Of The First 70s Ribosome, With Gentamicin And
           Rrf Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes And Is Described In Remark 400.
 gi|158430116|pdb|2QBK|S Chain S, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin And Ribosome
           Recycling Factor (Rrf). This File Contains The 50s
           Subunit Of The Second 70s Ribosome, With Gentamicin And
           Rrf Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes And Is Described In Remark 400.
 gi|158431416|pdb|2Z4L|S Chain S, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Paromomycin And
           Ribosome Recycling Factor (Rrf). This File Contains The
           50s Subunit Of The First 70s Ribosome, With Paromomycin
           And Rrf Bound. The Entire Crystal Structure Contains Two
           70s Ribosomes And Is Described In Remark 400.
 gi|158431469|pdb|2Z4N|S Chain S, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Paromomycin And
           Ribosome Recycling Factor (Rrf). This File Contains The
           50s Subunit Of The Second 70s Ribosome, With Paromomycin
           And Rrf Bound. The Entire Crystal Structure Contains Two
           70s Ribosomes And Is Described In Remark 400.
 gi|168988749|pdb|2VHM|S Chain S, Structure Of Pdf Binding Helix In Complex With The
           Ribosome (Part 1 Of 4)
 gi|168988780|pdb|2VHN|S Chain S, Structure Of Pdf Binding Helix In Complex With The
           Ribosome. (Part 2 Of 4)
 gi|169404619|pdb|2RDO|S Chain S, 50s Subunit With Ef-G(Gdpnp) And Rrf Bound
 gi|197107318|pdb|3DF2|S Chain S, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Hygromycin B. This File
           Contains The 50s Subunit Of The First 70s Ribosome. The
           Entire Crystal Structure Contains Two 70s Ribosomes.
 gi|197107370|pdb|3DF4|S Chain S, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Hygromycin B. This File
           Contains The 50s Subunit Of The Second 70s Ribosome. The
           Entire Crystal Structure Contains Two 70s Ribosomes.
 gi|209870371|pdb|3BBX|S Chain S, The Hsp15 Protein Fitted Into The Low Resolution Cryo-Em
           Map 50s.Nc-Trna.Hsp15 Complex
 gi|224510748|pdb|3FIK|S Chain S, Ternary Complex-Bound E.Coli 70s Ribosome. This Entry
           Consists Of The 50s Subunit.
 gi|256032384|pdb|3E1B|L Chain L, Structure Of The 50s Subunit Of E. Coli Ribosome In Pre-
           Accommodation State
 gi|256032441|pdb|3E1D|L Chain L, Structure Of The 50s Subunit Of E. Coli Ribosome In Post-
           Accommodation State
 gi|257097360|pdb|3I1N|S Chain S, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 gi|257097412|pdb|3I1P|S Chain S, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 gi|257097466|pdb|3I1R|S Chain S, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 gi|257097520|pdb|3I1T|S Chain S, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 gi|257097575|pdb|3I20|S Chain S, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 gi|257097630|pdb|3I22|S Chain S, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 gi|290560350|pdb|3KCR|S Chain S, Ribosome-Secy Complex. This Entry 3kcr Contains 50s
           Ribosomal Subnit. The 30s Ribosomal Subunit Can Be Found
           In Pdb Entry 3kc4
 gi|294662268|pdb|2WWQ|S Chain S, E.Coli 70s Ribosome Stalled During Translation Of Tnac
           Leader Peptide. This File Contains The 50s, The P-Site
           Trna And The Tnac Leader Peptide (Part 2 Of 2).
 gi|308198373|pdb|1VT2|S Chain S, Crystal Structure Of The E. Coli Ribosome Bound To
           Cem-101. This File Contains The 50s Subunit Of The
           Second 70s Ribosome.
 gi|308198747|pdb|3ORB|S Chain S, Crystal Structure Of The E. Coli Ribosome Bound To
           Cem-101. This File Contains The 50s Subunit Of The First
           70s Ribosome Bound To Cem-101.
 gi|308388025|pdb|3OFQ|S Chain S, Crystal Structure Of The E. Coli Ribosome Bound To
           Erythromycin. This File Contains The 50s Subunit Of The
           Second 70s Ribosome.
 gi|308388056|pdb|3OFR|S Chain S, Crystal Structure Of The E. Coli Ribosome Bound To
           Erythromycin. This File Contains The 50s Subunit Of The
           First 70s Ribosome With Erthromycin Bound.
 gi|309320083|pdb|3OFC|S Chain S, Crystal Structure Of The E. Coli Ribosome Bound To
           Chloramphenicol. This File Contains The 50s Subunit Of
           The First 70s Ribosome With Chloramphenicol Bound.
 gi|309320114|pdb|3OFD|S Chain S, Crystal Structure Of The E. Coli Ribosome Bound To
           Chloramphenicol. This File Contains The 50s Subunit Of
           The Second 70s Ribosome.
 gi|309320187|pdb|3OFZ|S Chain S, Crystal Structure Of The E. Coli Ribosome Bound To
           Clindamycin. This File Contains The 50s Subunit Of The
           First 70s Ribosome Bound To Clindamycin.
 gi|309320218|pdb|3OG0|S Chain S, Crystal Structure Of The E. Coli Ribosome Bound To
           Clindamycin. This File Contains The 50s Subunit Of The
           Second 70s Ribosome.
 gi|315113672|pdb|3OAS|S Chain S, Crystal Structure Of The E. Coli Ribosome Bound To
           Telithromycin. This File Contains The 50s Subunit Of The
           Second 70s Ribosome.
 gi|315113703|pdb|3OAT|S Chain S, Crystal Structure Of The E. Coli Ribosome Bound To
           Telithromycin. This File Contains The 50s Subunit Of The
           First 70s Ribosome With Telithromycin Bound.
 gi|326634228|pdb|3IZT|T Chain T, Structural Insights Into Cognate Vs. Near-Cognate
           Discrimination During Decoding. This Entry Contains The
           Large Subunit Of A Ribosome Programmed With A
           Near-Cognate Codon.
 gi|326634261|pdb|3IZU|T Chain T, Structural Insights Into Cognate Vs. Near-Cognate
           Discrimination During Decoding. This Entry Contains The
           Large Subunit Of A Ribosome Programmed With A Cognate
           Codon
 gi|329666034|pdb|3J01|S Chain S, Structure Of The Ribosome-Secye Complex In The Membrane
           Environment
 gi|12517947|gb|AAG58436.1|AE005557_5 50S ribosomal subunit protein L22 [Escherichia coli O157:H7 str.
           EDL933]
 gi|26110334|gb|AAN82520.1|AE016767_280 50S ribosomal protein L22 [Escherichia coli CFT073]
 gi|42831|emb|CAA26465.1| unnamed protein product [Escherichia coli]
 gi|606249|gb|AAA58112.1| 50S ribosomal subunit protein L22 [Escherichia coli str. K-12
           substr. MG1655]
 gi|1789711|gb|AAC76340.1| 50S ribosomal subunit protein L22 [Escherichia coli str. K-12
           substr. MG1655]
 gi|13363653|dbj|BAB37603.1| 50S ribosomal subunit protein L22 [Escherichia coli O157:H7 str.
           Sakai]
 gi|16421992|gb|AAL22298.1| 50S ribosomal subunit protein L22 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|16505154|emb|CAD08178.1| 50S ribosomal subunit protein L22 [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29139973|gb|AAO71537.1| 50S ribosomal subunit protein L22 [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|56129611|gb|AAV79117.1| 50S ribosomal subunit protein L22 [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|73857311|gb|AAZ90018.1| 50S ribosomal subunit protein L22 [Shigella sonnei Ss046]
 gi|81242759|gb|ABB63469.1| 50S ribosomal subunit protein L22 [Shigella dysenteriae Sd197]
 gi|81247089|gb|ABB67797.1| 50S ribosomal subunit protein L22 [Shigella boydii Sb227]
 gi|85676726|dbj|BAE77976.1| 50S ribosomal subunit protein L22 [Escherichia coli str. K12
           substr. W3110]
 gi|91074323|gb|ABE09204.1| 50S ribosomal subunit protein L22 [Escherichia coli UTI89]
 gi|110345146|gb|ABG71383.1| 50S ribosomal protein L22 [Escherichia coli 536]
 gi|115514718|gb|ABJ02793.1| 50S ribosomal protein L22 [Escherichia coli APEC O1]
 gi|156530493|gb|ABU75319.1| hypothetical protein ESA_00010 [Cronobacter sakazakii ATCC BAA-894]
 gi|157068469|gb|ABV07724.1| ribosomal protein L22 [Escherichia coli HS]
 gi|157077595|gb|ABV17303.1| ribosomal protein L22 [Escherichia coli E24377A]
 gi|157086097|gb|ABV15775.1| hypothetical protein CKO_04730 [Citrobacter koseri ATCC BAA-895]
 gi|161365825|gb|ABX69593.1| hypothetical protein SPAB_04276 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|169753377|gb|ACA76076.1| ribosomal protein L22 [Escherichia coli ATCC 8739]
 gi|169890669|gb|ACB04376.1| 50S ribosomal subunit protein L22 [Escherichia coli str. K-12
           substr. DH10B]
 gi|170121605|gb|EDS90536.1| ribosomal protein L22 [Escherichia albertii TW07627]
 gi|170521364|gb|ACB19542.1| ribosomal protein L22 [Escherichia coli SMS-3-5]
 gi|187430459|gb|ACD09733.1| ribosomal protein L22 [Shigella boydii CDC 3083-94]
 gi|188491431|gb|EDU66534.1| ribosomal protein L22 [Escherichia coli 53638]
 gi|188998468|gb|EDU67466.1| ribosomal protein L22 [Escherichia coli O157:H7 str. EC4076]
 gi|189358796|gb|EDU77215.1| ribosomal protein L22 [Escherichia coli O157:H7 str. EC4401]
 gi|189361826|gb|EDU80245.1| ribosomal protein L22 [Escherichia coli O157:H7 str. EC4486]
 gi|189374645|gb|EDU93061.1| ribosomal protein L22 [Escherichia coli O157:H7 str. EC869]
 gi|190905053|gb|EDV64717.1| ribosomal protein L22 [Escherichia coli F11]
 gi|194402684|gb|ACF62906.1| ribosomal protein L22 [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194407499|gb|ACF67718.1| ribosomal protein L22 [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194455474|gb|EDX44313.1| ribosomal protein L22 [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|194711599|gb|ACF90820.1| ribosomal protein L22 [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|195628914|gb|EDX48324.1| ribosomal protein L22 [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|197095761|emb|CAR61331.1| 50S ribosomal subunit protein L22 [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|197212649|gb|ACH50046.1| ribosomal protein L22 [Salmonella enterica subsp. enterica serovar
           Agona str. SL483]
 gi|197243136|gb|EDY25756.1| ribosomal protein L22 [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|197940573|gb|ACH77906.1| ribosomal protein L22 [Salmonella enterica subsp. enterica serovar
           Dublin str. CT_02021853]
 gi|199604801|gb|EDZ03346.1| ribosomal protein L22 [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|205274718|emb|CAR39774.1| 50s ribosomal protein l22 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|206710480|emb|CAR34838.1| 50s ribosomal protein l22 [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|208726576|gb|EDZ76177.1| ribosomal protein L22 [Escherichia coli O157:H7 str. EC4206]
 gi|208734123|gb|EDZ82810.1| ribosomal protein L22 [Escherichia coli O157:H7 str. EC4045]
 gi|208741202|gb|EDZ88884.1| ribosomal protein L22 [Escherichia coli O157:H7 str. EC4042]
 gi|209161654|gb|ACI39087.1| ribosomal protein L22 [Escherichia coli O157:H7 str. EC4115]
 gi|209757088|gb|ACI76856.1| 50S ribosomal subunit protein L22 [Escherichia coli]
 gi|209757090|gb|ACI76857.1| 50S ribosomal subunit protein L22 [Escherichia coli]
 gi|209757092|gb|ACI76858.1| 50S ribosomal subunit protein L22 [Escherichia coli]
 gi|209757094|gb|ACI76859.1| 50S ribosomal subunit protein L22 [Escherichia coli]
 gi|209757096|gb|ACI76860.1| 50S ribosomal subunit protein L22 [Escherichia coli]
 gi|209914040|dbj|BAG79114.1| 50S ribosomal protein L22 [Escherichia coli SE11]
 gi|215266687|emb|CAS11126.1| 50S ribosomal subunit protein L22 [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217321576|gb|EEC30000.1| ribosomal protein L22 [Escherichia coli O157:H7 str. TW14588]
 gi|218353739|emb|CAV00029.1| 50S ribosomal subunit protein L22 [Escherichia coli 55989]
 gi|218358131|emb|CAQ90778.1| 50S ribosomal subunit protein L22 [Escherichia fergusonii ATCC
           35469]
 gi|218362640|emb|CAR00266.1| 50S ribosomal subunit protein L22 [Escherichia coli IAI1]
 gi|218367145|emb|CAR04919.1| 50S ribosomal subunit protein L22 [Escherichia coli S88]
 gi|218372063|emb|CAR19923.1| 50S ribosomal subunit protein L22 [Escherichia coli IAI39]
 gi|218429165|emb|CAR10117.2| 50S ribosomal subunit protein L22 [Escherichia coli ED1a]
 gi|218434019|emb|CAR14936.1| 50S ribosomal subunit protein L22 [Escherichia coli UMN026]
 gi|222035024|emb|CAP77767.1| 50S ribosomal protein L22 [Escherichia coli LF82]
 gi|224469758|gb|ACN47588.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|226838982|gb|EEH71005.1| 50S ribosomal subunit protein L22 [Escherichia sp. 1_1_43]
 gi|226902309|gb|EEH88568.1| ribosomal protein L22 [Escherichia sp. 3_2_53FAA]
 gi|227839590|gb|EEJ50056.1| 50S ribosomal protein L22 [Escherichia coli 83972]
 gi|238859861|gb|ACR61859.1| 50S ribosomal subunit protein L22 [Escherichia coli BW2952]
 gi|242378842|emb|CAQ33634.1| 50S ribosomal subunit protein L22, subunit of 50S ribosomal subunit
           and ribosome [Escherichia coli BL21(DE3)]
 gi|253322905|gb|ACT27507.1| ribosomal protein L22 [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253975144|gb|ACT40815.1| 50S ribosomal protein L22 [Escherichia coli B str. REL606]
 gi|253979300|gb|ACT44970.1| 50S ribosomal protein L22 [Escherichia coli BL21(DE3)]
 gi|254594652|gb|ACT74013.1| 50S ribosomal subunit protein L22 [Escherichia coli O157:H7 str.
           TW14359]
 gi|257756085|dbj|BAI27587.1| 50S ribosomal subunit protein L22 [Escherichia coli O26:H11 str.
           11368]
 gi|257761260|dbj|BAI32757.1| 50S ribosomal subunit protein L22 [Escherichia coli O103:H2 str.
           12009]
 gi|257766414|dbj|BAI37909.1| 50S ribosomal subunit protein L22 [Escherichia coli O111:H- str.
           11128]
 gi|260218811|emb|CBA34163.1| 50S ribosomal protein L22 [Cronobacter turicensis z3032]
 gi|260447666|gb|ACX38088.1| ribosomal protein L22 [Escherichia coli DH1]
 gi|261248591|emb|CBG26429.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267995644|gb|ACY90529.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|281180350|dbj|BAI56680.1| 50S ribosomal protein L22 [Escherichia coli SE15]
 gi|282951503|emb|CBG91202.1| 50S ribosomal subunit protein L22 [Citrobacter rodentium ICC168]
 gi|284923321|emb|CBG36415.1| 50S ribosomal subunit protein L22 [Escherichia coli 042]
 gi|290764546|gb|ADD58507.1| 50S ribosomal protein L22 [Escherichia coli O55:H7 str. CB9615]
 gi|291321759|gb|EFE61190.1| 50S ribosomal protein L22 [Escherichia coli B088]
 gi|291425723|gb|EFE98757.1| rplV [Escherichia coli FVEC1412]
 gi|291431308|gb|EFF04293.1| 50S ribosomal protein L22 [Escherichia coli B185]
 gi|291468381|gb|EFF10874.1| 50S ribosomal protein L22 [Escherichia coli B354]
 gi|294493147|gb|ADE91903.1| ribosomal protein L22 [Escherichia coli IHE3034]
 gi|298276488|gb|EFI18006.1| 50S ribosomal protein L22 [Escherichia coli FVEC1302]
 gi|299881665|gb|EFI89876.1| ribosomal protein L22 [Escherichia coli MS 196-1]
 gi|300301912|gb|EFJ58297.1| ribosomal protein L22 [Escherichia coli MS 185-1]
 gi|300309004|gb|EFJ63524.1| ribosomal protein L22 [Escherichia coli MS 200-1]
 gi|300318239|gb|EFJ68023.1| ribosomal protein L22 [Escherichia coli MS 175-1]
 gi|300359494|gb|EFJ75364.1| ribosomal protein L22 [Escherichia coli MS 198-1]
 gi|300399531|gb|EFJ83069.1| ribosomal protein L22 [Escherichia coli MS 69-1]
 gi|300404436|gb|EFJ87974.1| ribosomal protein L22 [Escherichia coli MS 84-1]
 gi|300409397|gb|EFJ92935.1| ribosomal protein L22 [Escherichia coli MS 45-1]
 gi|300414549|gb|EFJ97859.1| ribosomal protein L22 [Escherichia coli MS 115-1]
 gi|300421724|gb|EFK05035.1| ribosomal protein L22 [Escherichia coli MS 182-1]
 gi|300453783|gb|EFK17403.1| ribosomal protein L22 [Escherichia coli MS 116-1]
 gi|300459469|gb|EFK22962.1| ribosomal protein L22 [Escherichia coli MS 21-1]
 gi|300460032|gb|EFK23525.1| ribosomal protein L22 [Escherichia coli MS 187-1]
 gi|300524648|gb|EFK45717.1| ribosomal protein L22 [Escherichia coli MS 119-7]
 gi|300532367|gb|EFK53429.1| ribosomal protein L22 [Escherichia coli MS 107-1]
 gi|300839219|gb|EFK66979.1| ribosomal protein L22 [Escherichia coli MS 124-1]
 gi|300847997|gb|EFK75757.1| ribosomal protein L22 [Escherichia coli MS 78-1]
 gi|301077768|gb|EFK92574.1| ribosomal protein L22 [Escherichia coli MS 146-1]
 gi|301159978|emb|CBW19497.1| 50s ribosomal protein l22 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|305850738|gb|EFM51195.1| 50S ribosomal protein L22 [Escherichia coli NC101]
 gi|306905455|gb|EFN35990.1| ribosomal protein L22 [Escherichia coli W]
 gi|307555403|gb|ADN48178.1| 50S ribosomal subunit protein L22 [Escherichia coli ABU 83972]
 gi|308121640|gb|EFO58902.1| ribosomal protein L22 [Escherichia coli MS 145-7]
 gi|308926757|gb|EFP72233.1| ribosomal protein L22 [Shigella dysenteriae 1617]
 gi|309703727|emb|CBJ03068.1| 50S ribosomal subunit protein L22 [Escherichia coli ETEC H10407]
 gi|310334801|gb|EFQ01006.1| ribosomal protein L22 [Escherichia coli 1827-70]
 gi|312287185|gb|EFR15095.1| ribosomal protein L22 [Escherichia coli 2362-75]
 gi|312914458|dbj|BAJ38432.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|312947866|gb|ADR28693.1| 50S ribosomal protein L22 [Escherichia coli O83:H1 str. NRG 857C]
 gi|315062607|gb|ADT76934.1| 50S ribosomal subunit protein L22 [Escherichia coli W]
 gi|315137890|dbj|BAJ45049.1| 50S ribosomal protein L22 [Escherichia coli DH1]
 gi|315255898|gb|EFU35866.1| ribosomal protein L22 [Escherichia coli MS 85-1]
 gi|315284610|gb|EFU44055.1| ribosomal protein L22 [Escherichia coli MS 110-3]
 gi|315292368|gb|EFU51720.1| ribosomal protein L22 [Escherichia coli MS 153-1]
 gi|315298613|gb|EFU57868.1| ribosomal protein L22 [Escherichia coli MS 16-3]
 gi|315616992|gb|EFU97604.1| ribosomal protein L22 [Escherichia coli 3431]
 gi|320087880|emb|CBY97643.1| 50S ribosomal protein L22, chloroplastic [Salmonella enterica
           subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|320173956|gb|EFW49132.1| 50S ribosomal protein L22 [Shigella dysenteriae CDC 74-1112]
 gi|320180149|gb|EFW55088.1| 50S ribosomal protein L22 [Shigella boydii ATCC 9905]
 gi|320187033|gb|EFW61745.1| 50S ribosomal protein L22 [Shigella flexneri CDC 796-83]
 gi|320191654|gb|EFW66304.1| 50S ribosomal protein L22 [Escherichia coli O157:H7 str. EC1212]
 gi|320199499|gb|EFW74089.1| 50S ribosomal protein L22 [Escherichia coli EC4100B]
 gi|320639620|gb|EFX09214.1| 50S ribosomal protein L22 [Escherichia coli O157:H7 str. G5101]
 gi|320645118|gb|EFX14134.1| 50S ribosomal protein L22 [Escherichia coli O157:H- str. 493-89]
 gi|320650429|gb|EFX18895.1| 50S ribosomal protein L22 [Escherichia coli O157:H- str. H 2687]
 gi|320655954|gb|EFX23874.1| 50S ribosomal protein L22 [Escherichia coli O55:H7 str. 3256-97 TW
           07815]
 gi|320661406|gb|EFX28821.1| 50S ribosomal protein L22 [Escherichia coli O55:H7 str. USDA 5905]
 gi|320666428|gb|EFX33411.1| 50S ribosomal protein L22 [Escherichia coli O157:H7 str. LSU-61]
 gi|321226482|gb|EFX51532.1| LSU ribosomal protein L22p L17e [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|322615024|gb|EFY11948.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322617311|gb|EFY14212.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322625533|gb|EFY22358.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322626375|gb|EFY23184.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322632113|gb|EFY28866.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322635008|gb|EFY31731.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322643291|gb|EFY39858.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322646625|gb|EFY43132.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322649971|gb|EFY46390.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322652688|gb|EFY49028.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322659555|gb|EFY55799.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322665503|gb|EFY61690.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322670397|gb|EFY66536.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322670470|gb|EFY66604.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322675046|gb|EFY71129.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322681583|gb|EFY77612.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322685927|gb|EFY81916.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|322716426|gb|EFZ07997.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
 gi|323131793|gb|ADX19223.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|323154153|gb|EFZ40356.1| ribosomal protein L22 [Escherichia coli EPECa14]
 gi|323162994|gb|EFZ48829.1| ribosomal protein L22 [Escherichia coli E128010]
 gi|323164879|gb|EFZ50670.1| ribosomal protein L22 [Shigella sonnei 53G]
 gi|323173951|gb|EFZ59579.1| ribosomal protein L22 [Escherichia coli LT-68]
 gi|323179149|gb|EFZ64723.1| ribosomal protein L22 [Escherichia coli 1180]
 gi|323182793|gb|EFZ68194.1| ribosomal protein L22 [Escherichia coli 1357]
 gi|323189080|gb|EFZ74364.1| ribosomal protein L22 [Escherichia coli RN587/1]
 gi|323194035|gb|EFZ79235.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323196447|gb|EFZ81598.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323202314|gb|EFZ87359.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323207337|gb|EFZ92287.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323211227|gb|EFZ96072.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323216064|gb|EGA00795.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323223445|gb|EGA07773.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323226825|gb|EGA11015.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323231813|gb|EGA15923.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323233234|gb|EGA17329.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323237301|gb|EGA21366.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323245536|gb|EGA29535.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323249042|gb|EGA32964.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323250665|gb|EGA34546.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323256894|gb|EGA40608.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323263043|gb|EGA46590.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323266043|gb|EGA49538.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323272800|gb|EGA56203.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
 gi|323376806|gb|ADX49074.1| ribosomal protein L22 [Escherichia coli KO11]
 gi|323934487|gb|EGB30895.1| ribosomal protein L22 [Escherichia coli E1520]
 gi|323939263|gb|EGB35475.1| ribosomal protein L22 [Escherichia coli E482]
 gi|323944264|gb|EGB40340.1| ribosomal protein L22 [Escherichia coli H120]
 gi|323950229|gb|EGB46111.1| ribosomal protein L22 [Escherichia coli H252]
 gi|323954562|gb|EGB50345.1| ribosomal protein L22 [Escherichia coli H263]
 gi|323959534|gb|EGB55187.1| ribosomal protein L22 [Escherichia coli H489]
 gi|323966277|gb|EGB61712.1| ribosomal protein L22 [Escherichia coli M863]
 gi|323970119|gb|EGB65393.1| ribosomal protein L22 [Escherichia coli TA007]
 gi|323974732|gb|EGB69845.1| ribosomal protein L22 [Escherichia coli TW10509]
 gi|324009006|gb|EGB78225.1| ribosomal protein L22 [Escherichia coli MS 57-2]
 gi|324014931|gb|EGB84150.1| ribosomal protein L22 [Escherichia coli MS 60-1]
 gi|324017867|gb|EGB87086.1| ribosomal protein L22 [Escherichia coli MS 117-3]
 gi|324111994|gb|EGC05973.1| ribosomal protein L22 [Escherichia fergusonii B253]
 gi|324116295|gb|EGC10215.1| ribosomal protein L22 [Escherichia coli E1167]
 gi|325498881|gb|EGC96740.1| 50S ribosomal protein L22 [Escherichia fergusonii ECD227]
 gi|326342560|gb|EGD66334.1| 50S ribosomal protein L22 [Escherichia coli O157:H7 str. 1044]
 gi|326344547|gb|EGD68296.1| 50S ribosomal protein L22 [Escherichia coli O157:H7 str. 1125]
 gi|326625178|gb|EGE31523.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
 gi|326630086|gb|EGE36429.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
 gi|327250963|gb|EGE62656.1| ribosomal protein L22 [Escherichia coli STEC_7v]
 gi|330909357|gb|EGH37871.1| LSU ribosomal protein L22p (L17e) [Escherichia coli AA86]
 gi|331036305|gb|EGI08531.1| ribosomal protein L22 [Escherichia coli H736]
 gi|331041610|gb|EGI13754.1| ribosomal protein L22 [Escherichia coli M605]
 gi|331046923|gb|EGI19001.1| ribosomal protein L22 [Escherichia coli M718]
 gi|331052820|gb|EGI24853.1| ribosomal protein L22 [Escherichia coli TA206]
 gi|331057438|gb|EGI29424.1| ribosomal protein L22 [Escherichia coli TA143]
 gi|331062206|gb|EGI34126.1| ribosomal protein L22 [Escherichia coli TA271]
 gi|331072556|gb|EGI43881.1| ribosomal protein L22 [Escherichia coli H591]
 gi|331077328|gb|EGI48540.1| ribosomal protein L22 [Escherichia coli H299]
 gi|332085466|gb|EGI90632.1| ribosomal protein L22 [Shigella boydii 5216-82]
 gi|332085612|gb|EGI90776.1| ribosomal protein L22 [Shigella dysenteriae 155-74]
 gi|332090385|gb|EGI95483.1| ribosomal protein L22 [Shigella boydii 3594-74]
 gi|332104222|gb|EGJ07568.1| 50S ribosomal subunit protein L22 [Shigella sp. D9]
          Length = 110

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 64/99 (64%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R S QK+ LVA +IRGK+VS AL  L ++ K+ A  V+K L SA+ANAE+N   D+D L 
Sbjct: 11  RSSAQKVRLVADLIRGKKVSQALDILTYTNKKAAVLVKKVLESAIANAEHNDGADIDDLK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           V++ +V +   MKR   R + R  RI++  S +TV+V +
Sbjct: 71  VTKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSD 109


>gi|126697645|ref|YP_001086542.1| 50S ribosomal protein L22 [Clostridium difficile 630]
 gi|254973736|ref|ZP_05270208.1| 50S ribosomal protein L22 [Clostridium difficile QCD-66c26]
 gi|255091126|ref|ZP_05320604.1| 50S ribosomal protein L22 [Clostridium difficile CIP 107932]
 gi|255099237|ref|ZP_05328214.1| 50S ribosomal protein L22 [Clostridium difficile QCD-63q42]
 gi|255305020|ref|ZP_05349192.1| 50S ribosomal protein L22 [Clostridium difficile ATCC 43255]
 gi|255312780|ref|ZP_05354363.1| 50S ribosomal protein L22 [Clostridium difficile QCD-76w55]
 gi|255515539|ref|ZP_05383215.1| 50S ribosomal protein L22 [Clostridium difficile QCD-97b34]
 gi|255648634|ref|ZP_05395536.1| 50S ribosomal protein L22 [Clostridium difficile QCD-37x79]
 gi|255654167|ref|ZP_05399576.1| 50S ribosomal protein L22 [Clostridium difficile QCD-23m63]
 gi|260681851|ref|YP_003213136.1| 50S ribosomal protein L22 [Clostridium difficile CD196]
 gi|260685449|ref|YP_003216582.1| 50S ribosomal protein L22 [Clostridium difficile R20291]
 gi|306518757|ref|ZP_07405104.1| 50S ribosomal protein L22 [Clostridium difficile QCD-32g58]
 gi|123363694|sp|Q18CG1|RL22_CLOD6 RecName: Full=50S ribosomal protein L22
 gi|115249082|emb|CAJ66893.1| 50S ribosomal protein L22 [Clostridium difficile]
 gi|260208014|emb|CBA60195.1| 50S ribosomal protein L22 [Clostridium difficile CD196]
 gi|260211465|emb|CBE01588.1| 50S ribosomal protein L22 [Clostridium difficile R20291]
          Length = 111

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 64/108 (59%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A  +RVSP+K   +  ++RGK V +ALA L+F+ +  A  + K + SA ANAENN
Sbjct: 2   EAKATAKYVRVSPRKAGQICDLVRGKNVDEALAILKFTPRGAASIIAKVVKSAKANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           H++D ++L ++     +   MKRF  R   R   I +  S + V+V+E
Sbjct: 62  HEMDTEKLYIASIVANQGPTMKRFMPRAMGRATTIRKRTSHIEVVVKE 109


>gi|330432119|gb|AEC17178.1| 50S ribosomal protein L22 [Gallibacterium anatis UMN179]
          Length = 110

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 63/99 (63%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R S QK  LVA +IRGK+V+ AL  L ++ K+ A  V+K L SA+ANAE+N   D+D L 
Sbjct: 11  RTSAQKARLVADLIRGKKVAQALEILTYTNKKAAALVKKVLESAIANAEHNDGADIDDLK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           V++ +V +   MKR   R + R  RI++  S +TV+V +
Sbjct: 71  VAKIFVDEGPSMKRVMPRAKGRADRILKRTSHITVVVSD 109


>gi|116667450|pdb|2GYA|Q Chain Q, Structure Of The 50s Subunit Of A Pre-Translocational E.
           Coli Ribosome Obtained By Fitting Atomic Models For Rna
           And Protein Components Into Cryo-Em Map Emd-1056
 gi|116667502|pdb|2GYC|Q Chain Q, Structure Of The 50s Subunit Of A Secm-Stalled E. Coli
           Ribosome Complex Obtained By Fitting Atomic Models For
           Rna And Protein Components Into Cryo-Em Map Emd-1143
          Length = 106

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 64/99 (64%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R S QK+ LVA +IRGK+VS AL  L ++ K+ A  V+K L SA+ANAE+N   D+D L 
Sbjct: 7   RSSAQKVRLVADLIRGKKVSQALDILTYTNKKAAVLVKKVLESAIANAEHNDGADIDDLK 66

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           V++ +V +   MKR   R + R  RI++  S +TV+V +
Sbjct: 67  VTKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSD 105


>gi|21230369|ref|NP_636286.1| 50S ribosomal protein L22 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|21241742|ref|NP_641324.1| 50S ribosomal protein L22 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|66769637|ref|YP_244399.1| 50S ribosomal protein L22 [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|188992849|ref|YP_001904859.1| 50S ribosomal protein L22 [Xanthomonas campestris pv. campestris
           str. B100]
 gi|285017325|ref|YP_003375036.1| 50s ribosomal protein l22 [Xanthomonas albilineans GPE PC73]
 gi|294627846|ref|ZP_06706425.1| 50S ribosomal protein L22 [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
 gi|294663999|ref|ZP_06729413.1| 50S ribosomal protein L22 [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
 gi|51316735|sp|Q7CLU6|RL22_XANCP RecName: Full=50S ribosomal protein L22
 gi|51316876|sp|Q8NKY0|RL22_XANAC RecName: Full=50S ribosomal protein L22
 gi|81304408|sp|Q4URE4|RL22_XANC8 RecName: Full=50S ribosomal protein L22
 gi|226734752|sp|B0RU77|RL22_XANCB RecName: Full=50S ribosomal protein L22
 gi|21107113|gb|AAM35860.1| 50S ribosomal protein L22 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|21111925|gb|AAM40210.1| 50S ribosomal protein L22 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66574969|gb|AAY50379.1| 50S ribosomal protein L22 [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|167734609|emb|CAP52819.1| 50S ribosomal protein L22 [Xanthomonas campestris pv. campestris]
 gi|283472543|emb|CBA15048.1| probable 50s ribosomal protein l22 [Xanthomonas albilineans]
 gi|292597760|gb|EFF41918.1| 50S ribosomal protein L22 [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
 gi|292606228|gb|EFF49465.1| 50S ribosomal protein L22 [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
          Length = 113

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 62/106 (58%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AI    R+SPQK  LVA  +RG     A+  L+FS K+ A  ++K + SA+ANAENN
Sbjct: 4   EAKAILRTARISPQKARLVADQVRGLSAERAVNLLKFSDKKAAHLIKKVVESAIANAENN 63

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              DVD L V    V +   +KRF  R + R  RI++  S +TV+V
Sbjct: 64  QGADVDELKVKTIMVDEGPSLKRFMARAKGRGTRILKRTSHITVVV 109


>gi|78046560|ref|YP_362735.1| 50S ribosomal protein L22 [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|325925382|ref|ZP_08186784.1| LSU ribosomal protein L22P [Xanthomonas perforans 91-118]
 gi|109893254|sp|Q3BWX8|RL22_XANC5 RecName: Full=50S ribosomal protein L22
 gi|78034990|emb|CAJ22635.1| 50S ribosomal protein L22 [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|325544260|gb|EGD15641.1| LSU ribosomal protein L22P [Xanthomonas perforans 91-118]
          Length = 111

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 62/106 (58%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AI    R+SPQK  LVA  +RG     A+  L+FS K+ A  ++K + SA+ANAENN
Sbjct: 2   EAKAILRTARISPQKARLVADQVRGLSAERAVNLLKFSDKKAAHLIKKVVESAIANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              DVD L V    V +   +KRF  R + R  RI++  S +TV+V
Sbjct: 62  QGADVDELKVKTIMVDEGPSLKRFMARAKGRGTRILKRTSHITVVV 107


>gi|238021595|ref|ZP_04602021.1| hypothetical protein GCWU000324_01495 [Kingella oralis ATCC 51147]
 gi|237866209|gb|EEP67251.1| hypothetical protein GCWU000324_01495 [Kingella oralis ATCC 51147]
          Length = 109

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 59/97 (60%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R+S QK  LVA MIRGK V+ AL  L FS K+ A  ++K L SA+ANAE+N+D D+D L 
Sbjct: 11  RISAQKARLVADMIRGKDVAQALNILAFSPKKGAELIKKVLESAIANAEHNNDADIDELK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           V   +V K   +KRF  R + R  RI +    + V V
Sbjct: 71  VVTIFVDKGPSLKRFQARAKGRGNRIEKQTCHIHVTV 107


>gi|304399286|ref|ZP_07381152.1| ribosomal protein L22 [Pantoea sp. aB]
 gi|308188352|ref|YP_003932483.1| 50S ribosomal protein L22 [Pantoea vagans C9-1]
 gi|304353212|gb|EFM17593.1| ribosomal protein L22 [Pantoea sp. aB]
 gi|308058862|gb|ADO11034.1| 50S ribosomal protein L22 [Pantoea vagans C9-1]
          Length = 110

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 64/99 (64%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R S QK+ LVA +IRGK+VS AL  L ++ K+ A  V+K L SA+ANAE+N   D+D L 
Sbjct: 11  RSSAQKVRLVADLIRGKKVSQALDILTYTNKKAAVLVKKVLESAIANAEHNDGADIDDLK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           +++ +V +   MKR   R + R  RI++  S +TV+V +
Sbjct: 71  ITKIFVDEGPTMKRIMPRAKGRADRILKRTSHITVVVSD 109


>gi|303246998|ref|ZP_07333274.1| ribosomal protein L22 [Desulfovibrio fructosovorans JJ]
 gi|302491705|gb|EFL51588.1| ribosomal protein L22 [Desulfovibrio fructosovorans JJ]
          Length = 110

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 62/108 (57%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A  +RVSPQK  LVAA I G+ V +A+  L+F+ K+ A  + K L SAVANAE  
Sbjct: 2   EAKARAKFIRVSPQKARLVAANILGRPVEEAMNILKFTPKKSAKLIGKVLGSAVANAEQI 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
             +D+D L V +  V      KR   R   R  RIV+  S +TV+V E
Sbjct: 62  SGVDIDNLTVKQVIVNPGPTWKRIMTRSMGRAFRIVKRTSHITVVVAE 109


>gi|169632355|ref|YP_001706091.1| 50S ribosomal protein L22 [Acinetobacter baumannii SDF]
 gi|169794599|ref|YP_001712392.1| 50S ribosomal protein L22 [Acinetobacter baumannii AYE]
 gi|260549835|ref|ZP_05824051.1| 50S ribosomal protein L22 [Acinetobacter sp. RUH2624]
 gi|260557032|ref|ZP_05829249.1| ribosomal protein L22 [Acinetobacter baumannii ATCC 19606]
 gi|262377307|ref|ZP_06070531.1| ribosomal protein L22 [Acinetobacter lwoffii SH145]
 gi|262380343|ref|ZP_06073497.1| ribosomal protein L22 [Acinetobacter radioresistens SH164]
 gi|215274937|sp|B2HZL7|RL22_ACIBC RecName: Full=50S ribosomal protein L22
 gi|226733402|sp|B0VQS3|RL22_ACIBS RecName: Full=50S ribosomal protein L22
 gi|226733403|sp|B0V6X3|RL22_ACIBY RecName: Full=50S ribosomal protein L22
 gi|169147526|emb|CAM85387.1| 50S ribosomal protein L22 [Acinetobacter baumannii AYE]
 gi|169151147|emb|CAO99819.1| 50S ribosomal protein L22 [Acinetobacter baumannii]
 gi|260407085|gb|EEX00562.1| 50S ribosomal protein L22 [Acinetobacter sp. RUH2624]
 gi|260409638|gb|EEX02939.1| ribosomal protein L22 [Acinetobacter baumannii ATCC 19606]
 gi|262297789|gb|EEY85704.1| ribosomal protein L22 [Acinetobacter radioresistens SH164]
 gi|262307760|gb|EEY88899.1| ribosomal protein L22 [Acinetobacter lwoffii SH145]
 gi|323519523|gb|ADX93904.1| 50S ribosomal protein L22 [Acinetobacter baumannii TCDC-AB0715]
          Length = 110

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 60/96 (62%)

Query: 26  VSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLIV 85
           +S QK  LVA +IRGK V+ AL  L FS K+ A  V+K L SA+ANAE+N+ LDVD L V
Sbjct: 13  ISAQKARLVADLIRGKSVAHALNILNFSNKKAAVLVKKALESAIANAEHNNSLDVDDLKV 72

Query: 86  SEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           S  YV + + +KR   R + R  RI +    +TV V
Sbjct: 73  STIYVDEGMSLKRIMPRAKGRADRITKRTCHITVKV 108


>gi|323700811|ref|ZP_08112723.1| ribosomal protein L22 [Desulfovibrio sp. ND132]
 gi|323460743|gb|EGB16608.1| ribosomal protein L22 [Desulfovibrio desulfuricans ND132]
          Length = 110

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/108 (40%), Positives = 64/108 (59%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  +RVSP+K  +VA  I+GK V DAL  L F+ ++ A  + K L SAV+NAE  
Sbjct: 2   EAKAVAKFIRVSPRKTRIVAENIKGKGVEDALNILRFTPQKPADILSKVLYSAVSNAEQM 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
             +DVD L+V+   V +    KR   R   R  R+ +  S +T++V+E
Sbjct: 62  PGVDVDSLVVASVVVNEGPTWKRIQPRAMGRAYRVRKRTSHITIVVKE 109


>gi|114567836|ref|YP_754990.1| 50S ribosomal protein L22 [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
 gi|122317288|sp|Q0AUI5|RL22_SYNWW RecName: Full=50S ribosomal protein L22
 gi|114338771|gb|ABI69619.1| LSU ribosomal protein L22P [Syntrophomonas wolfei subsp. wolfei
           str. Goettingen]
          Length = 113

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/108 (40%), Positives = 66/108 (61%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AIA  +RVSP K   VA ++RGK   +A+A L ++ K+ A  +RK L SA+ANAE+N
Sbjct: 2   EARAIARYIRVSPFKARQVADLVRGKDTEEAMAILRYTNKKSAPLIRKVLQSAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            D+D + L+VS+ ++ +   +KR   R   R        S +TV++RE
Sbjct: 62  FDMDSNALVVSQIFIDEGPIVKRMRPRAYGRADVRRHRTSHITVVLRE 109


>gi|213158830|ref|YP_002320828.1| ribosomal protein L22 [Acinetobacter baumannii AB0057]
 gi|215482188|ref|YP_002324370.1| ribosomal protein L22 [Acinetobacter baumannii AB307-0294]
 gi|239503229|ref|ZP_04662539.1| 50S ribosomal protein L22 [Acinetobacter baumannii AB900]
 gi|255319810|ref|ZP_05361015.1| ribosomal protein L22 [Acinetobacter radioresistens SK82]
 gi|293610829|ref|ZP_06693129.1| 50S ribosomal protein L22 [Acinetobacter sp. SH024]
 gi|294839742|ref|ZP_06784425.1| 50S ribosomal protein L22 [Acinetobacter sp. 6013113]
 gi|294842658|ref|ZP_06787341.1| 50S ribosomal protein L22 [Acinetobacter sp. 6014059]
 gi|294860420|ref|ZP_06798189.1| 50S ribosomal protein L22 [Acinetobacter sp. 6013150]
 gi|301345015|ref|ZP_07225756.1| 50S ribosomal protein L22 [Acinetobacter baumannii AB056]
 gi|301512054|ref|ZP_07237291.1| 50S ribosomal protein L22 [Acinetobacter baumannii AB058]
 gi|301595189|ref|ZP_07240197.1| 50S ribosomal protein L22 [Acinetobacter baumannii AB059]
 gi|193078475|gb|ABO13473.2| 50S ribosomal protein L22 [Acinetobacter baumannii ATCC 17978]
 gi|213057990|gb|ACJ42892.1| ribosomal protein L22 [Acinetobacter baumannii AB0057]
 gi|213985807|gb|ACJ56106.1| ribosomal protein L22 [Acinetobacter baumannii AB307-0294]
 gi|255303129|gb|EET82341.1| ribosomal protein L22 [Acinetobacter radioresistens SK82]
 gi|292827173|gb|EFF85538.1| 50S ribosomal protein L22 [Acinetobacter sp. SH024]
 gi|322509503|gb|ADX04957.1| 50S ribosomal protein L22 [Acinetobacter baumannii 1656-2]
 gi|325123599|gb|ADY83122.1| 50S ribosomal protein L22 [Acinetobacter calcoaceticus PHEA-2]
          Length = 109

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 60/96 (62%)

Query: 26  VSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLIV 85
           +S QK  LVA +IRGK V+ AL  L FS K+ A  V+K L SA+ANAE+N+ LDVD L V
Sbjct: 12  ISAQKARLVADLIRGKSVAHALNILNFSNKKAAVLVKKALESAIANAEHNNSLDVDDLKV 71

Query: 86  SEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           S  YV + + +KR   R + R  RI +    +TV V
Sbjct: 72  STIYVDEGMSLKRIMPRAKGRADRITKRTCHITVKV 107


>gi|152972222|ref|YP_001337368.1| 50S ribosomal protein L22 [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
 gi|206579092|ref|YP_002236286.1| ribosomal protein L22 [Klebsiella pneumoniae 342]
 gi|238896811|ref|YP_002921556.1| 50S ribosomal protein L22 [Klebsiella pneumoniae NTUH-K2044]
 gi|261342785|ref|ZP_05970643.1| ribosomal protein L22 [Enterobacter cancerogenus ATCC 35316]
 gi|262045172|ref|ZP_06018199.1| 50S ribosomal protein L22 [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|288933271|ref|YP_003437330.1| ribosomal protein L22 [Klebsiella variicola At-22]
 gi|290512074|ref|ZP_06551442.1| 50S ribosomal protein L22 [Klebsiella sp. 1_1_55]
 gi|291619170|ref|YP_003521912.1| RplV [Pantoea ananatis LMG 20103]
 gi|296105023|ref|YP_003615169.1| 50S ribosomal protein L22 [Enterobacter cloacae subsp. cloacae ATCC
           13047]
 gi|311277730|ref|YP_003939961.1| ribosomal protein L22 [Enterobacter cloacae SCF1]
 gi|330002289|ref|ZP_08304283.1| ribosomal protein L22 [Klebsiella sp. MS 92-3]
 gi|166199469|sp|A6TEW7|RL22_KLEP7 RecName: Full=50S ribosomal protein L22
 gi|226733475|sp|B5XN99|RL22_KLEP3 RecName: Full=50S ribosomal protein L22
 gi|150957071|gb|ABR79101.1| 50S ribosomal protein L22 [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
 gi|206568150|gb|ACI09926.1| ribosomal protein L22 [Klebsiella pneumoniae 342]
 gi|238549138|dbj|BAH65489.1| 50S ribosomal protein L22 [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
 gi|259037492|gb|EEW38736.1| 50S ribosomal protein L22 [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|288314963|gb|EFC53901.1| ribosomal protein L22 [Enterobacter cancerogenus ATCC 35316]
 gi|288888000|gb|ADC56318.1| ribosomal protein L22 [Klebsiella variicola At-22]
 gi|289775864|gb|EFD83864.1| 50S ribosomal protein L22 [Klebsiella sp. 1_1_55]
 gi|291154200|gb|ADD78784.1| RplV [Pantoea ananatis LMG 20103]
 gi|295059482|gb|ADF64220.1| 50S ribosomal protein L22 [Enterobacter cloacae subsp. cloacae ATCC
           13047]
 gi|295096956|emb|CBK86046.1| LSU ribosomal protein L22P [Enterobacter cloacae subsp. cloacae
           NCTC 9394]
 gi|308746925|gb|ADO46677.1| ribosomal protein L22 [Enterobacter cloacae SCF1]
 gi|327395500|dbj|BAK12922.1| 50S ribosomal protein L22 RplV [Pantoea ananatis AJ13355]
 gi|328537362|gb|EGF63612.1| ribosomal protein L22 [Klebsiella sp. MS 92-3]
          Length = 110

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 64/99 (64%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R S QK+ LVA +IRGK+VS AL  L ++ K+ A  V+K L SA+ANAE+N   D+D L 
Sbjct: 11  RSSAQKVRLVADLIRGKKVSQALDILTYTNKKAAVLVKKVLESAIANAEHNDGADIDDLK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           V++ +V +   MKR   R + R  RI++  S +TV+V +
Sbjct: 71  VAKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSD 109


>gi|308233857|ref|ZP_07664594.1| ribosomal protein L22 [Atopobium vaginae DSM 15829]
 gi|328943565|ref|ZP_08241030.1| 50S ribosomal protein L22 [Atopobium vaginae DSM 15829]
 gi|327491534|gb|EGF23308.1| 50S ribosomal protein L22 [Atopobium vaginae DSM 15829]
          Length = 119

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/106 (41%), Positives = 61/106 (57%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A A  +R++P+K  +V  +IR K +  AL  L+FS +  A  V K L SAVANAENN
Sbjct: 8   EVKATAKFVRMAPRKARMVVDLIRNKSIDRALEALQFSTRAAAEPVTKVLKSAVANAENN 67

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           H+L    L+V  AYV +   +KR   R +    RI +  S +TV+V
Sbjct: 68  HNLRARTLVVKAAYVNEGPTLKRIRPRAKGSASRINKRTSHITVVV 113


>gi|52426098|ref|YP_089235.1| 50S ribosomal protein L22 [Mannheimia succiniciproducens MBEL55E]
 gi|81691302|sp|Q65QW0|RL22_MANSM RecName: Full=50S ribosomal protein L22
 gi|52308150|gb|AAU38650.1| RplV protein [Mannheimia succiniciproducens MBEL55E]
          Length = 110

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 63/99 (63%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R S QK  LVA +IRGK+V+ AL  L ++ K+ A  V+K L SA+ANAE+N   D+D L 
Sbjct: 11  RTSAQKARLVADLIRGKKVAAALEILTYTNKKAAALVKKVLESAIANAEHNDGADIDDLK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           V++ +V +   MKR   R + R  RI++  S +TV+V +
Sbjct: 71  VTKIFVDEGPSMKRVMPRAKGRADRILKRTSHITVVVSD 109


>gi|309777137|ref|ZP_07672100.1| ribosomal protein L22 [Erysipelotrichaceae bacterium 3_1_53]
 gi|313897198|ref|ZP_07830742.1| ribosomal protein L22 [Clostridium sp. HGF2]
 gi|308915007|gb|EFP60784.1| ribosomal protein L22 [Erysipelotrichaceae bacterium 3_1_53]
 gi|312957919|gb|EFR39543.1| ribosomal protein L22 [Clostridium sp. HGF2]
          Length = 111

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/108 (40%), Positives = 62/108 (57%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  + A  LR+ P+K  +V  +IRGK  ++A A L+F+    A  V K L SAVANA NN
Sbjct: 2   EVKSTAKTLRIPPRKARIVIDLIRGKDAAEAAAILKFTPNVAAEAVGKVLKSAVANAVNN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           HD+D ++L V   Y  + V +KRF  R +     I +  S +TV+V E
Sbjct: 62  HDMDEEKLYVKACYANEGVTLKRFMPRAKGSASAIHKRTSHITVVVDE 109


>gi|317049835|ref|YP_004117483.1| 50S ribosomal protein L22 [Pantoea sp. At-9b]
 gi|316951452|gb|ADU70927.1| ribosomal protein L22 [Pantoea sp. At-9b]
          Length = 110

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 64/99 (64%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R S QK+ LVA +IRGK+VS AL  L ++ K+ A  V+K L SA+ANAE+N   D+D L 
Sbjct: 11  RSSAQKVRLVADLIRGKKVSQALDILTYTNKKAAVLVKKVLESAIANAEHNDGADIDDLK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           V++ +V +   MKR   R + R  RI++  S +TV+V +
Sbjct: 71  VAKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSD 109


>gi|126666808|ref|ZP_01737785.1| 50S ribosomal protein L22 [Marinobacter sp. ELB17]
 gi|126628853|gb|EAZ99473.1| 50S ribosomal protein L22 [Marinobacter sp. ELB17]
          Length = 110

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 59/97 (60%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R+S QK  LVA  +RGK V DAL  L FS K+ AG ++K L SA+ANAE+N  LDVD L 
Sbjct: 11  RLSAQKARLVADQVRGKAVEDALNILTFSPKKAAGILKKALESAIANAEHNEGLDVDDLR 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           VS   V +   +KR   R + R  RI++    +TV V
Sbjct: 71  VSTVMVDEGPTLKRIKARAKGRADRIMKRTCHITVKV 107


>gi|116490663|ref|YP_810207.1| 50S ribosomal protein L22P [Oenococcus oeni PSU-1]
 gi|290890079|ref|ZP_06553162.1| hypothetical protein AWRIB429_0552 [Oenococcus oeni AWRIB429]
 gi|122277153|sp|Q04G80|RL22_OENOB RecName: Full=50S ribosomal protein L22
 gi|116091388|gb|ABJ56542.1| LSU ribosomal protein L22P [Oenococcus oeni PSU-1]
 gi|290480270|gb|EFD88911.1| hypothetical protein AWRIB429_0552 [Oenococcus oeni AWRIB429]
          Length = 120

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 66/119 (55%), Gaps = 2/119 (1%)

Query: 12  MGDN--EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           M +N   A A A  +R++P+K  LV   +RGK V++A A L+F        V K L SAV
Sbjct: 1   MAENVTSAKATAFQVRIAPRKARLVLDTVRGKSVNEAYAILKFLPNTGTEPVYKVLNSAV 60

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           ANAENN  LD   L++ EAY  +   MKRF  R +    +I +  S +T++V E   +G
Sbjct: 61  ANAENNFALDRADLVIKEAYANEGPTMKRFRPRAKGTASKINKRTSHITIVVSENDKKG 119


>gi|78357295|ref|YP_388744.1| 50S ribosomal protein L22 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|109893197|sp|Q30Z47|RL22_DESDG RecName: Full=50S ribosomal protein L22
 gi|78219700|gb|ABB39049.1| LSU ribosomal protein L22P [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 110

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 64/108 (59%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A A A  +RVSP+K  LVA  ++GK V DA+  L F+ ++  G + K + SA+ANAE  
Sbjct: 2   QAKATAKFVRVSPRKARLVAQNVKGKPVEDAMNILRFTPQKAGGLIFKVMHSALANAEQL 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
             +DVD ++V +  + +    KRF  R   R  RI++  S +TVI+ E
Sbjct: 62  PGIDVDAMVVKQVIINEGPTWKRFLPRSMGRANRILKRTSHITVILEE 109


>gi|170718251|ref|YP_001785271.1| 50S ribosomal protein L22 [Haemophilus somnus 2336]
 gi|189041954|sp|B0UX18|RL22_HAES2 RecName: Full=50S ribosomal protein L22
 gi|168826380|gb|ACA31751.1| ribosomal protein L22 [Haemophilus somnus 2336]
          Length = 110

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 63/99 (63%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R S QK  LVA ++RGK+V+ AL  L F+ K+ A  V+K L SA+ANAE+N   D+D L 
Sbjct: 11  RTSVQKARLVADLVRGKKVAQALEILTFTNKKAAALVKKVLESAIANAEHNDGADIDDLK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           V++ +V +   MKR   R + R  RI++  S +TV+V +
Sbjct: 71  VAKIFVDEGPSMKRVMPRAKGRADRILKRTSHITVVVSD 109


>gi|323490628|ref|ZP_08095833.1| 50S ribosomal protein L22 [Planococcus donghaensis MPA1U2]
 gi|323395720|gb|EGA88561.1| 50S ribosomal protein L22 [Planococcus donghaensis MPA1U2]
          Length = 113

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 70/108 (64%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A A+A  +R++P+K+ LV  +IRGK++ +A+A L  + K  +  V K L SA ANAE+N
Sbjct: 2   QAKAVARTVRIAPRKVRLVVDLIRGKQIGEAVAILNHTPKAASVVVEKLLKSAAANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           +++D++ L++SE +V +   +KRF  R   R   I +  S +T++V +
Sbjct: 62  YEMDLNDLVISEVFVDEGPTLKRFRPRAMGRASAINKRTSHITLVVSD 109


>gi|224542243|ref|ZP_03682782.1| hypothetical protein CATMIT_01418 [Catenibacterium mitsuokai DSM
           15897]
 gi|224524785|gb|EEF93890.1| hypothetical protein CATMIT_01418 [Catenibacterium mitsuokai DSM
           15897]
          Length = 110

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 61/108 (56%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A  +RVSPQK  LV  ++RGK V +AL  LEF+ K     + K + SA ANA NN
Sbjct: 2   EARATAKTIRVSPQKARLVVDLVRGKSVKEALGILEFTNKSATPAIIKVVNSAKANAVNN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
              D D+L + + YV +   +KRF  R +    +I++    +T +V E
Sbjct: 62  EGADEDKLYIKKIYVDEGPTLKRFRARAKGSGTQILKRTCHITCVVEE 109


>gi|121608248|ref|YP_996055.1| 50S ribosomal protein L22 [Verminephrobacter eiseniae EF01-2]
 gi|215274881|sp|A1WHD0|RL22_VEREI RecName: Full=50S ribosomal protein L22
 gi|121552888|gb|ABM57037.1| LSU ribosomal protein L22P [Verminephrobacter eiseniae EF01-2]
          Length = 110

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 63/106 (59%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E +AI   +R+S  K  LVA +IRGK+V  AL  L F++K+ AG +RK L SA+ANAE+N
Sbjct: 3   ETHAILRGVRLSVDKGRLVADLIRGKKVDQALNILNFTQKKAAGIIRKVLESAIANAEHN 62

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L V   +V +   +KR   R + R  RI +P   + V V
Sbjct: 63  DSADIDELKVKTIHVEQGTTLKRSAARAKGRGNRISKPTCHVYVTV 108


>gi|313200086|ref|YP_004038744.1| 50S ribosomal protein L22 [Methylovorus sp. MP688]
 gi|312439402|gb|ADQ83508.1| ribosomal protein L22 [Methylovorus sp. MP688]
          Length = 91

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 39/89 (43%), Positives = 57/89 (64%)

Query: 33  LVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLIVSEAYVGK 92
           +VA +IRGK+V  AL  L F+ K+ A  ++K + SA+ANAE+N   D+D L V+  YV K
Sbjct: 1   MVADLIRGKKVDYALNILNFTPKKGAEIIKKVVESAIANAEHNEGADIDELKVTSIYVDK 60

Query: 93  SVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
            + +KR   R + R GRI++P   +TV V
Sbjct: 61  GIVLKRIRARAKGRAGRIIKPTCHITVTV 89


>gi|134096316|ref|YP_001101391.1| 50S ribosomal protein L22 [Herminiimonas arsenicoxydans]
 gi|166199502|sp|A4G9T3|RL22_HERAR RecName: Full=50S ribosomal protein L22
 gi|133740219|emb|CAL63270.1| 50S ribosomal subunit protein L22 [Herminiimonas arsenicoxydans]
          Length = 109

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 61/106 (57%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  AI   +R+S QK  LVA  IRGK+V  AL  L+FS K+ A  +++ L SA+ANAE+N
Sbjct: 2   ETKAILKGVRLSDQKGRLVADQIRGKKVDAALNLLQFSPKKGAAIIKRVLESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L V   YV K   +KRF  R + R  RI +    + V V
Sbjct: 62  DGADIDELFVKTIYVEKGPILKRFTARAKGRGDRISKQSCHIYVTV 107


>gi|239817868|ref|YP_002946778.1| 50S ribosomal protein L22 [Variovorax paradoxus S110]
 gi|319796212|ref|YP_004157852.1| ribosomal protein l22 [Variovorax paradoxus EPS]
 gi|259646266|sp|C5CP48|RL22_VARPS RecName: Full=50S ribosomal protein L22
 gi|239804445|gb|ACS21512.1| ribosomal protein L22 [Variovorax paradoxus S110]
 gi|315598675|gb|ADU39741.1| ribosomal protein L22 [Variovorax paradoxus EPS]
          Length = 110

 Score = 76.3 bits (186), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 64/107 (59%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
           +E  A+   +R+S  K  LVA +IRGK+V  AL  L+F++K+ A  ++K L SA+ANAE+
Sbjct: 2   SETRAVLRGVRLSVDKGRLVADLIRGKKVDQALNVLQFTQKKAAVIIKKVLESAIANAEH 61

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           N   D+D L V   YV +   +KRF  R + R  RI +P   + V V
Sbjct: 62  NDGADIDELKVKTIYVEQGATLKRFTARAKGRGNRISKPTCHVYVTV 108


>gi|146313380|ref|YP_001178454.1| 50S ribosomal protein L22 [Enterobacter sp. 638]
 gi|166986972|sp|A4WFC3|RL22_ENT38 RecName: Full=50S ribosomal protein L22
 gi|145320256|gb|ABP62403.1| LSU ribosomal protein L22P [Enterobacter sp. 638]
          Length = 110

 Score = 76.3 bits (186), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 64/99 (64%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R S QK+ LVA +IRGK+VS AL  L ++ K+ A  V+K L SA+ANAE+N   D+D L 
Sbjct: 11  RSSAQKVRLVADLIRGKKVSQALDILTYTNKKAAVFVKKVLESAIANAEHNDGADIDDLK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           V++ +V +   MKR   R + R  RI++  S +TV+V +
Sbjct: 71  VAKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSD 109


>gi|257067055|ref|YP_003153311.1| 50S ribosomal protein L22 [Anaerococcus prevotii DSM 20548]
 gi|256798935|gb|ACV29590.1| ribosomal protein L22 [Anaerococcus prevotii DSM 20548]
          Length = 115

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/111 (38%), Positives = 66/111 (59%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  AIA   R+SP K++ +A  IRGK+V +AL  L F+ K+ A  +   L SA+ANAENN
Sbjct: 2   EVKAIAKYQRISPLKVHYIAREIRGKQVDEALNILRFTNKKGARLLSDVLKSAIANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           + LD   L V +AY   +  MKR+H + +     I++  S + V++ ++ D
Sbjct: 62  NGLDRANLYVKKAYANDAPTMKRWHPKAKGAAYPILKRSSHIGVVLADIED 112


>gi|209693929|ref|YP_002261857.1| 50S ribosomal protein L22 [Aliivibrio salmonicida LFI1238]
 gi|226733423|sp|B6EPT0|RL22_ALISL RecName: Full=50S ribosomal protein L22
 gi|208007880|emb|CAQ78010.1| 50S ribosomal subunit protein L22 [Aliivibrio salmonicida LFI1238]
          Length = 110

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 60/96 (62%)

Query: 26  VSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLIV 85
           +SPQK  LVA  IRGK V  AL  L FS K+ A  ++K + SA+ANAE+N   D+D L V
Sbjct: 12  ISPQKARLVADQIRGKSVDQALEILTFSNKKAAVIIKKVVESAIANAEHNEGADIDDLNV 71

Query: 86  SEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           ++ +V +   MKR   R + R  RI++  S +T++V
Sbjct: 72  AKIFVDEGPIMKRIMPRAKGRADRILKRSSHITIVV 107


>gi|119502929|ref|ZP_01625014.1| 50S ribosomal protein L22 [marine gamma proteobacterium HTCC2080]
 gi|119461275|gb|EAW42365.1| 50S ribosomal protein L22 [marine gamma proteobacterium HTCC2080]
          Length = 112

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 60/97 (61%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R+S QK  LVA  +RG  V +AL  LEFS+K+ A  VRK L SA+ANAENN   DVD L 
Sbjct: 11  RISAQKARLVADEVRGMPVGEALNLLEFSKKKAAHLVRKLLNSAIANAENNEGADVDELR 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           V+  +V + + MKR   R + R  RI++    +TV V
Sbjct: 71  VATIFVDEGLTMKRMRPRAKGRGDRILKRTCHITVKV 107


>gi|317125867|ref|YP_004099979.1| 50S ribosomal protein L22P [Intrasporangium calvum DSM 43043]
 gi|315589955|gb|ADU49252.1| LSU ribosomal protein L22P [Intrasporangium calvum DSM 43043]
          Length = 121

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 48/118 (40%), Positives = 68/118 (57%), Gaps = 5/118 (4%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A  +RVSPQK   V  +IRGK V++A+  L F+ +  +  V+K L SA+ANA   
Sbjct: 2   EAKASARHVRVSPQKARRVVDLIRGKAVTEAVTTLTFAPQAASEPVKKVLESAIANARFR 61

Query: 76  HD-----LDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
            D      D   L+V+ A+V +   MKRF  R + R GRI +  S +TVIV ++  +G
Sbjct: 62  ADRESLAFDERELVVTSAFVDEGPTMKRFRPRAQGRAGRINKRTSHITVIVSQLEKKG 119


>gi|238898922|ref|YP_002924604.1| 50S ribosomal subunit protein L22 [Candidatus Hamiltonella defensa
           5AT (Acyrthosiphon pisum)]
 gi|259646250|sp|C4K7B3|RL22_HAMD5 RecName: Full=50S ribosomal protein L22
 gi|229466682|gb|ACQ68456.1| 50S ribosomal subunit protein L22 [Candidatus Hamiltonella defensa
           5AT (Acyrthosiphon pisum)]
          Length = 116

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 63/104 (60%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R S QK+ LV  +IRGK+V  AL  L ++ K+ A  V+K L SAVANAENN   D+D L 
Sbjct: 11  RSSAQKVRLVVDLIRGKQVPRALEILSYTNKKAAVLVKKVLESAVANAENNDGADIDELK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           ++  +V +   MKR   R + R  RI++  S +TV+V +  D G
Sbjct: 71  ITRIFVDEGPTMKRTMPRAKGRADRILKRTSHITVVVSDGRDSG 114


>gi|188535273|ref|YP_001909070.1| 50S ribosomal protein L22 [Erwinia tasmaniensis Et1/99]
 gi|259909994|ref|YP_002650350.1| 50S ribosomal protein L22 [Erwinia pyrifoliae Ep1/96]
 gi|292489844|ref|YP_003532734.1| 50S ribosomal protein L22 [Erwinia amylovora CFBP1430]
 gi|292900886|ref|YP_003540255.1| 50S ribosomal protein L22 [Erwinia amylovora ATCC 49946]
 gi|226733464|sp|B2VK59|RL22_ERWT9 RecName: Full=50S ribosomal protein L22
 gi|188030315|emb|CAO98204.1| 50S ribosomal protein L22 [Erwinia tasmaniensis Et1/99]
 gi|224965616|emb|CAX57148.1| 50S ribosomal protein L22 [Erwinia pyrifoliae Ep1/96]
 gi|283480091|emb|CAY76007.1| 50S ribosomal protein L22 [Erwinia pyrifoliae DSM 12163]
 gi|291200734|emb|CBJ47867.1| 50S ribosomal subunit protein L22 [Erwinia amylovora ATCC 49946]
 gi|291555281|emb|CBA23579.1| 50S ribosomal protein L22 [Erwinia amylovora CFBP1430]
 gi|307628350|gb|ADN72654.1| 50S ribosomal protein L22 [Escherichia coli UM146]
 gi|310765593|gb|ADP10543.1| 50S ribosomal protein L22 [Erwinia sp. Ejp617]
 gi|312174026|emb|CBX82279.1| 50S ribosomal protein L22 [Erwinia amylovora ATCC BAA-2158]
          Length = 110

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 64/99 (64%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R S QK+ LVA ++RGK+VS AL  L ++ K+ A  V+K L SA+ANAE+N   D+D L 
Sbjct: 11  RSSAQKVRLVADLVRGKKVSQALDILTYTNKKAAVLVKKVLESAIANAEHNDGADIDDLK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           V++ +V +   MKR   R + R  RI++  S +TV+V +
Sbjct: 71  VTKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSD 109


>gi|254449310|ref|ZP_05062755.1| ribosomal protein L22 [gamma proteobacterium HTCC5015]
 gi|198261069|gb|EDY85369.1| ribosomal protein L22 [gamma proteobacterium HTCC5015]
          Length = 109

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 58/97 (59%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R S QK  LVA  IRG  V  A+  L+FS K+ +  V+K L SAVANAE+N   D+D L 
Sbjct: 11  RTSAQKARLVADQIRGLPVERAVELLQFSPKKSSALVKKVLESAVANAEHNEGADIDELT 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           VS  +V +   MKRF  R + R  RI++  S +TV V
Sbjct: 71  VSAVFVDEGPTMKRFQARAKGRGNRILKRTSHITVTV 107


>gi|307244768|ref|ZP_07526869.1| ribosomal protein L22 [Peptostreptococcus stomatis DSM 17678]
 gi|306491866|gb|EFM63918.1| ribosomal protein L22 [Peptostreptococcus stomatis DSM 17678]
          Length = 112

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 65/108 (60%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A  +RVS +K   +  ++RGK V++ALA L+F+ +  A  + K + SA ANAENN
Sbjct: 2   EAKATAKYVRVSARKAGQICDLVRGKDVNEALAILKFTPRYAAEVIAKVVKSAAANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           H++D D+L ++     +   MKRF  R + R   I +  S + V+V+E
Sbjct: 62  HEMDTDKLYIASIVANQGPTMKRFMPRAQGRATAIRKRTSHIEVVVKE 109


>gi|163847928|ref|YP_001635972.1| 50S ribosomal protein L22 [Chloroflexus aurantiacus J-10-fl]
 gi|222525808|ref|YP_002570279.1| 50S ribosomal protein L22 [Chloroflexus sp. Y-400-fl]
 gi|189041942|sp|A9WH71|RL22_CHLAA RecName: Full=50S ribosomal protein L22
 gi|254800429|sp|B9LJD7|RL22_CHLSY RecName: Full=50S ribosomal protein L22
 gi|163669217|gb|ABY35583.1| ribosomal protein L22 [Chloroflexus aurantiacus J-10-fl]
 gi|222449687|gb|ACM53953.1| ribosomal protein L22 [Chloroflexus sp. Y-400-fl]
          Length = 113

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 42/111 (37%), Positives = 65/111 (58%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+   +R+SP K+ LV  ++RG  V  ALA L +  ++ A EV +T+ SA ANAE+N
Sbjct: 2   EAKAVTRYVRISPLKVRLVMDVVRGMNVDRALATLRYMPQKAAREVARTIKSAAANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
            D+D + L +   Y  +   +KR   R R    RI +P + +TV+V + S+
Sbjct: 62  FDMDRESLYIKTIYADQGPVLKRIMPRARGMANRIRKPTTHITVVVADRSE 112


>gi|152978146|ref|YP_001343775.1| 50S ribosomal protein L22 [Actinobacillus succinogenes 130Z]
 gi|171704190|sp|A6VLJ3|RL22_ACTSZ RecName: Full=50S ribosomal protein L22
 gi|150839869|gb|ABR73840.1| ribosomal protein L22 [Actinobacillus succinogenes 130Z]
          Length = 110

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 63/99 (63%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R S QK  LVA +IRGK+V+ AL  L ++ K+ A  V+K L SA+ANAE+N   D+D L 
Sbjct: 11  RTSAQKARLVADLIRGKKVAAALEILTYTNKKAAALVKKVLESAIANAEHNDGADIDDLK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           V++ +V +   MKR   R + R  RI++  S +TV+V +
Sbjct: 71  VAKIFVDEGPSMKRVMPRAKGRADRILKRTSHITVVVSD 109


>gi|325479149|gb|EGC82246.1| ribosomal protein L22 [Anaerococcus prevotii ACS-065-V-Col13]
          Length = 115

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/111 (38%), Positives = 66/111 (59%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  AIA   R+SP K++ +A  IRGK+V +AL  L F+ K+ A  +   L SA+ANAENN
Sbjct: 2   EVKAIAKYQRISPLKVHYIAREIRGKQVDEALDILRFTNKKGARLLSDVLKSAIANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           + LD   L V +AY   +  MKR+H + +     I++  S + V++ ++ D
Sbjct: 62  NGLDRANLYVKKAYANDAPTMKRWHPKAKGAAYPILKRSSHIGVVLADIED 112


>gi|293602630|ref|ZP_06685073.1| 50S ribosomal protein L22 [Achromobacter piechaudii ATCC 43553]
 gi|292819002|gb|EFF78040.1| 50S ribosomal protein L22 [Achromobacter piechaudii ATCC 43553]
          Length = 109

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 63/106 (59%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  AI   + +S QK  LVA MIRG++V  AL  L FS K+ A  ++K + SA+ANAE+N
Sbjct: 2   ETTAIIRGVHISAQKTRLVADMIRGQKVGRALEILTFSPKKAAVILKKAVESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L V+  +V K+  MKRF  R + R  RI +    +TV V
Sbjct: 62  DGADIDELKVTTIFVDKAQSMKRFSARAKGRGNRIEKQTCHITVKV 107


>gi|229815770|ref|ZP_04446095.1| hypothetical protein COLINT_02819 [Collinsella intestinalis DSM
           13280]
 gi|229808686|gb|EEP44463.1| hypothetical protein COLINT_02819 [Collinsella intestinalis DSM
           13280]
          Length = 121

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/103 (43%), Positives = 61/103 (59%)

Query: 19  AIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDL 78
           A A  +RVSP K  LV  +IRGK V+ A   L F  + +A +V K L SAVANAE+N+ +
Sbjct: 13  ATAKYVRVSPGKARLVIDLIRGKNVAQAFDILHFCTRSVAVDVEKVLRSAVANAEHNNQM 72

Query: 79  DVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
             D L+V  AYV +   +KR   R +    RI++  S +TVIV
Sbjct: 73  RADDLVVKAAYVDEGPTLKRIRPRAKGSASRILKRTSHITVIV 115


>gi|195939864|ref|ZP_03085246.1| 50S ribosomal protein L22 [Escherichia coli O157:H7 str. EC4024]
          Length = 110

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 64/99 (64%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R S QK+ LVA +IRGK+VS AL  L ++ K+ A  V+K L SA+ANAE+N   D+D L 
Sbjct: 11  RSSAQKVRLVADLIRGKKVSQALDILTYTNKKAAVLVKKVLESAIANAEHNDGADIDDLK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           V++ +V +   MKR   R + R  RI++  S +TV+V +
Sbjct: 71  VTKIFVDEGPSMKRIMPRAKCRADRILKRTSHITVVVSD 109


>gi|56477599|ref|YP_159188.1| 50S ribosomal protein L22 [Aromatoleum aromaticum EbN1]
 gi|81677439|sp|Q5P327|RL22_AZOSE RecName: Full=50S ribosomal protein L22
 gi|56313642|emb|CAI08287.1| 50S ribosomal protein L22 [Aromatoleum aromaticum EbN1]
          Length = 109

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/108 (42%), Positives = 63/108 (58%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  AI   +R+S QK  LVA  +RG+ V  AL  L FS K+ A  +RK + SA+ANAE+N
Sbjct: 2   ETRAILRGVRLSAQKGRLVADQVRGRPVDQALNILAFSPKKGAQIIRKVMESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
              D+D L V   YV + + +KRF  R + R  RI++P   + V V E
Sbjct: 62  DGADIDTLKVKTIYVEEGMSLKRFAARAKGRGARILKPTCHIYVTVGE 109


>gi|291166874|gb|EFE28920.1| 50S ribosomal protein L22 [Filifactor alocis ATCC 35896]
          Length = 114

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 64/108 (59%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  +R SP+K   V +++RGK V +ALA L+F+    A  + K + SA ANAENN
Sbjct: 6   EARAVAKYVRTSPRKAGFVCSLVRGKSVDEALAILKFTPNNSADIIAKVVKSAAANAENN 65

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            ++D D+L V+     +   +KRF  R + R   I +  S + VIV+E
Sbjct: 66  FEMDRDKLYVAHIVANQGPTLKRFRPRAQGRATAIHKRTSHIEVIVKE 113


>gi|159901431|ref|YP_001547678.1| 50S ribosomal protein L22 [Herpetosiphon aurantiacus ATCC 23779]
 gi|254800442|sp|A9B417|RL22_HERA2 RecName: Full=50S ribosomal protein L22
 gi|159894470|gb|ABX07550.1| ribosomal protein L22 [Herpetosiphon aurantiacus ATCC 23779]
          Length = 113

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 44/116 (37%), Positives = 71/116 (61%), Gaps = 4/116 (3%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A AI    R+SPQK+ LVA ++RGK V++AL  L++   + A E+ + + SA ANA++N
Sbjct: 2   QAKAILRNFRMSPQKVRLVADLVRGKNVTEALGILQYLPHKAAPEIARVIKSAKANADHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEGKVV 131
           + +  + L+V    V     +KR+  R R R  RI++  S +TVIV    D+G+V+
Sbjct: 62  YQMSPEDLVVKTIMVDAGPVLKRYMPRARGRGDRILKRSSHITVIV----DDGEVL 113


>gi|313904947|ref|ZP_07838318.1| ribosomal protein L22 [Eubacterium cellulosolvens 6]
 gi|313470204|gb|EFR65535.1| ribosomal protein L22 [Eubacterium cellulosolvens 6]
          Length = 128

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 52/124 (41%), Positives = 68/124 (54%), Gaps = 3/124 (2%)

Query: 3   GKRSVSKRRMGDNEAN---AIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAG 59
           G RS  KR   +N+ N   A  S  RVS QK   V   IRGK V  AL  L +S +  + 
Sbjct: 4   GHRSQIKRERNENKDNRPSAKLSYARVSVQKACYVLDAIRGKDVETALGILTYSPRYASS 63

Query: 60  EVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTV 119
            V+K L SA+ANAENN+ L  + L V+E Y  K+  MKR H R + R  RI    S ++V
Sbjct: 64  IVKKLLESAIANAENNNGLSRNNLYVAECYANKAPTMKRIHPRAQGRAYRIEHLTSHISV 123

Query: 120 IVRE 123
           ++ E
Sbjct: 124 VLDE 127


>gi|159028201|emb|CAO89808.1| rplV [Microcystis aeruginosa PCC 7806]
          Length = 119

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 60/107 (56%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
           NE  AIA  +R+SP K+  V   IRG+   +AL  LEF   R    + K L SAVANAEN
Sbjct: 7   NEVKAIARYIRMSPLKVRRVLDQIRGRSYREALIILEFMPYRACDPILKVLRSAVANAEN 66

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           N  LD   L+VS+A+      +KRF  R + R  +I +P   +TV V
Sbjct: 67  NEGLDPATLVVSQAFADGGPTLKRFRPRAQGRAYQIRKPTCHITVAV 113


>gi|237749520|ref|ZP_04580000.1| large subunit ribosomal protein L22 [Oxalobacter formigenes OXCC13]
 gi|229380882|gb|EEO30973.1| large subunit ribosomal protein L22 [Oxalobacter formigenes OXCC13]
          Length = 110

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/98 (43%), Positives = 59/98 (60%)

Query: 24  LRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRL 83
           + +S QK  LVA +IRGK+V  AL  L F+ K+ A  +++ L SA+ANAE+N   D+D L
Sbjct: 11  VHLSAQKGRLVADLIRGKKVDQALDILAFTPKKAAVIIKQVLESAIANAEHNDGADIDEL 70

Query: 84  IVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
            VS  YV K  FMKR+  R + R  RI +    + V V
Sbjct: 71  KVSSIYVEKGTFMKRYSARAKGRGDRISKQTCHIYVTV 108


>gi|262370573|ref|ZP_06063898.1| predicted protein [Acinetobacter johnsonii SH046]
 gi|262314373|gb|EEY95415.1| predicted protein [Acinetobacter johnsonii SH046]
          Length = 110

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 59/96 (61%)

Query: 26  VSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLIV 85
           +S QK  LVA +IRGK V+ AL  L FS K+ A  V+K L SA+ANAE+N+ LDVD L V
Sbjct: 13  ISAQKTRLVADLIRGKSVAHALNILNFSNKKAAVLVKKALESAIANAEHNNSLDVDDLKV 72

Query: 86  SEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           +  YV +   +KR   R + R  RI +    +TV V
Sbjct: 73  TTIYVDEGTSLKRIMPRAKGRADRITKRTCHITVKV 108


>gi|194291017|ref|YP_002006924.1| 50S ribosomal protein l22 [Cupriavidus taiwanensis LMG 19424]
 gi|300702785|ref|YP_003744386.1| 50S ribosomal protein L22 [Ralstonia solanacearum CFBP2957]
 gi|226733451|sp|B3R7R8|RL22_CUPTR RecName: Full=50S ribosomal protein L22
 gi|193224852|emb|CAQ70863.1| 50S ribosomal subunit protein L22 [Cupriavidus taiwanensis LMG
           19424]
 gi|299070447|emb|CBJ41742.1| 50S ribosomal subunit protein L22 [Ralstonia solanacearum CFBP2957]
          Length = 109

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 60/106 (56%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  AI    R+S QK  LVA  IRG  +  AL  L FS K+ AG V+K + SA+ANAE+N
Sbjct: 2   EVKAIHRGARISAQKTRLVADQIRGLPIERALNVLTFSPKKAAGIVKKVVESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L V   YV K+  +KRF  R + R  RI +    +TV +
Sbjct: 62  EGADIDELKVKSIYVDKATSLKRFTARAKGRGNRIEKQTCHITVTL 107


>gi|326385094|ref|ZP_08206764.1| 50S ribosomal protein L22 [Gordonia neofelifaecis NRRL B-59395]
 gi|326196179|gb|EGD53383.1| 50S ribosomal protein L22 [Gordonia neofelifaecis NRRL B-59395]
          Length = 136

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 67/122 (54%), Gaps = 9/122 (7%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A A  +RV+P K   V  ++RGK V +AL  L F+ +  +  V K L SAVANAENN 
Sbjct: 4   ARATAKFVRVTPMKARRVIDLVRGKNVDEALDILRFAPQAASEPVYKVLASAVANAENNV 63

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRI---------VRPFSRLTVIVREVSDE 127
            LD   L+VSEA+  +   +KRF  R + R  RI          +P S +TV+V  V + 
Sbjct: 64  GLDRRTLVVSEAFADEGPTLKRFQPRAQGRAFRIRKRTSHISTRKPPSHITVVVSAVENG 123

Query: 128 GK 129
           G+
Sbjct: 124 GR 125


>gi|120609046|ref|YP_968724.1| 50S ribosomal protein L22 [Acidovorax citrulli AAC00-1]
 gi|215274805|sp|A1TJ12|RL22_ACIAC RecName: Full=50S ribosomal protein L22
 gi|120587510|gb|ABM30950.1| LSU ribosomal protein L22P [Acidovorax citrulli AAC00-1]
          Length = 110

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 63/107 (58%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
           +E  A+   +R+S  K  LVA +IRGK+V  AL  L F++K+ A  V+K L SA+ANAE+
Sbjct: 2   SETRAVLRGVRLSVDKGRLVADLIRGKKVDQALNILTFTQKKAAVIVKKVLESAIANAEH 61

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           N   D+D L V   YV +   +KRF  R + R  RI +P   + V V
Sbjct: 62  NDGADIDELKVKTIYVEQGTTLKRFTARAKGRGNRISKPTCHVYVTV 108


>gi|294101633|ref|YP_003553491.1| ribosomal protein L22 [Aminobacterium colombiense DSM 12261]
 gi|293616613|gb|ADE56767.1| ribosomal protein L22 [Aminobacterium colombiense DSM 12261]
          Length = 110

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 44/108 (40%), Positives = 65/108 (60%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  +R+SP K+  +  +IRGK+V +A+  L++S ++ AG V K L SAVANAE+N
Sbjct: 2   EARALAKQVRISPYKVRRILPLIRGKKVDEAMMILKYSPQKAAGIVSKVLQSAVANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           + +D D+L V +A   +   MKRF      R        S +T+IV E
Sbjct: 62  YGMDTDKLRVVKATADQGPRMKRFRPVSMGRAHPYQHRTSHVTIIVAE 109


>gi|332041528|gb|EGI77888.1| 50S ribosomal protein L22 [Hylemonella gracilis ATCC 19624]
          Length = 109

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/98 (43%), Positives = 60/98 (61%)

Query: 24  LRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRL 83
           +R+S  K  LVA +IRGK+V  AL  L+F++K+ A  +RK L SA+ANAE+N   D+D L
Sbjct: 10  VRLSVDKGRLVADLIRGKKVDQALNILQFTQKKAALIIRKVLESAIANAEHNDGADIDEL 69

Query: 84  IVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
            V   YV +   +KRF  R + R  RI +P   + V V
Sbjct: 70  KVKTIYVEQGTTLKRFTARAKGRGNRISKPTCHVYVTV 107


>gi|187930359|ref|YP_001900846.1| 50S ribosomal protein L22 [Ralstonia pickettii 12J]
 gi|241664527|ref|YP_002982887.1| 50S ribosomal protein L22 [Ralstonia pickettii 12D]
 gi|309782839|ref|ZP_07677559.1| ribosomal protein L22 [Ralstonia sp. 5_7_47FAA]
 gi|226733500|sp|B2UEL4|RL22_RALPJ RecName: Full=50S ribosomal protein L22
 gi|187727249|gb|ACD28414.1| ribosomal protein L22 [Ralstonia pickettii 12J]
 gi|240866554|gb|ACS64215.1| ribosomal protein L22 [Ralstonia pickettii 12D]
 gi|308918263|gb|EFP63940.1| ribosomal protein L22 [Ralstonia sp. 5_7_47FAA]
          Length = 109

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 60/106 (56%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  AI    R+S QK  LVA  IRG  +  AL  L FS K+ AG V+K + SA+ANAE+N
Sbjct: 2   EVKAIHRGARISAQKTRLVADQIRGLSIERALNVLTFSPKKAAGIVKKVVESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L V   Y+ K+  +KRF  R + R  RI +    +TV +
Sbjct: 62  EGADIDELKVKSIYIDKATSLKRFTARAKGRGNRIEKQTCHITVTL 107


>gi|242278663|ref|YP_002990792.1| ribosomal protein L22 [Desulfovibrio salexigens DSM 2638]
 gi|259646241|sp|C6C190|RL22_DESAD RecName: Full=50S ribosomal protein L22
 gi|242121557|gb|ACS79253.1| ribosomal protein L22 [Desulfovibrio salexigens DSM 2638]
          Length = 110

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 65/109 (59%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AIA  +R+SP+K+ LVA  I+GK V +AL  L+F+ K+ A  + K L SAVANAE  
Sbjct: 2   EARAIAKYMRISPRKVRLVAENIKGKPVEEALNILKFTPKKGAEMLSKVLYSAVANAEQI 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV 124
             +DVD L V    V +    KR   R   R  RI +  S +TV+V+E+
Sbjct: 62  PGVDVDSLCVDIVKVDEGPTWKRIQPRAMGRAYRIRKRTSHITVVVKEM 110


>gi|33594484|ref|NP_882128.1| 50S ribosomal protein L22 [Bordetella pertussis Tohama I]
 gi|33594756|ref|NP_882399.1| 50S ribosomal protein L22 [Bordetella parapertussis 12822]
 gi|33599027|ref|NP_886587.1| 50S ribosomal protein L22 [Bordetella bronchiseptica RB50]
 gi|187476544|ref|YP_784568.1| 50S ribosomal protein L22 [Bordetella avium 197N]
 gi|51316366|sp|Q7VTC8|RL22_BORPE RecName: Full=50S ribosomal protein L22
 gi|51316373|sp|Q7W2F1|RL22_BORPA RecName: Full=50S ribosomal protein L22
 gi|51316380|sp|Q7WRC0|RL22_BORBR RecName: Full=50S ribosomal protein L22
 gi|109893183|sp|Q2L2E3|RL22_BORA1 RecName: Full=50S ribosomal protein L22
 gi|33564560|emb|CAE43876.1| 50S ribosomal protein L22 [Bordetella pertussis Tohama I]
 gi|33564832|emb|CAE39775.1| 50S ribosomal protein L22 [Bordetella parapertussis]
 gi|33575073|emb|CAE30536.1| 50S ribosomal protein L22 [Bordetella bronchiseptica RB50]
 gi|115421130|emb|CAJ47614.1| 50S ribosomal protein L22 [Bordetella avium 197N]
          Length = 109

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 63/106 (59%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  AI   + +S QK  LVA +IRGK V+ AL  L FS K+ A  ++K + SA+ANAE+N
Sbjct: 2   ETTAIIRGVHISAQKTRLVADLIRGKSVAQALNILTFSPKKAAVILKKAVESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L V+  +V K+  MKRF  R + R  RI +    +TV V
Sbjct: 62  DGADIDELKVTTIFVDKAQSMKRFSARAKGRGNRIEKQTCHITVKV 107


>gi|239918194|ref|YP_002957752.1| LSU ribosomal protein L22P [Micrococcus luteus NCTC 2665]
 gi|281415615|ref|ZP_06247357.1| 50S ribosomal protein L22 [Micrococcus luteus NCTC 2665]
 gi|289706538|ref|ZP_06502888.1| ribosomal protein L22 [Micrococcus luteus SK58]
 gi|259646252|sp|C5CC57|RL22_MICLC RecName: Full=50S ribosomal protein L22
 gi|239839401|gb|ACS31198.1| LSU ribosomal protein L22P [Micrococcus luteus NCTC 2665]
 gi|289556673|gb|EFD50014.1| ribosomal protein L22 [Micrococcus luteus SK58]
          Length = 121

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 47/118 (39%), Positives = 69/118 (58%), Gaps = 5/118 (4%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AIA  LRV+P K   V  ++RGK+ ++ALA L+F+++  +  V K + SAVANA   
Sbjct: 2   EAKAIARHLRVTPMKARRVVDLVRGKQATEALAILKFAQQGASEPVYKLVTSAVANARVK 61

Query: 76  HD-----LDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
            D      D D L ++EA+V +   MKRF  R + R  RI +  S +TV+V    ++G
Sbjct: 62  ADREGQAFDEDALYITEAFVDEGPTMKRFQPRAQGRAYRINKRTSHVTVVVASKDEKG 119


>gi|146281175|ref|YP_001171328.1| 50S ribosomal protein L22 [Pseudomonas stutzeri A1501]
 gi|166221986|sp|A4VHN5|RL22_PSEU5 RecName: Full=50S ribosomal protein L22
 gi|145569380|gb|ABP78486.1| ribosomal protein L22 [Pseudomonas stutzeri A1501]
 gi|310941881|dbj|BAJ24294.1| 50S ribosomal protein L22 [Pseudomonas stutzeri]
 gi|327479328|gb|AEA82638.1| 50S ribosomal protein L22 [Pseudomonas stutzeri DSM 4166]
          Length = 110

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 62/106 (58%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A  S  R+S QK  LVA  IRGK+V DAL  L FS K+ A  ++K L SAVANAE+N
Sbjct: 2   EVAAKLSGARISAQKARLVADQIRGKKVGDALNLLAFSSKKAAEIMKKVLESAVANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              DVD L VS  +V +   +KR   R + R  RIV+    +TV V
Sbjct: 62  EGADVDDLKVSTVFVNEGRSLKRIMPRAKGRADRIVKRSCHITVKV 107


>gi|262197183|ref|YP_003268392.1| ribosomal protein L22 [Haliangium ochraceum DSM 14365]
 gi|262080530|gb|ACY16499.1| ribosomal protein L22 [Haliangium ochraceum DSM 14365]
          Length = 114

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/113 (39%), Positives = 67/113 (59%), Gaps = 2/113 (1%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A A+   + +SP+K+ +VA M+RG+RV +ALA L F  K+ A  + K L SA ANAE+ 
Sbjct: 2   QARAVVKHISMSPRKMRVVANMVRGERVEEALASLRFMPKKAARLIAKALESAAANAEDK 61

Query: 76  H--DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
              D+D+D L++   YV     +KR+  R   R  RI    S LTV+V + +D
Sbjct: 62  SGGDVDIDSLVIEGIYVDGGPIIKRWMPRAMGRANRINHRTSHLTVVVGDGND 114


>gi|262038257|ref|ZP_06011647.1| ribosomal protein L22 [Leptotrichia goodfellowii F0264]
 gi|261747724|gb|EEY35173.1| ribosomal protein L22 [Leptotrichia goodfellowii F0264]
          Length = 111

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 59/99 (59%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R+SPQK  LVA ++RGK    AL  L F+ K+ A  + KTL SA+ANAE+N  +D D+L 
Sbjct: 11  RLSPQKARLVADIVRGKNALQALNVLRFTNKKAAKYIEKTLKSAIANAEHNFQMDPDKLF 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           VS   + K   +KR + R   R   I +P + +TV V E
Sbjct: 71  VSRILIDKGPVLKRVNPRAMGRADVIRKPTAHITVEVDE 109


>gi|331005007|ref|ZP_08328414.1| LSU ribosomal protein L22p (L17e) [gamma proteobacterium IMCC1989]
 gi|330421173|gb|EGG95432.1| LSU ribosomal protein L22p (L17e) [gamma proteobacterium IMCC1989]
          Length = 111

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 66/112 (58%), Gaps = 3/112 (2%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A  S  R+S QK  LVA  IRGK V +AL  L FS+K+ A  ++K L SA+ANAE N
Sbjct: 3   EVAAKLSGARLSAQKARLVADQIRGKHVEEALDLLHFSKKKGAEIIKKVLESAIANAEQN 62

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
              DVD L VS  +V + + MKR   R + R  RI++    +TV   +V+DE
Sbjct: 63  EGADVDELRVSTIFVDEGMTMKRIRPRAKGRADRILKRSCHITV---KVADE 111


>gi|197117328|ref|YP_002137755.1| 50S ribosomal protein L22 [Geobacter bemidjiensis Bem]
 gi|253701917|ref|YP_003023106.1| 50S ribosomal protein L22 [Geobacter sp. M21]
 gi|322418369|ref|YP_004197592.1| 50S ribosomal protein L22 [Geobacter sp. M18]
 gi|226733469|sp|B5EFQ5|RL22_GEOBB RecName: Full=50S ribosomal protein L22
 gi|259646248|sp|C6E4Q2|RL22_GEOSM RecName: Full=50S ribosomal protein L22
 gi|197086688|gb|ACH37959.1| ribosomal protein L22 [Geobacter bemidjiensis Bem]
 gi|251776767|gb|ACT19348.1| ribosomal protein L22 [Geobacter sp. M21]
 gi|320124756|gb|ADW12316.1| ribosomal protein L22 [Geobacter sp. M18]
          Length = 111

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 44/108 (40%), Positives = 62/108 (57%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E++A  S +R+SP+K  LV  ++RGK +  AL  L FS +  A  + K L SAVANAE  
Sbjct: 2   ESSAKLSSVRLSPRKTRLVVDLVRGKGIQTALNTLRFSPQPSAKLISKLLSSAVANAEQK 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
              DVD+L V   +V     +KRF  R   R  +I +P S +TV++ E
Sbjct: 62  GCSDVDKLFVKTIFVDGGAVLKRFTPRAMGRASKIRKPTSHITVVLAE 109


>gi|91786172|ref|YP_547124.1| 50S ribosomal protein L22 [Polaromonas sp. JS666]
 gi|123165525|sp|Q12GW6|RL22_POLSJ RecName: Full=50S ribosomal protein L22
 gi|91695397|gb|ABE42226.1| LSU ribosomal protein L22P [Polaromonas sp. JS666]
          Length = 109

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/106 (40%), Positives = 62/106 (58%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A    +R+S  K  LVA +IRGK+V  AL  L F++K+ AG ++K + SA+ANAE+N
Sbjct: 2   ETRATLRGVRLSVDKGRLVADLIRGKKVDQALNILNFTQKKAAGIIKKVVESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L V   YV +   +KRF  R + R   I +P   + V+V
Sbjct: 62  DGADIDELKVKTIYVEQGATLKRFSARAKGRGNSISKPTCHVYVVV 107


>gi|251793832|ref|YP_003008564.1| 50S ribosomal protein L22 [Aggregatibacter aphrophilus NJ8700]
 gi|261866790|ref|YP_003254712.1| 50S ribosomal protein L22 [Aggregatibacter actinomycetemcomitans
           D11S-1]
 gi|293391700|ref|ZP_06636034.1| ribosomal protein L22 [Aggregatibacter actinomycetemcomitans D7S-1]
 gi|315633460|ref|ZP_07888750.1| 50S ribosomal protein L22 [Aggregatibacter segnis ATCC 33393]
 gi|2500297|sp|P55838|RL22_ACTAC RecName: Full=50S ribosomal protein L22
 gi|1841327|dbj|BAA10952.1| ribosomal protein L22 [Actinobacillus actinomycetemcomitans]
 gi|247535231|gb|ACS98477.1| ribosomal protein L22 [Aggregatibacter aphrophilus NJ8700]
 gi|261412122|gb|ACX81493.1| ribosomal protein L22 [Aggregatibacter actinomycetemcomitans
           D11S-1]
 gi|290952234|gb|EFE02353.1| ribosomal protein L22 [Aggregatibacter actinomycetemcomitans D7S-1]
 gi|315477502|gb|EFU68244.1| 50S ribosomal protein L22 [Aggregatibacter segnis ATCC 33393]
          Length = 110

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 63/99 (63%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R S QK  LVA +IRGK+V+ AL  L ++ K+ +  V+K L SA+ANAE+N   D+D L 
Sbjct: 11  RTSAQKARLVADLIRGKKVAQALEILTYTNKKASALVKKVLESAIANAEHNDGADIDDLK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           V++ +V +   MKR   R + R  RI++  S +TV+V +
Sbjct: 71  VAKIFVDEGPSMKRVMPRAKGRADRILKRTSHITVVVSD 109


>gi|167626801|ref|YP_001677301.1| 50S ribosomal protein L22 [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|241667382|ref|ZP_04754960.1| 50S ribosomal protein L22 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|189041951|sp|B0U0Y4|RL22_FRAP2 RecName: Full=50S ribosomal protein L22
 gi|167596802|gb|ABZ86800.1| 50S ribosomal protein L22 [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
          Length = 111

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/108 (42%), Positives = 61/108 (56%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A     ++S QK  LVA  IRG  V  A+  L FS K+ A  ++  L SA+ANAE+N
Sbjct: 2   EVQAKLKFAKISAQKCRLVADQIRGLPVEKAINLLTFSNKKAAVLIKDVLNSAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
             +DVD L VS  +V +   MKRF  R + R  RI++  S +TV V E
Sbjct: 62  DGMDVDSLFVSTVFVDEGPTMKRFEARAKGRGNRILKRTSHITVKVAE 109


>gi|152998266|ref|YP_001343101.1| 50S ribosomal protein L22 [Marinomonas sp. MWYL1]
 gi|215274830|sp|A6W387|RL22_MARMS RecName: Full=50S ribosomal protein L22
 gi|150839190|gb|ABR73166.1| ribosomal protein L22 [Marinomonas sp. MWYL1]
          Length = 110

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 61/97 (62%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R+S QK  LV   IRGK VS+AL  L FS K+ A  V+K L SA+ANAE+N   DVD L 
Sbjct: 12  RLSAQKARLVVDQIRGKSVSEALNILTFSPKKAAVIVKKVLESAIANAEHNEGADVDDLR 71

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           VS AYV +++ +KR   R + R  RI++    +TV V
Sbjct: 72  VSTAYVDEAMTLKRIMPRAKGRADRILKRGCHITVKV 108


>gi|210631087|ref|ZP_03296743.1| hypothetical protein COLSTE_00628 [Collinsella stercoris DSM 13279]
 gi|210160175|gb|EEA91146.1| hypothetical protein COLSTE_00628 [Collinsella stercoris DSM 13279]
          Length = 121

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 61/106 (57%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A A  +RVSP K  LV  +IRGK V+ A   L F  + +A +V K L SAVANAE+N
Sbjct: 10  EVRATAKYVRVSPGKARLVIDLIRGKNVAQAFDILHFCTRSVAVDVEKVLRSAVANAEHN 69

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           + +  D L V  AYV +   +KR   R +    RI++  S +TV+V
Sbjct: 70  NQMRADDLFVKAAYVDEGPTLKRIRPRAKGSASRILKRTSHITVVV 115


>gi|126680609|gb|ABO26531.1| ribosomal protein L22 [Acholeplasma palmae]
          Length = 111

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/108 (41%), Positives = 67/108 (62%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AIA  +R++P+K  LV  +IRG+ + +A A L F+ +  +  + K L SAVANA +N
Sbjct: 2   EAKAIAKTVRIAPRKARLVIDLIRGQNIKEAQAILMFTPRAASPIILKVLNSAVANASHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            +LD  +L V EAYVG+ V +KR   R + +   I +  S +TV+V E
Sbjct: 62  LNLDETKLYVKEAYVGEGVRLKRLLPRAKGQGDIIQKRTSHITVVVAE 109


>gi|319760334|ref|YP_004124272.1| 50S ribosomal protein L22 [Candidatus Blochmannia vafer str. BVAF]
 gi|318039048|gb|ADV33598.1| 50S ribosomal protein L22 [Candidatus Blochmannia vafer str. BVAF]
          Length = 111

 Score = 75.5 bits (184), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 46/108 (42%), Positives = 66/108 (61%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E+ A    +R S QK+ LV  MIRGK VS AL  L ++ K+ A  V+KTL SA+ANAE+N
Sbjct: 2   ESMAKYRYIRSSAQKVRLVVNMIRGKYVSRALDILNYTNKKSAYVVKKTLESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
             +++D L + + +V     +KR   R + R  RI++  S LTV+V E
Sbjct: 62  DGMNIDNLKIIKIFVDNGPSIKRIMPRAKGRSDRILKRTSHLTVVVSE 109


>gi|83748154|ref|ZP_00945181.1| LSU ribosomal protein L22P [Ralstonia solanacearum UW551]
 gi|207721893|ref|YP_002252331.1| 50s ribosomal protein l22 [Ralstonia solanacearum MolK2]
 gi|207723100|ref|YP_002253505.1| 50s ribosomal protein l22 [Ralstonia solanacearum IPO1609]
 gi|300690165|ref|YP_003751160.1| 50S ribosomal subunit protein L22 [Ralstonia solanacearum PSI07]
 gi|83725122|gb|EAP72273.1| LSU ribosomal protein L22P [Ralstonia solanacearum UW551]
 gi|206587061|emb|CAQ17645.1| 50s ribosomal protein l22 [Ralstonia solanacearum MolK2]
 gi|206588293|emb|CAQ18991.1| 50s ribosomal protein l22 [Ralstonia solanacearum IPO1609]
 gi|299077225|emb|CBJ49851.1| 50S ribosomal subunit protein L22 [Ralstonia solanacearum PSI07]
          Length = 109

 Score = 75.5 bits (184), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 60/106 (56%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  AI    R+S QK  LVA  IRG  +  AL  L FS K+ AG V+K + SA+ANAE+N
Sbjct: 2   EVKAIHRGARISAQKTRLVADQIRGLPIERALNVLTFSPKKAAGIVKKVVESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L V   Y+ K+  +KRF  R + R  RI +    +TV +
Sbjct: 62  EGADIDELKVKSIYIDKATSLKRFTARAKGRGNRIEKQTCHITVTL 107


>gi|291542040|emb|CBL15150.1| LSU ribosomal protein L22P [Ruminococcus bromii L2-63]
          Length = 113

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 42/112 (37%), Positives = 68/112 (60%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A  +R+SP+K+N+V  ++RGK V  A A L+ + K     + K L SA+ANAENN
Sbjct: 2   EAKANAKFVRISPRKVNVVLDLVRGKDVKYAEAVLKHTPKAACEPLLKLLNSAMANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           HD+DV +L +++        +KR   R + R  RI +  S ++++++E  D+
Sbjct: 62  HDMDVSKLYIAQCNATAGPILKRIRPRAQGRAFRINKRTSHISLVLKEREDD 113


>gi|119773359|ref|YP_926099.1| 50S ribosomal protein L22 [Shewanella amazonensis SB2B]
 gi|166221992|sp|A1S223|RL22_SHEAM RecName: Full=50S ribosomal protein L22
 gi|119765859|gb|ABL98429.1| LSU ribosomal protein L22P [Shewanella amazonensis SB2B]
          Length = 110

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 61/99 (61%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R SPQK  LVA  IRG  V+ AL  L FS K+ A  V+K + SA+ANAE+N   D+D L 
Sbjct: 11  RTSPQKARLVADQIRGLPVAKALEILTFSPKKAAVLVKKVVDSAIANAEHNEGADIDDLK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           +++ +V +   MKR   R + R  RI++  S +TV+V +
Sbjct: 71  IAKVFVDEGPTMKRIMPRAKGRADRIIKRTSHITVVVSD 109


>gi|149072014|ref|YP_001293585.1| ribosomal protein L22 [Rhodomonas salina]
 gi|215274767|sp|A6MW06|RK22_RHDSA RecName: Full=50S ribosomal protein L22, chloroplastic
 gi|134302965|gb|ABO70769.1| ribosomal protein L22 [Rhodomonas salina]
          Length = 118

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 44/111 (39%), Positives = 62/111 (55%)

Query: 14  DNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAE 73
             EA AIA  +R+SP K+  V   IRG+   +AL  LEF        V + L SA ANA+
Sbjct: 7   QTEARAIAKYIRMSPFKVRRVLKQIRGRSYKEALMILEFMPYAACKPVLQLLQSAAANAQ 66

Query: 74  NNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV 124
           NN+ L  D++IV+ AY      +KRF  R + R  +I +P   +TV ++EV
Sbjct: 67  NNYGLQKDQMIVNYAYADPGPVLKRFRPRAQGRGFKIKKPTCHITVSLKEV 117


>gi|294789228|ref|ZP_06754467.1| ribosomal protein L22 [Simonsiella muelleri ATCC 29453]
 gi|294482969|gb|EFG30657.1| ribosomal protein L22 [Simonsiella muelleri ATCC 29453]
          Length = 109

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 59/97 (60%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R+S QK  LVA MIRGK V+ AL  L FS K+ A  ++K L SA+ANAE+N+  D+D L 
Sbjct: 11  RISAQKARLVADMIRGKDVAQALNILAFSPKKGAELIKKVLESAIANAEHNNGADIDELK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           V   +V K   +KRF  R + R  RI +    + V+V
Sbjct: 71  VVTIFVDKGPSLKRFQARAKGRGNRIEKQTCHINVVV 107


>gi|126680600|gb|ABO26525.1| ribosomal protein L22 [Picris echioides phyllody phytoplasma]
          Length = 128

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 46/122 (37%), Positives = 72/122 (59%), Gaps = 2/122 (1%)

Query: 12  MGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVAN 71
           M +N+  AIA  + ++P+K+ LV  +IR K + +A A L+F+ K  +  V K L SAV+N
Sbjct: 1   MINNDVKAIAKRVPIAPRKIRLVIDLIRYKSIEEAQAILDFTNKASSVVVSKLLKSAVSN 60

Query: 72  AENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV--REVSDEGK 129
           A NN + D++ L V E +V + V MKR   R + R  +I +  S +T+ V  + V  E K
Sbjct: 61  AVNNFNFDINNLYVKEIFVNQGVRMKRLLPRAKGRSNQIQKNTSHITIFVSSKSVESERK 120

Query: 130 VV 131
           V+
Sbjct: 121 VI 122


>gi|89095532|ref|ZP_01168437.1| Ribosomal protein L22 [Oceanospirillum sp. MED92]
 gi|89080207|gb|EAR59474.1| Ribosomal protein L22 [Oceanospirillum sp. MED92]
          Length = 109

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 60/97 (61%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R+S QK  LVA  IRGK V +AL  L FS K+ A  V+K L SA+ANAE+N   D+D L 
Sbjct: 11  RISAQKARLVADQIRGKSVGEALDILAFSPKKGAALVKKVLESAIANAEHNEGADIDELR 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           VS  +V +++ MKR   R + R  RI++    +TV V
Sbjct: 71  VSTVFVDEAMTMKRIKPRAKGRADRILKRSCHITVKV 107


>gi|289824755|ref|ZP_06544220.1| 50S ribosomal protein L22 [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
          Length = 106

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 62/96 (64%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R S QK+ LVA +IRGK+VS AL  L ++ K+ A  V+K L SA+ANAE+N   D+D L 
Sbjct: 11  RSSAQKVRLVADLIRGKKVSQALDILTYTNKKAAVLVKKVLESAIANAEHNDGADIDDLK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVI 120
           V++ +V +   MKR   R + R  RI++  S +TV+
Sbjct: 71  VTKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVV 106


>gi|262203619|ref|YP_003274827.1| 50S ribosomal protein L22 [Gordonia bronchialis DSM 43247]
 gi|262086966|gb|ACY22934.1| ribosomal protein L22 [Gordonia bronchialis DSM 43247]
          Length = 136

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 45/116 (38%), Positives = 66/116 (56%), Gaps = 1/116 (0%)

Query: 14  DN-EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANA 72
           DN +A A A  +RV+P K   V  +IRGK   +AL  L F+ +  +  V K L SA+ANA
Sbjct: 6   DNPQAKATAKFVRVTPMKARRVLDLIRGKNADEALDILRFAPQSASEPVYKVLASAIANA 65

Query: 73  ENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           ENN  LD   L+V+ A+  +   +KRF  R + R  RI +  S +TV+V  + ++ 
Sbjct: 66  ENNDGLDRRTLVVATAFADEGPTLKRFQPRAQGRAFRIRKRTSHITVVVESLPEKA 121


>gi|210623193|ref|ZP_03293632.1| hypothetical protein CLOHIR_01582 [Clostridium hiranonis DSM 13275]
 gi|210153730|gb|EEA84736.1| hypothetical protein CLOHIR_01582 [Clostridium hiranonis DSM 13275]
          Length = 110

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 64/108 (59%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A  +RVS +K   +  ++RGK V +ALA L+F+ +  A  + K + SA ANAENN
Sbjct: 2   EAKATAKYVRVSARKAGQICDLVRGKNVDEALAILKFTPREAASIIAKVVASAKANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           H++D D+L ++     +   MKR+  R + R   I +  S + V+++E
Sbjct: 62  HEMDTDKLYIASIVANQGPTMKRYMPRAQGRACEIRKRTSHIEVVLKE 109


>gi|260881642|ref|ZP_05404917.2| ribosomal protein L22 [Mitsuokella multacida DSM 20544]
 gi|260848060|gb|EEX68067.1| ribosomal protein L22 [Mitsuokella multacida DSM 20544]
          Length = 91

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 40/87 (45%), Positives = 57/87 (65%)

Query: 37  MIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFM 96
           +IRGK V++A A L+F+ K  A  V K L SAVANAENN D+DVD+L V  A+  +   +
Sbjct: 3   LIRGKNVAEAFAILKFTPKAGAEVVEKVLRSAVANAENNFDMDVDKLYVKTAFADQGPTL 62

Query: 97  KRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           KR H R R +  +I++  S +T++V E
Sbjct: 63  KRIHPRSRGQAFKILKRTSHVTIVVDE 89


>gi|332107871|gb|EGJ09095.1| 50S ribosomal protein L22 [Rubrivivax benzoatilyticus JA2]
          Length = 109

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 44/106 (41%), Positives = 61/106 (57%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  AI   +R+S  K  LVA MIRGK+V  A+  L F+ K+ A  ++K + SAVANAE+N
Sbjct: 2   ETKAIVRGVRLSADKGRLVADMIRGKKVDQAINILTFTPKKAAVIIKKAVESAVANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L +   YV +   +KRF  R + R  RI +P   + V V
Sbjct: 62  DGADIDELKIKSIYVEQGATLKRFSARAKGRGNRISKPTCHIFVTV 107


>gi|39997944|ref|NP_953895.1| 50S ribosomal protein L22 [Geobacter sulfurreducens PCA]
 gi|51316297|sp|Q748Z3|RL22_GEOSL RecName: Full=50S ribosomal protein L22
 gi|39984889|gb|AAR36245.1| ribosomal protein L22 [Geobacter sulfurreducens PCA]
 gi|298506883|gb|ADI85606.1| ribosomal protein L22 [Geobacter sulfurreducens KN400]
          Length = 111

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 60/106 (56%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA+A  +  R+SP+K  LV  M+RGK + DAL  L FS +  A  V K L SAVANAE  
Sbjct: 2   EASAKLTFARLSPRKTRLVVDMVRGKGIQDALTILRFSPQASAKLVSKLLRSAVANAEQK 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              DVDRL V    V     +KRF  R   R  +I +P S +TV++
Sbjct: 62  GASDVDRLYVKSISVDGGPVLKRFVPRAMGRASKIRKPTSHITVVL 107


>gi|121603125|ref|YP_980454.1| 50S ribosomal protein L22 [Polaromonas naphthalenivorans CJ2]
 gi|166221981|sp|A1VIQ5|RL22_POLNA RecName: Full=50S ribosomal protein L22
 gi|120592094|gb|ABM35533.1| LSU ribosomal protein L22P [Polaromonas naphthalenivorans CJ2]
          Length = 109

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 43/106 (40%), Positives = 62/106 (58%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A    +R+S  K  LVA +IRGK+V  AL  L F++K+ AG ++K + SA+ANAE+N
Sbjct: 2   ETRATLRGVRLSVDKGRLVADLIRGKKVDQALNILNFTQKKAAGIIKKVVESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L V   YV +   +KRF  R + R   I +P   + V+V
Sbjct: 62  DGADIDELRVKTIYVEQGATLKRFSARAKGRGNSISKPTCHVYVVV 107


>gi|329118603|ref|ZP_08247307.1| 50S ribosomal protein L22 [Neisseria bacilliformis ATCC BAA-1200]
 gi|327465338|gb|EGF11619.1| 50S ribosomal protein L22 [Neisseria bacilliformis ATCC BAA-1200]
          Length = 109

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 57/97 (58%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R+S QK  LV   IRGK V+ AL  L FS K+ A  V+K L SAVANAE+N  +D+D L 
Sbjct: 11  RISAQKARLVVDQIRGKDVAQALNILAFSTKKGAELVKKVLESAVANAEHNEGVDIDELK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           V   YV K+  +KRF  R + R  RI +    + V V
Sbjct: 71  VVTVYVDKASSLKRFQARAKGRGNRIEKQTCHINVTV 107


>gi|332139853|ref|YP_004425591.1| 50S ribosomal protein L22 [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|332139866|ref|YP_004425604.1| 50S ribosomal protein L22 [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|226733424|sp|B4S096|RL22_ALTMD RecName: Full=50S ribosomal protein L22
 gi|327549875|gb|AEA96593.1| 50S ribosomal protein L22 [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327549888|gb|AEA96606.1| 50S ribosomal protein L22 [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 110

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 61/106 (57%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A     R S QK  LVA  IRG  V  AL  L +S K+ A  V+K L SA+ANAE+N
Sbjct: 2   EALAKHRFARTSAQKARLVADQIRGLHVEKALEVLAYSPKKSAALVKKVLESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L+V++ +V +   MKR   R + R  RI +  S +TV+V
Sbjct: 62  EGADIDELVVAKVFVDEGPTMKRIKPRAKGRADRIFKRSSHITVVV 107


>gi|83319685|ref|YP_424655.1| 50S ribosomal protein L22 [Mycoplasma capricolum subsp. capricolum
           ATCC 27343]
 gi|313665572|ref|YP_004047443.1| ribosomal protein L22 [Mycoplasma leachii PG50]
 gi|331703711|ref|YP_004400398.1| 50S ribosomal protein L22 [Mycoplasma mycoides subsp. capri LC str.
           95010]
 gi|132789|sp|P10139|RL22_MYCCT RecName: Full=50S ribosomal protein L22
 gi|44214|emb|CAA29709.1| unnamed protein product [Mycoplasma capricolum subsp. capricolum
           ATCC 27343]
 gi|83283571|gb|ABC01503.1| ribosomal protein L22 [Mycoplasma capricolum subsp. capricolum ATCC
           27343]
 gi|256383841|gb|ACU78411.1| ribosomal protein L22 [Mycoplasma mycoides subsp. capri str. GM12]
 gi|256384672|gb|ACU79241.1| ribosomal protein L22 [Mycoplasma mycoides subsp. capri str. GM12]
 gi|296455507|gb|ADH21742.1| ribosomal protein L22 [synthetic Mycoplasma mycoides JCVI-syn1.0]
 gi|312949940|gb|ADR24536.1| ribosomal protein L22 [Mycoplasma leachii PG50]
 gi|328802266|emb|CBW54420.1| 50S ribosomal protein L22 [Mycoplasma mycoides subsp. capri LC str.
           95010]
          Length = 111

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 49/112 (43%), Positives = 65/112 (58%), Gaps = 3/112 (2%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A  SM+R+SP+K+ LVA  IR K VS A+A L+   K  A  + K L SAVANA NN
Sbjct: 2   EAKAKLSMIRISPRKMRLVADTIRNKAVSVAVATLKNLNKDAAEPILKLLNSAVANAVNN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           + ++ D+L V   +V +   +KRF  R     GR    F R + +V  VSDE
Sbjct: 62  NGMEADKLYVKTIFVNEGPTLKRFRPRAH---GRAYEIFKRTSHVVIVVSDE 110


>gi|298491403|ref|YP_003721580.1| 50S ribosomal protein L22 ['Nostoc azollae' 0708]
 gi|298233321|gb|ADI64457.1| ribosomal protein L22 ['Nostoc azollae' 0708]
          Length = 119

 Score = 74.7 bits (182), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 59/107 (55%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
            E  AIA  +R+SP K+  V   IRG+   +AL  LEF   R    V K L SA ANAE+
Sbjct: 6   TEVQAIARYIRISPYKVRRVLDQIRGRSYREALIILEFMPYRACEPVLKVLRSAAANAEH 65

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           N  LD   L++++AY  +   +KRF  R + R  +I +P   +TV V
Sbjct: 66  NEGLDRSELVITQAYADQGPVLKRFQPRAQGRAYQIRKPTCHITVAV 112


>gi|119511174|ref|ZP_01630291.1| 50S ribosomal protein L22 [Nodularia spumigena CCY9414]
 gi|119464162|gb|EAW45082.1| 50S ribosomal protein L22 [Nodularia spumigena CCY9414]
          Length = 118

 Score = 74.7 bits (182), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 44/113 (38%), Positives = 62/113 (54%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
            E  AIA  +R+SP K+  V   IRG+   +AL  LEF   R    V K L SA ANAE+
Sbjct: 6   TEVKAIARYIRISPYKVRRVLDQIRGRSYREALIILEFMPYRACEPVLKLLRSAAANAEH 65

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           N  LD   L++++AY  +   +KRF  R + R  +I +P   +TV V + + E
Sbjct: 66  NAGLDRTNLVITQAYANQGPVLKRFQPRAQGRAYQIRKPTCHITVAVADATAE 118


>gi|164660919|ref|XP_001731582.1| hypothetical protein MGL_0850 [Malassezia globosa CBS 7966]
 gi|159105483|gb|EDP44368.1| hypothetical protein MGL_0850 [Malassezia globosa CBS 7966]
          Length = 287

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 73/127 (57%), Gaps = 9/127 (7%)

Query: 4   KRSVSKRRMGDNEANAI--------ASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRK 55
           KR + KR  G  E             ++ R+SP+KLN++A  I GK +  A+  ++FS K
Sbjct: 116 KRLLRKRWGGTTELGGPEKLEHKYSTAVFRISPRKLNMLAHQISGKPIDFAILQMQFSAK 175

Query: 56  RIAGEVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFS 115
           R A  VR TL  A  +AE    +D  RLIVSEA+V K ++MKR   +GR R G +  P +
Sbjct: 176 RAARRVRATLALARDHAEAK-GMDPRRLIVSEAWVTKGLYMKRLEIKGRGRFGILEHPQA 234

Query: 116 RLTVIVR 122
           RL++I+R
Sbjct: 235 RLSIILR 241


>gi|294790416|ref|ZP_06755574.1| ribosomal protein L22 [Scardovia inopinata F0304]
 gi|294458313|gb|EFG26666.1| ribosomal protein L22 [Scardovia inopinata F0304]
          Length = 119

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 67/111 (60%), Gaps = 5/111 (4%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AIA  +RV+P+K   +  +IRGK+ ++A+  L+F+ +  A  VRK L SAVANA   
Sbjct: 2   EAKAIARHVRVTPRKARRMVNLIRGKKATEAITILKFAPQDAAVPVRKVLESAVANARVL 61

Query: 76  HDLDV-----DRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
            D D      + L+V E YV + V +KRF  R + R GRI +  S +TV+V
Sbjct: 62  ADKDSVPFRENELVVKETYVDEGVTLKRFRARAQGRAGRINKRTSHITVVV 112


>gi|300718700|ref|YP_003743503.1| 50S ribosomal protein L22 [Erwinia billingiae Eb661]
 gi|299064536|emb|CAX61656.1| 50S ribosomal protein L22 [Erwinia billingiae Eb661]
          Length = 110

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 63/99 (63%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R S QK+ LVA ++RGK VS AL  L ++ K+ A  V+K L SA+ANAE+N   D+D L 
Sbjct: 11  RSSAQKVRLVADLVRGKNVSQALDILTYTNKKAAVLVKKVLESAIANAEHNDGADIDDLK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           V++ +V +   MKR   R + R  RI++  S +TV+V +
Sbjct: 71  VTKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSD 109


>gi|86605861|ref|YP_474624.1| 50S ribosomal protein L22 [Synechococcus sp. JA-3-3Ab]
 gi|109893245|sp|Q2JV86|RL22_SYNJA RecName: Full=50S ribosomal protein L22
 gi|86554403|gb|ABC99361.1| ribosomal protein L22 [Synechococcus sp. JA-3-3Ab]
          Length = 123

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 65/119 (54%), Gaps = 2/119 (1%)

Query: 12  MGDN--EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           M D   E  A+A  +R+SP K+  V   IRG+  +DAL  LEF        VRK L SAV
Sbjct: 1   MADPSPEIKAVARYIRMSPYKVRRVLNQIRGRTYADALILLEFMPYAACEPVRKVLRSAV 60

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           ANAE+N+ LD   L++S+AY  +   +KRF  R + R   I +    +T+ VR +  E 
Sbjct: 61  ANAEHNNGLDPRDLVISKAYADQGPTLKRFRPRAQGRAYPIRKRTCHITIAVRPIEPEA 119


>gi|51316662|sp|Q6XYY1|RL22_SPIKU RecName: Full=50S ribosomal protein L22
 gi|34849398|gb|AAP58897.1| ribosomal protein L22 [Spiroplasma kunkelii CR2-3x]
 gi|110004234|emb|CAK98572.1| 50s ribosomal protein l22 [Spiroplasma citri]
          Length = 112

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 62/100 (62%)

Query: 24  LRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRL 83
           +R+SP+K+ LV  +IR K+V DA+  L  + K+ +  V+K + SAVANA NN+ LD DRL
Sbjct: 10  IRISPRKVRLVTDLIRNKKVGDAIVILNNTNKKSSVPVQKLVKSAVANAVNNNGLDADRL 69

Query: 84  IVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            + E +V +   +KRF  R   R   I++  S +TV V +
Sbjct: 70  FIKEIFVNEGPTLKRFRPRAHGRAYEILKRTSHITVTVSD 109


>gi|90994499|ref|YP_536989.1| ribosomal protein L22 [Porphyra yezoensis]
 gi|109893079|sp|Q1XDH9|RK22_PORYE RecName: Full=50S ribosomal protein L22, chloroplastic
 gi|90819063|dbj|BAE92432.1| 50S ribosomal protein L22 [Porphyra yezoensis]
 gi|116266164|gb|ABJ91320.1| 50S ribosomal protein L22 [Porphyra yezoensis]
          Length = 117

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 63/109 (57%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A+   +R+SP K+  V   IRG++  +AL  LEF   R+   +++ L SA ANAE+N
Sbjct: 9   ETKAVGKYIRLSPHKVRRVLDQIRGRKYQEALIILEFMPYRVCSHIKQILESAAANAEHN 68

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV 124
             L+ ++L VS+A+  K   +KRF  R + R   I +P   +T+ V E+
Sbjct: 69  DGLNKNQLFVSKAFADKGPTLKRFQPRAQGRAFPIHKPTCHITLGVSEL 117


>gi|225629639|ref|ZP_03787637.1| ribosomal protein L22 [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
 gi|225591506|gb|EEH12548.1| ribosomal protein L22 [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
          Length = 116

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 67/103 (65%), Gaps = 2/103 (1%)

Query: 23  MLRVSPQKLNLVAAMIRGKRVSDA-LADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVD 81
           +L+ +P+KLNLVA ++R K+VS A +    F  K+ AG +RK L SA+ANA+ N+ LD+D
Sbjct: 14  VLKSTPRKLNLVAGLVRNKKVSFATVXXXRFCEKKAAGLIRKVLNSAIANAQ-NYGLDID 72

Query: 82  RLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV 124
            L + E  +GKS+ ++R   +   R  R+ + +S +TV + E+
Sbjct: 73  NLYIKEILIGKSLTLRRVCPKAMGRANRVSKRYSNITVKLGEI 115


>gi|295398293|ref|ZP_06808335.1| 50S ribosomal protein L22 [Aerococcus viridans ATCC 11563]
 gi|294973432|gb|EFG49217.1| 50S ribosomal protein L22 [Aerococcus viridans ATCC 11563]
          Length = 118

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 66/110 (60%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A A+ +RVS +K  LV  +IR K V +A+A L+ + +  +  V K L SA+ANAE+N 
Sbjct: 8   AKATANTVRVSARKARLVVDLIRNKTVGEAIAILKNTPRSASPAVEKVLMSAIANAEHNF 67

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
            L+   L+VSEA+V +   MKRF  R +    RI +  S +TV+V+   +
Sbjct: 68  GLEPANLVVSEAFVNEGPTMKRFRPRAKGSASRINKRTSHITVVVKTAEE 117


>gi|146297280|ref|YP_001181051.1| ribosomal protein L22 [Caldicellulosiruptor saccharolyticus DSM
           8903]
 gi|215274812|sp|A4XLS5|RL22_CALS8 RecName: Full=50S ribosomal protein L22
 gi|145410856|gb|ABP67860.1| LSU ribosomal protein L22P [Caldicellulosiruptor saccharolyticus
           DSM 8903]
          Length = 122

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 62/98 (63%)

Query: 26  VSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLIV 85
           +SP+K+ +V  +IR K V +AL  L+F  KR A  V K L SA+ANAENNH+++VD+L +
Sbjct: 23  ISPRKVRIVIDLIRNKPVQEALNILKFIPKRGARFVEKLLKSAIANAENNHNMNVDKLYI 82

Query: 86  SEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           +E Y      +KR   R + R   I +  S +TV+++E
Sbjct: 83  AEIYANGGPMLKRIRPRAQGRAFLIRKRTSHITVVLKE 120


>gi|126680597|gb|ABO26523.1| ribosomal protein L22 [Italian alfalfa witches'-broom phytoplasma]
          Length = 128

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 66/110 (60%)

Query: 12  MGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVAN 71
           M +N+  AIA+ + ++P+K+ LV  +IR K + +A A LEF+RK  +  V K L SAVAN
Sbjct: 1   MINNDVKAIANRVPIAPRKIRLVIDLIRDKSIEEAQAILEFTRKASSIVVAKLLKSAVAN 60

Query: 72  AENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           A NN   D+  L V + +V + V MKR   R + R  +I +  S +T+ V
Sbjct: 61  AVNNFKFDIHNLYVKKIFVNQGVRMKRLLPRAKGRSNQIQKNTSHITIFV 110


>gi|330470168|ref|YP_004407911.1| 50S ribosomal protein L22 [Verrucosispora maris AB-18-032]
 gi|328813139|gb|AEB47311.1| 50S ribosomal protein L22 [Verrucosispora maris AB-18-032]
          Length = 132

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 39/87 (44%), Positives = 54/87 (62%)

Query: 24  LRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRL 83
           +R+SP K   V  ++RG    +AL  L+F+ +  + +V K L SA+ANAENN  LD D L
Sbjct: 1   MRISPMKARRVVNLVRGLPAKEALTVLQFAPQAASEQVYKVLASAIANAENNERLDPDAL 60

Query: 84  IVSEAYVGKSVFMKRFHCRGRQRIGRI 110
           +VSEA+V +   MKRF  R + R  RI
Sbjct: 61  LVSEAFVDEGPTMKRFQPRAQGRAYRI 87


>gi|148652243|ref|YP_001279336.1| 50S ribosomal protein L22 [Psychrobacter sp. PRwf-1]
 gi|172048476|sp|A5WCJ5|RL22_PSYWF RecName: Full=50S ribosomal protein L22
 gi|148571327|gb|ABQ93386.1| LSU ribosomal protein L22P [Psychrobacter sp. PRwf-1]
          Length = 109

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 45/98 (45%), Positives = 60/98 (61%)

Query: 26  VSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLIV 85
           +S QK+ LVA  +RGK +  AL  L FS K+ A  V+K L SA+ANAE+NH LD+D L V
Sbjct: 12  ISAQKVRLVADEVRGKSIERALDILAFSNKKGAVFVKKCLESAIANAEHNHGLDIDTLKV 71

Query: 86  SEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           S  YV + + +KR   R + R  RI +    +TV V E
Sbjct: 72  STIYVDEGITLKRILPRAKGRADRISKRTCHITVKVGE 109


>gi|109896803|ref|YP_660058.1| 50S ribosomal protein L22 [Pseudoalteromonas atlantica T6c]
 gi|123171762|sp|Q15YN4|RL22_PSEA6 RecName: Full=50S ribosomal protein L22
 gi|109699084|gb|ABG39004.1| LSU ribosomal protein L22P [Pseudoalteromonas atlantica T6c]
          Length = 110

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 60/106 (56%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A     R S QK  LVA  IRG  V  AL  L +S K+ A  ++K L SA+ANAE+N
Sbjct: 2   EALATHRHARTSAQKARLVADQIRGLHVEKALELLAYSPKKSADLIKKVLESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L VS+ +V +   MKR   R + R  RI +  S +TV+V
Sbjct: 62  EGADIDELTVSKVFVDEGPTMKRIKPRAKGRADRIFKRSSHITVVV 107


>gi|295106946|emb|CBL04489.1| LSU ribosomal protein L22P [Gordonibacter pamelaeae 7-10-1-b]
          Length = 113

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 44/106 (41%), Positives = 63/106 (59%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  +RVSP+K  +V  ++RGK V  A   L F+ + +A  V KTL SAVANAE+ 
Sbjct: 2   EAKAVARYVRVSPRKARIVVDLVRGKSVIQAREILAFTNRGVAEAVEKTLNSAVANAEHQ 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           H +  + LIV  A+V +   +KR   R +    RI +  S +T+IV
Sbjct: 62  HHVRPESLIVKTAFVDEGPTLKRIRPRAKGSASRIRKRTSHITIIV 107


>gi|209528354|ref|ZP_03276805.1| ribosomal protein L22 [Arthrospira maxima CS-328]
 gi|209491207|gb|EDZ91611.1| ribosomal protein L22 [Arthrospira maxima CS-328]
          Length = 116

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 61/111 (54%)

Query: 13  GDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANA 72
            ++E  AIA  +R+SP K+  V   IRG+   +AL  LEF   R    V K L SAVANA
Sbjct: 4   SNSEVKAIARYIRMSPSKVRRVLDQIRGRSYREALIILEFMPYRACTPVLKVLRSAVANA 63

Query: 73  ENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           E+N  LD   LIVS+A+      +KR+  R + R   I +P   +TV V E
Sbjct: 64  EHNQGLDPATLIVSQAFADAGPSLKRYRPRAQGRAYPIRKPTCHITVTVAE 114


>gi|294651629|ref|ZP_06728933.1| 50S ribosomal protein L22 [Acinetobacter haemolyticus ATCC 19194]
 gi|292822478|gb|EFF81377.1| 50S ribosomal protein L22 [Acinetobacter haemolyticus ATCC 19194]
          Length = 110

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 60/96 (62%)

Query: 26  VSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLIV 85
           +S QK  LVA +IRGK V+ AL  L FS K+ A  V+K L SA+ANAE+N+ LDVD L V
Sbjct: 13  ISAQKARLVADLIRGKSVARALDILNFSNKKAAVLVKKALESAIANAEHNNSLDVDDLKV 72

Query: 86  SEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           +  YV + + +KR   R + R  RI +    +TV V
Sbjct: 73  TTIYVDEGMSLKRIMPRAKGRADRITKRTCHITVKV 108


>gi|226953876|ref|ZP_03824340.1| 50S ribosomal protein L22 [Acinetobacter sp. ATCC 27244]
 gi|226835359|gb|EEH67742.1| 50S ribosomal protein L22 [Acinetobacter sp. ATCC 27244]
          Length = 109

 Score = 74.3 bits (181), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 60/96 (62%)

Query: 26  VSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLIV 85
           +S QK  LVA +IRGK V+ AL  L FS K+ A  V+K L SA+ANAE+N+ LDVD L V
Sbjct: 12  ISAQKARLVADLIRGKSVARALDILNFSNKKAAVLVKKALESAIANAEHNNSLDVDDLKV 71

Query: 86  SEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           +  YV + + +KR   R + R  RI +    +TV V
Sbjct: 72  TTIYVDEGMSLKRIMPRAKGRADRITKRTCHITVKV 107


>gi|119478127|ref|ZP_01618206.1| 50S ribosomal protein L22 [marine gamma proteobacterium HTCC2143]
 gi|119448833|gb|EAW30076.1| 50S ribosomal protein L22 [marine gamma proteobacterium HTCC2143]
          Length = 112

 Score = 74.3 bits (181), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 65/111 (58%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E +A  +  ++S QK+ LVA  +RGK V  AL  LEFS K+ A  V+K L SA+ANAE+N
Sbjct: 2   EVSAKLTGAQISAQKVRLVADQVRGKEVEVALDILEFSNKKAADIVKKILNSAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
              DVD L +S  +V +   +KR   R + R  RI++    +TV V +  D
Sbjct: 62  EGADVDELKISTIFVDEGRVLKRLRPRAKGRADRILKRSCHITVKVSDSED 112


>gi|229821618|ref|YP_002883144.1| ribosomal protein L22 [Beutenbergia cavernae DSM 12333]
 gi|259646237|sp|C5C0I6|RL22_BEUC1 RecName: Full=50S ribosomal protein L22
 gi|229567531|gb|ACQ81382.1| ribosomal protein L22 [Beutenbergia cavernae DSM 12333]
          Length = 121

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 48/118 (40%), Positives = 67/118 (56%), Gaps = 5/118 (4%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A  +RV+PQK   V   IRGK  ++A+A L F+ +  A  VRK + SAVANA   
Sbjct: 2   EAKAQARFVRVTPQKARRVVDTIRGKGAAEAVAVLSFAPQAAAETVRKVVESAVANARVK 61

Query: 76  HD-----LDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
            D      D   L+++EAYV +   +KRF  R + R  ++++  S +TVIV E   EG
Sbjct: 62  ADTASVRFDPADLVIAEAYVDEGPTLKRFRPRAQGRANQVLKRTSHITVIVAERQKEG 119


>gi|158317786|ref|YP_001510294.1| 50S ribosomal protein L22 [Frankia sp. EAN1pec]
 gi|215274862|sp|A8LC51|RL22_FRASN RecName: Full=50S ribosomal protein L22
 gi|158113191|gb|ABW15388.1| ribosomal protein L22 [Frankia sp. EAN1pec]
          Length = 140

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 44/111 (39%), Positives = 62/111 (55%)

Query: 11  RMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVA 70
           R G   A A A  +  SP K   V  ++RG+  S+AL  L F+ +  + +V K + SAVA
Sbjct: 11  RAGLPGAKATARYVHTSPTKARRVVDLVRGRSASEALDILRFAPQAASTDVYKVVASAVA 70

Query: 71  NAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           NAENNH+LD   L +  AYV +   +KR   R + R  RI +  S +TV+V
Sbjct: 71  NAENNHNLDPATLWIGAAYVDEGPTLKRIRPRAQGRAYRIRKRTSHITVVV 121


>gi|296130490|ref|YP_003637740.1| ribosomal protein L22 [Cellulomonas flavigena DSM 20109]
 gi|296022305|gb|ADG75541.1| ribosomal protein L22 [Cellulomonas flavigena DSM 20109]
          Length = 122

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 71/119 (59%), Gaps = 5/119 (4%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANA--- 72
           EA A A  +RV+PQK   V  +IRGK+ ++A+A L+F+ +  A  V KT+ SAVANA   
Sbjct: 2   EAKAKARFVRVTPQKARRVVDLIRGKQAAEAVAVLKFAPQAAAEPVLKTVQSAVANAVEG 61

Query: 73  --ENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEGK 129
              N+  LD   L +SE +V +   +KRF  R + R  +I++  S +TV+V E   +G+
Sbjct: 62  AKRNSERLDEADLFISEVFVDEGPTLKRFRPRAQGRASQILKRTSHITVVVAERETKGR 120


>gi|268609588|ref|ZP_06143315.1| ribosomal protein L22 [Ruminococcus flavefaciens FD-1]
          Length = 111

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 61/99 (61%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R+SP+K+ +V  +IR K V  ALA L+ + K  +  V K + SA ANAENN  +D D L+
Sbjct: 11  RISPRKVQIVLDLIRNKPVDIALATLDLTPKAASPIVSKLVKSAQANAENNFSMDKDNLV 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           V+E +V     MKR   R + R  RI++  S +TV+++E
Sbjct: 71  VAECFVTPGPIMKRIMPRAQGRAYRILKRTSHITVVLKE 109


>gi|310941671|dbj|BAJ24189.1| 50S ribosomal protein L22 [Pseudomonas alcaligenes]
          Length = 110

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 62/106 (58%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A  S  R+S QK  LVA  IRGK+V +AL  L FS K+ A  ++K L SAVANAE+N
Sbjct: 2   EVAAKLSGARISAQKARLVADQIRGKKVGEALNLLAFSSKKAAEIIKKVLESAVANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              DVD L VS  +V +   +KR   R + R  RIV+    +TV V
Sbjct: 62  EGADVDDLKVSTVFVNEGRSLKRIMPRAKGRADRIVKRSCHITVKV 107


>gi|152980507|ref|YP_001355096.1| large subunit ribosomal protein L22 [Janthinobacterium sp.
           Marseille]
 gi|215274826|sp|A6T3J9|RL22_JANMA RecName: Full=50S ribosomal protein L22
 gi|151280584|gb|ABR88994.1| large subunit ribosomal protein L22 [Janthinobacterium sp.
           Marseille]
          Length = 110

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 61/106 (57%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A    +R+S QK  LVA  IRGK+V  AL  L+FS K+ A  +++ L SA+ANAE+N
Sbjct: 3   ETKATLRGVRLSAQKGRLVADQIRGKKVDQALNILQFSPKKGAAIIKRVLESAIANAEHN 62

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L V+  YV K   +KRF  R + R  RI +    + V V
Sbjct: 63  DGADIDELKVTTIYVEKGSVLKRFTARAKGRGDRISKQSCHIYVTV 108


>gi|85713140|ref|ZP_01044172.1| Ribosomal protein L22 [Idiomarina baltica OS145]
 gi|85693010|gb|EAQ30976.1| Ribosomal protein L22 [Idiomarina baltica OS145]
          Length = 110

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 61/108 (56%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A     RVS QK  LVA  IRG  V  AL  L +S K  AG V+K L SA+ANAE+N
Sbjct: 2   EAIAKHQFARVSAQKGRLVADQIRGLPVEKALDILAYSPKAAAGLVKKVLESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
              D+D L V+  +V +   MKR   R + R  RI +  S +TV+V +
Sbjct: 62  EGADIDELKVARVFVDEGPTMKRIKPRAKGRADRIFKRTSHITVVVSD 109


>gi|297569417|ref|YP_003690761.1| ribosomal protein L22 [Desulfurivibrio alkaliphilus AHT2]
 gi|296925332|gb|ADH86142.1| ribosomal protein L22 [Desulfurivibrio alkaliphilus AHT2]
          Length = 110

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 44/108 (40%), Positives = 61/108 (56%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+   +R+SPQK  LVA ++RG+ V  AL  L F  K+ A  +RK + SAVANA  N
Sbjct: 2   EAKALVRNIRISPQKARLVADLVRGREVGAALNTLRFMPKKGARILRKLIESAVANASQN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
              DVD L +   +V     +KR       R GRI++  S +TV++ E
Sbjct: 62  ETTDVDNLYIKSIHVDGGPMLKRIRPMAMGRAGRILKRTSHITVVLDE 109


>gi|254492316|ref|ZP_05105489.1| ribosomal protein L22 [Methylophaga thiooxidans DMS010]
 gi|224462488|gb|EEF78764.1| ribosomal protein L22 [Methylophaga thiooxydans DMS010]
          Length = 110

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 59/102 (57%)

Query: 22  SMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVD 81
           S  R+S QK+ LVA  IRG  V  A+  L FS K+ A  ++  L SA+ANAE+N   D+D
Sbjct: 8   SYARISAQKVRLVADQIRGLPVEKAINLLAFSPKKAADLMKDVLNSAIANAEHNDGADID 67

Query: 82  RLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            L+VS   V     MKR   R + R  RI++  S +TV+V E
Sbjct: 68  ELVVSAVMVDDGPTMKRMQARAKGRGNRILKRTSHITVVVDE 109


>gi|256827409|ref|YP_003151368.1| 50S ribosomal protein L22P [Cryptobacterium curtum DSM 15641]
 gi|256583552|gb|ACU94686.1| LSU ribosomal protein L22P [Cryptobacterium curtum DSM 15641]
          Length = 113

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 62/106 (58%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  +RVSP+K  +V   IRGK +  A   L F+ + IA +V K + SAVANAE+N
Sbjct: 2   EAKAVARYVRVSPRKARVVVDQIRGKDIVRAREVLAFTTRAIAEDVEKVMNSAVANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           H  +  +L V  AYV +   +KR   R +    RI +  S +TVIV
Sbjct: 62  HQANPAQLYVKAAYVDEGPTLKRIRPRAKGSAARIRKRTSHITVIV 107


>gi|167755917|ref|ZP_02428044.1| hypothetical protein CLORAM_01437 [Clostridium ramosum DSM 1402]
 gi|237733233|ref|ZP_04563714.1| 50S ribosomal protein L22 [Mollicutes bacterium D7]
 gi|167703909|gb|EDS18488.1| hypothetical protein CLORAM_01437 [Clostridium ramosum DSM 1402]
 gi|229383614|gb|EEO33705.1| 50S ribosomal protein L22 [Coprobacillus sp. D7]
          Length = 110

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 61/108 (56%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A M+RVSPQK  LV  ++RGK+V +AL  LE+  K     + K + SA  NA  N
Sbjct: 2   EARAQAKMIRVSPQKARLVVDLVRGKQVKEALGMLEYVNKSATPAIIKVVKSAAQNAVYN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
              + ++L + E YV +   +KRF  R +    RI++  S +T +V E
Sbjct: 62  EGAEAEKLYIKEIYVDEGPTLKRFAARAKGSGTRILKRTSHITCVVEE 109


>gi|240047264|ref|YP_002960652.1| 50S ribosomal protein L22 [Mycoplasma conjunctivae HRC/581]
 gi|239984836|emb|CAT04826.1| 50S ribosomal protein L22 [Mycoplasma conjunctivae]
          Length = 120

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 65/109 (59%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A A   M R+S QK  LVAA+I+ +  ++ALA L  + K+ A    K L SA+ANA NN
Sbjct: 7   KAQAHVKMQRISAQKARLVAALIKKQPTTNALAILHNTNKKAALLFIKLLNSAIANAVNN 66

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV 124
           H LD D+LIV +  V +   +KRF  R +    +I++  S L++ V +V
Sbjct: 67  HGLDGDKLIVEQVLVNEGPTLKRFQPRSKGVASQILKRTSHLSITVAQV 115


>gi|87122976|ref|ZP_01078837.1| ribosomal protein L22 [Marinomonas sp. MED121]
 gi|86161744|gb|EAQ63048.1| ribosomal protein L22 [Marinomonas sp. MED121]
          Length = 110

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 59/97 (60%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R+S QK  LVA  IRGK VS+AL  L FS K+ A  V+K L SAVANAE+N   D+D L 
Sbjct: 12  RLSAQKARLVADQIRGKSVSEALDILAFSPKKAAVLVKKVLESAVANAEHNEGADIDDLR 71

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           VS  YV ++   KR   R + R  RI++    +TV V
Sbjct: 72  VSTVYVDEATTYKRIMPRAKGRADRILKRGCHITVKV 108


>gi|222529725|ref|YP_002573607.1| 50S ribosomal protein L22 [Caldicellulosiruptor bescii DSM 6725]
 gi|302871503|ref|YP_003840139.1| ribosomal protein L22 [Caldicellulosiruptor obsidiansis OB47]
 gi|312127231|ref|YP_003992105.1| 50S ribosomal protein L22 [Caldicellulosiruptor hydrothermalis 108]
 gi|312135491|ref|YP_004002829.1| 50S ribosomal protein L22 [Caldicellulosiruptor owensensis OL]
 gi|312793934|ref|YP_004026857.1| 50S ribosomal protein L22 [Caldicellulosiruptor kristjanssonii
           177R1B]
 gi|222456572|gb|ACM60834.1| ribosomal protein L22 [Caldicellulosiruptor bescii DSM 6725]
 gi|302574362|gb|ADL42153.1| ribosomal protein L22 [Caldicellulosiruptor obsidiansis OB47]
 gi|311775542|gb|ADQ05029.1| ribosomal protein L22 [Caldicellulosiruptor owensensis OL]
 gi|311777250|gb|ADQ06736.1| ribosomal protein L22 [Caldicellulosiruptor hydrothermalis 108]
 gi|312181074|gb|ADQ41244.1| ribosomal protein L22 [Caldicellulosiruptor kristjanssonii 177R1B]
          Length = 120

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 63/98 (64%)

Query: 26  VSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLIV 85
           +SP+K+ +V  +IR K V++AL  L+F  KR A  V K + SA+ANAENNH+++VD+L +
Sbjct: 21  ISPRKVRVVIDLIRNKPVNEALNILKFLPKRAARIVEKLVKSAIANAENNHNMNVDKLYI 80

Query: 86  SEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           +E Y      +KR   R + R   I +  S +TV+++E
Sbjct: 81  AEIYANGGPMLKRIRPRAQGRAFLIRKRTSHITVVLKE 118


>gi|147676660|ref|YP_001210875.1| ribosomal protein L22 [Pelotomaculum thermopropionicum SI]
 gi|189041956|sp|A5D5J5|RL22_PELTS RecName: Full=50S ribosomal protein L22
 gi|146272757|dbj|BAF58506.1| ribosomal protein L22 [Pelotomaculum thermopropionicum SI]
          Length = 113

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 42/106 (39%), Positives = 64/106 (60%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  +R+SP+K+  V  +IRGK++++ALA L ++ KR +  V K + SA ANAENN
Sbjct: 2   EAKAVARYIRISPRKVRQVVDLIRGKKLNEALAILRYTPKRASAVVAKVVRSAAANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
             +D D L +   YV +    KR+  R   R   + +  S +TV+V
Sbjct: 62  LQMDRDELFIKACYVDQGPTYKRYMPRAFGRADVMRKRTSHITVVV 107


>gi|312622050|ref|YP_004023663.1| 50S ribosomal protein L22 [Caldicellulosiruptor kronotskyensis
           2002]
 gi|312202517|gb|ADQ45844.1| ribosomal protein L22 [Caldicellulosiruptor kronotskyensis 2002]
          Length = 120

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 63/98 (64%)

Query: 26  VSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLIV 85
           +SP+K+ +V  +IR K V++AL  L+F  KR A  V K + SA+ANAENNH+++VD+L +
Sbjct: 21  ISPRKVRVVIDLIRNKPVNEALNILKFLPKRAARIVEKLVKSAIANAENNHNMNVDKLYI 80

Query: 86  SEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           +E Y      +KR   R + R   I +  S +TV+++E
Sbjct: 81  AEIYANGGPMLKRIRPRAQGRAFLIRKRTSHITVVLKE 118


>gi|262373516|ref|ZP_06066794.1| ribosomal protein L22 [Acinetobacter junii SH205]
 gi|262311269|gb|EEY92355.1| ribosomal protein L22 [Acinetobacter junii SH205]
          Length = 110

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 60/96 (62%)

Query: 26  VSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLIV 85
           +S QK  LVA +IRGK V+ AL  L FS K+ A  V+K L SA+ANAE+N+ LDVD L V
Sbjct: 13  ISAQKARLVADLIRGKSVARALDILNFSNKKAAVLVKKALESAIANAEHNNSLDVDDLKV 72

Query: 86  SEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           +  YV + + +KR   R + R  RI +    +TV V
Sbjct: 73  TTIYVDEGMSLKRILPRAKGRADRITKRTCHITVKV 108


>gi|293402506|ref|ZP_06646641.1| ribosomal protein L22 [Erysipelotrichaceae bacterium 5_2_54FAA]
 gi|291304020|gb|EFE45274.1| ribosomal protein L22 [Erysipelotrichaceae bacterium 5_2_54FAA]
          Length = 111

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 45/108 (41%), Positives = 62/108 (57%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A A  LR+ P+K  LV  +IRGK V +A A L+F+    A  V K L SAVANA NN
Sbjct: 2   EVKACAKTLRIPPRKARLVIDLIRGKDVEEAAAILKFTPNVAAEAVGKVLKSAVANAVNN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           +D++ ++L V   Y  + V +KRF  R +     I +  S +TV+V E
Sbjct: 62  NDMNEEKLYVKACYANEGVTLKRFMPRAKGSASAIHKRTSHITVVVDE 109


>gi|302553547|ref|ZP_07305889.1| ribosomal protein L22 [Streptomyces viridochromogenes DSM 40736]
 gi|302471165|gb|EFL34258.1| ribosomal protein L22 [Streptomyces viridochromogenes DSM 40736]
          Length = 115

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 49/114 (42%), Positives = 67/114 (58%), Gaps = 3/114 (2%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A  +RV+P K   V  +IRG   ++A A L F+ +  +  V K L SA+ANA +N
Sbjct: 2   EARAQARYIRVTPMKARRVVDLIRGLNATEAQAVLRFAPQAASQPVGKVLDSAIANAAHN 61

Query: 76  HD-LDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           +D  DVD L +SEAYV +   +KRF  R + R  RI +  S +TV+V   S EG
Sbjct: 62  YDHTDVDSLYISEAYVDEGPTLKRFRPRAQGRAYRIRKRTSHITVVVS--SKEG 113


>gi|282857358|ref|ZP_06266595.1| ribosomal protein L22 [Pyramidobacter piscolens W5455]
 gi|282584858|gb|EFB90189.1| ribosomal protein L22 [Pyramidobacter piscolens W5455]
          Length = 109

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 46/108 (42%), Positives = 62/108 (57%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A A+A  +R+SP K+  V  +IRGK+V DA+  L ++ K+ A  V K L SAVANAE N
Sbjct: 2   QAYAVAKAVRISPYKVRQVLPLIRGKKVGDAMMVLRYTPKKAARLVEKVLKSAVANAEFN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
             +DV++L V EA   +   MKRF      R    V   S +TV V E
Sbjct: 62  FGMDVEKLKVVEAKADQGPSMKRFRPASMGRAHAYVHRTSHITVTVAE 109


>gi|323342794|ref|ZP_08083026.1| 50S ribosomal protein L22 [Erysipelothrix rhusiopathiae ATCC 19414]
 gi|322463906|gb|EFY09100.1| 50S ribosomal protein L22 [Erysipelothrix rhusiopathiae ATCC 19414]
          Length = 111

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 60/108 (55%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  AI   +RV+P+K  LV   IRG  V  A A L ++    +  + K L SA+ANA NN
Sbjct: 2   EVKAIVKTVRVTPRKARLVLDEIRGLDVDHAAAILRYTPNSASKVIAKVLDSAIANATNN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           H LD ++L +S  Y  + V MKRF  R +     I++  S +TV+V E
Sbjct: 62  HQLDEEKLYISACYADEGVTMKRFRPRAKGSAAPIMKRTSHITVVVSE 109


>gi|48374165|gb|AAT41878.1| 50S ribosomal subunit L22 [Fremyella diplosiphon Fd33]
          Length = 118

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 60/107 (56%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
            E  AIA  +R+SP K+  V   IRG+   +AL  LEF   R    V K L SA ANAE+
Sbjct: 6   TEVKAIARFIRISPYKVRRVLDQIRGRSYREALIILEFMPYRACDPVLKVLRSAAANAEH 65

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           N  LD  +L++++AY  +   +KRF  R + R  +I +P   +TV V
Sbjct: 66  NAGLDRAQLVITQAYADQGPVLKRFQPRAQGRAYQIRKPTCHITVAV 112


>gi|312877370|ref|ZP_07737335.1| ribosomal protein L22 [Caldicellulosiruptor lactoaceticus 6A]
 gi|311795844|gb|EFR12208.1| ribosomal protein L22 [Caldicellulosiruptor lactoaceticus 6A]
          Length = 120

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 63/98 (64%)

Query: 26  VSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLIV 85
           +SP+K+ +V  +IR K V++AL  L+F  KR A  V K + SA+ANAENNH+++VD+L +
Sbjct: 21  ISPRKVRVVIDLIRNKPVNEALNILKFLPKRAARIVEKLVKSAIANAENNHNMNVDKLYI 80

Query: 86  SEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           +E Y      +KR   R + R   I +  S +TV+++E
Sbjct: 81  AEIYANGGPMLKRIRPRAQGRAFLIRKRTSHITVVLKE 118


>gi|169350800|ref|ZP_02867738.1| hypothetical protein CLOSPI_01574 [Clostridium spiroforme DSM 1552]
 gi|169292386|gb|EDS74519.1| hypothetical protein CLOSPI_01574 [Clostridium spiroforme DSM 1552]
          Length = 110

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 61/108 (56%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A M+RVSPQK  LV  ++RGK+V +AL  LE+  K     + K + SA  NA  N
Sbjct: 2   EARAQAKMIRVSPQKARLVVDLVRGKKVKEALGILEYVNKSATPAIIKVVKSAAQNAIYN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
              + ++L + E YV +   +KRF  R +    RI++  S +T +V E
Sbjct: 62  SGAEAEKLYIKEIYVDEGPTLKRFAARAKGSGTRILKRTSHITCVVEE 109


>gi|160881780|ref|YP_001560748.1| ribosomal protein L22 [Clostridium phytofermentans ISDg]
 gi|215274819|sp|A9KJI9|RL22_CLOPH RecName: Full=50S ribosomal protein L22
 gi|160430446|gb|ABX44009.1| ribosomal protein L22 [Clostridium phytofermentans ISDg]
          Length = 128

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 47/124 (37%), Positives = 67/124 (54%), Gaps = 3/124 (2%)

Query: 3   GKRSVSKRRMG---DNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAG 59
           G RS  KR      D   +A  S  RVS QK   V   +RGK V  AL  L ++ +  + 
Sbjct: 4   GHRSQIKRERNANKDTRPSAKLSYARVSVQKACFVLDAVRGKDVQTALGILAYNPRYAST 63

Query: 60  EVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTV 119
            + K L SA+ANAENN+ +DV +L + E Y G +  MKR   R + R  RI++  S +T+
Sbjct: 64  LIEKLLKSAIANAENNNGMDVSKLYIEECYAGCAPTMKRIKPRAQGRAYRILKRLSHITI 123

Query: 120 IVRE 123
           ++ E
Sbjct: 124 VLNE 127


>gi|288917235|ref|ZP_06411604.1| ribosomal protein L22 [Frankia sp. EUN1f]
 gi|288351426|gb|EFC85634.1| ribosomal protein L22 [Frankia sp. EUN1f]
          Length = 140

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 44/111 (39%), Positives = 61/111 (54%)

Query: 11  RMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVA 70
           R G   A A A  +  SP K   V  ++RG+   +AL  L F+ +  + +V K + SAVA
Sbjct: 11  RAGLPGAKATARYVHTSPTKARRVVDLVRGRSAGEALDILRFAPQAASTDVYKVVASAVA 70

Query: 71  NAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           NAENNH LD   L +S AYV +   +KR   R + R  RI +  S +TV+V
Sbjct: 71  NAENNHSLDPATLWISAAYVDEGPTLKRIRPRAQGRAYRIRKRTSHITVVV 121


>gi|90020612|ref|YP_526439.1| 50S ribosomal protein L22 [Saccharophagus degradans 2-40]
 gi|109893234|sp|Q21M52|RL22_SACD2 RecName: Full=50S ribosomal protein L22
 gi|89950212|gb|ABD80227.1| LSU ribosomal protein L22P [Saccharophagus degradans 2-40]
          Length = 110

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 48/105 (45%), Positives = 63/105 (60%), Gaps = 3/105 (2%)

Query: 20  IASMLR---VSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           +A+ LR   +S QK  LVA  IRGK V +AL  L FS K+ A  ++K L SAVANAE+N 
Sbjct: 3   VAAKLRGAGMSAQKARLVADQIRGKSVEEALDLLTFSTKKGAALIKKVLESAVANAEHNE 62

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
             DVD L VS  +V + + MKR   R + R  RI++    +TV V
Sbjct: 63  GADVDELKVSTIFVDEGLTMKRIRPRAKGRADRILKRTCHITVKV 107


>gi|71281105|ref|YP_267617.1| 50S ribosomal protein L22 [Colwellia psychrerythraea 34H]
 gi|109893192|sp|Q487Z8|RL22_COLP3 RecName: Full=50S ribosomal protein L22
 gi|71146845|gb|AAZ27318.1| ribosomal protein L22 [Colwellia psychrerythraea 34H]
          Length = 110

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 47/108 (43%), Positives = 59/108 (54%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A AI    R S QK  LVA  IRG  V  AL  L FS K+ A  V+K L SA+ANAE+N
Sbjct: 2   QAIAIHKFARGSAQKARLVADQIRGVNVEKALEILTFSNKKAAELVKKVLNSAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
              D+D L V    +     MKR   R + R  RI++  S +TVIV +
Sbjct: 62  EGADIDELFVKTILIDDGPTMKRIMPRAKGRADRIIKRTSHITVIVSD 109


>gi|239995005|ref|ZP_04715529.1| 50S ribosomal protein L22 [Alteromonas macleodii ATCC 27126]
          Length = 110

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 60/106 (56%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A     R S QK  LVA  IRG  V  AL  L +S K+ A  V+K L SA+ANAE+N
Sbjct: 2   EALAKHRFARTSAQKARLVADQIRGMHVEKALELLAYSPKKSAALVKKVLESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L VS+ +V +   MKR   R + R  RI +  S +TV+V
Sbjct: 62  EGADIDELRVSKVFVDEGPTMKRIKPRAKGRADRIFKRSSHITVVV 107


>gi|269124033|ref|YP_003306610.1| 50S ribosomal protein L22 [Streptobacillus moniliformis DSM 12112]
 gi|268315359|gb|ACZ01733.1| ribosomal protein L22 [Streptobacillus moniliformis DSM 12112]
          Length = 110

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 59/95 (62%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R+SPQK  LVA +IRGK   +AL  L F+ K+ A  + KTL SA+ANAE+N  L+ + LI
Sbjct: 11  RLSPQKARLVADVIRGKDALEALNILRFTNKKAAPLIEKTLRSAIANAEHNLGLNPENLI 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTV 119
           VS+  + K   +KR + R   R   I +P + +TV
Sbjct: 71  VSKVLIDKGPVLKRMNPRAMGRADIIRKPLAHITV 105


>gi|71023393|ref|XP_761926.1| hypothetical protein UM05779.1 [Ustilago maydis 521]
 gi|46100785|gb|EAK86018.1| hypothetical protein UM05779.1 [Ustilago maydis 521]
          Length = 375

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 62/99 (62%), Gaps = 1/99 (1%)

Query: 24  LRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRL 83
            ++SP+KL L+A  I G+ +  A+  ++FS KR A  V  TL  A  +A     + V RL
Sbjct: 232 FKISPRKLQLLANQISGQPIDYAILQMQFSPKRAAKRVLSTLALARDHAAAK-GMQVPRL 290

Query: 84  IVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVR 122
           +VSEA+VGK +++ R   +GR R+GR   P +RL++++R
Sbjct: 291 VVSEAWVGKGLYLTRTDIKGRARMGRKHHPQARLSIVLR 329


>gi|312880367|ref|ZP_07740167.1| LSU ribosomal protein L22P [Aminomonas paucivorans DSM 12260]
 gi|310783658|gb|EFQ24056.1| LSU ribosomal protein L22P [Aminomonas paucivorans DSM 12260]
          Length = 110

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 62/108 (57%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  +R+S  K+  +  +IRGK+  +AL  L ++ K+ A  V K L SAVANAE+N
Sbjct: 2   EAKAMAWQVRISATKVRQILPLIRGKKAGEALMTLRYTPKKGAKLVEKVLRSAVANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
             LD+D+L+V  A   +  +MKRF      R        S +TV+V E
Sbjct: 62  LGLDMDKLVVVTATADQGTYMKRFRPASMGRAHAFRHHTSHITVVVAE 109


>gi|56461019|ref|YP_156300.1| 50S ribosomal protein L22 [Idiomarina loihiensis L2TR]
 gi|81678372|sp|Q5QXY2|RL22_IDILO RecName: Full=50S ribosomal protein L22
 gi|56180029|gb|AAV82751.1| Ribosomal protein L22 [Idiomarina loihiensis L2TR]
          Length = 110

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 47/108 (43%), Positives = 61/108 (56%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A     RVS QK  LVA  IRG  V  AL  L +S K  AG ++K L SA+ANAE+N
Sbjct: 2   EAIAKHQFARVSAQKGRLVADQIRGLPVEKALDILAYSPKAAAGLIKKVLESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
              D+D L VS  ++ +   MKR   R + R  RI +  S +TV+V +
Sbjct: 62  EGADIDELKVSRVFLDEGPTMKRIKPRAKGRADRIFKRTSHITVVVSD 109


>gi|166368479|ref|YP_001660752.1| 50S ribosomal protein L22 [Microcystis aeruginosa NIES-843]
 gi|226733487|sp|B0JHZ8|RL22_MICAN RecName: Full=50S ribosomal protein L22
 gi|166090852|dbj|BAG05560.1| 50S ribosomal protein L22 [Microcystis aeruginosa NIES-843]
          Length = 119

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 60/107 (56%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
           NE  AIA  +R+SP K+  V   IRG+   +AL  LEF   R    + K L SAVANAE+
Sbjct: 7   NEVKAIARYIRMSPLKVRRVLDQIRGRSYREALIILEFMPYRACDPILKVLRSAVANAEH 66

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           N  LD   L+VS+A+      +KRF  R + R  +I +P   +TV V
Sbjct: 67  NEGLDPATLVVSQAFADGGPTLKRFRPRAQGRAYQIRKPTCHITVAV 113


>gi|73542858|ref|YP_297378.1| 50S ribosomal protein L22 [Ralstonia eutropha JMP134]
 gi|113869426|ref|YP_727915.1| 50S ribosomal protein L22 [Ralstonia eutropha H16]
 gi|109893226|sp|Q46WE9|RL22_RALEJ RecName: Full=50S ribosomal protein L22
 gi|122946538|sp|Q0K624|RL22_RALEH RecName: Full=50S ribosomal protein L22
 gi|72120271|gb|AAZ62534.1| LSU ribosomal protein L22P [Ralstonia eutropha JMP134]
 gi|113528202|emb|CAJ94547.1| LSU ribosomal protein L22 [Ralstonia eutropha H16]
          Length = 109

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 60/106 (56%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  AI    R+S QK  LVA  IRG  +  AL  L FS K+ AG V+K + SA+ANAE+N
Sbjct: 2   EVKAIHRGARISAQKTRLVADQIRGLPIERALNVLTFSPKKAAGIVKKVVESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L V   +V K+  +KRF  R + R  RI +    +TV +
Sbjct: 62  EGADIDELKVKSIFVDKATSLKRFTARAKGRGNRIEKQTCHITVTL 107


>gi|300865407|ref|ZP_07110212.1| 50S ribosomal protein L22 [Oscillatoria sp. PCC 6506]
 gi|300336590|emb|CBN55362.1| 50S ribosomal protein L22 [Oscillatoria sp. PCC 6506]
          Length = 118

 Score = 73.9 bits (180), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 44/108 (40%), Positives = 62/108 (57%)

Query: 14  DNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAE 73
           ++E  AIA  +R+SP K+  V   IRGK   +AL  LEF   R    + K L SA ANAE
Sbjct: 6   NSEVKAIARYIRMSPHKVRRVLDQIRGKSYREALVLLEFMPYRACEPILKVLRSAAANAE 65

Query: 74  NNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           +N  +D  +LIVS+A+  +   +KRF  R + R  +I +P   +TV V
Sbjct: 66  HNAGMDRAQLIVSQAFADQGPVLKRFRPRAQGRAYQIRKPTCHITVAV 113


>gi|94987407|ref|YP_595340.1| 50S ribosomal protein L22 [Lawsonia intracellularis PHE/MN1-00]
 gi|123385029|sp|Q1MPQ8|RL22_LAWIP RecName: Full=50S ribosomal protein L22
 gi|94731656|emb|CAJ55019.1| ribosomal protein L22 [Lawsonia intracellularis PHE/MN1-00]
          Length = 112

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 65/108 (60%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E+ A A  +RVSP+K  L+A+ ++GK V  A+  L+F+  + AG +   + SA+ANAE+N
Sbjct: 2   ESKACAKFIRVSPRKARLIASNVKGKTVELAMNILKFTPNKSAGIILGVMRSALANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
             LDVD LIV E  V +    KRF  R + R   I +  S ++V++ E
Sbjct: 62  AKLDVDTLIVKEVIVNEGPTWKRFMPRAQGRATHIRKRSSHISVVLSE 109


>gi|284033997|ref|YP_003383928.1| 50S ribosomal protein L22 [Kribbella flavida DSM 17836]
 gi|283813290|gb|ADB35129.1| ribosomal protein L22 [Kribbella flavida DSM 17836]
          Length = 152

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 51/128 (39%), Positives = 72/128 (56%), Gaps = 4/128 (3%)

Query: 4   KRSVSKRR---MGDNE-ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAG 59
           +R+VS RR   +GD   A A+A  +RV+P K   V  ++RG  V DALA L+F+ +  A 
Sbjct: 6   RRAVSARRESLLGDEPGAFAVARFVRVTPMKARRVVDLVRGMGVDDALATLKFAPQAAAA 65

Query: 60  EVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTV 119
            V K + SA ANAE    L    L+V +AYV +   +KR   R + R  RI +  S +TV
Sbjct: 66  TVYKVVDSAAANAEGTEHLSRADLVVVKAYVDEGPTLKRHRPRAQGRATRIDKRTSHITV 125

Query: 120 IVREVSDE 127
           +V   +DE
Sbjct: 126 VVGPRADE 133


>gi|90417574|ref|ZP_01225492.1| ribosomal protein L22 [marine gamma proteobacterium HTCC2207]
 gi|90330595|gb|EAS45891.1| ribosomal protein L22 [marine gamma proteobacterium HTCC2207]
          Length = 112

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 60/99 (60%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           ++S QK  LVA  IRGK V  AL  L+FS K+ A  ++K L SA+ANAE+N   DVD L 
Sbjct: 13  KMSAQKARLVADQIRGKSVESALDILQFSSKKGADIIKKVLESAIANAEHNDGADVDELK 72

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           VS  +V + + MKR   R + R  RI++    +TV V E
Sbjct: 73  VSTIFVDEGMTMKRIRPRAKGRADRILKRSCHITVKVAE 111


>gi|28867859|ref|NP_790478.1| 50S ribosomal protein L22 [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|66047770|ref|YP_237611.1| 50S ribosomal protein L22 [Pseudomonas syringae pv. syringae B728a]
 gi|71736088|ref|YP_276701.1| 50S ribosomal protein L22 [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|213969219|ref|ZP_03397357.1| 50S ribosomal protein L22 [Pseudomonas syringae pv. tomato T1]
 gi|237797437|ref|ZP_04585898.1| 50S ribosomal protein L22 [Pseudomonas syringae pv. oryzae str.
           1_6]
 gi|257483190|ref|ZP_05637231.1| 50S ribosomal protein L22 [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|289623844|ref|ZP_06456798.1| 50S ribosomal protein L22 [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289648937|ref|ZP_06480280.1| 50S ribosomal protein L22 [Pseudomonas syringae pv. aesculi str.
           2250]
 gi|289675493|ref|ZP_06496383.1| 50S ribosomal protein L22 [Pseudomonas syringae pv. syringae FF5]
 gi|298489092|ref|ZP_07007114.1| LSU ribosomal protein L22p (L17e) [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|301381726|ref|ZP_07230144.1| 50S ribosomal protein L22 [Pseudomonas syringae pv. tomato Max13]
 gi|302061074|ref|ZP_07252615.1| 50S ribosomal protein L22 [Pseudomonas syringae pv. tomato K40]
 gi|302130785|ref|ZP_07256775.1| 50S ribosomal protein L22 [Pseudomonas syringae pv. tomato NCPPB
           1108]
 gi|302189282|ref|ZP_07265955.1| 50S ribosomal protein L22 [Pseudomonas syringae pv. syringae 642]
 gi|51316824|sp|Q889W6|RL22_PSESM RecName: Full=50S ribosomal protein L22
 gi|81307863|sp|Q4ZMP9|RL22_PSEU2 RecName: Full=50S ribosomal protein L22
 gi|109893220|sp|Q48D41|RL22_PSE14 RecName: Full=50S ribosomal protein L22
 gi|28851095|gb|AAO54173.1| ribosomal protein L22 [Pseudomonas syringae pv. tomato str. DC3000]
 gi|63258477|gb|AAY39573.1| Ribosomal protein L22, bacterial and organelle form [Pseudomonas
           syringae pv. syringae B728a]
 gi|71556641|gb|AAZ35852.1| ribosomal protein L22 [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|213925897|gb|EEB59454.1| 50S ribosomal protein L22 [Pseudomonas syringae pv. tomato T1]
 gi|298156404|gb|EFH97502.1| LSU ribosomal protein L22p (L17e) [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|320322317|gb|EFW78411.1| 50S ribosomal protein L22 [Pseudomonas syringae pv. glycinea str.
           B076]
 gi|320331975|gb|EFW87911.1| 50S ribosomal protein L22 [Pseudomonas syringae pv. glycinea str.
           race 4]
 gi|330869426|gb|EGH04135.1| 50S ribosomal protein L22 [Pseudomonas syringae pv. aesculi str.
           0893_23]
 gi|330879374|gb|EGH13523.1| 50S ribosomal protein L22 [Pseudomonas syringae pv. glycinea str.
           race 4]
 gi|330879437|gb|EGH13586.1| 50S ribosomal protein L22 [Pseudomonas syringae pv. morsprunorum
           str. M302280PT]
 gi|330891926|gb|EGH24587.1| 50S ribosomal protein L22 [Pseudomonas syringae pv. mori str.
           301020]
 gi|330899732|gb|EGH31151.1| 50S ribosomal protein L22 [Pseudomonas syringae pv. japonica str.
           M301072PT]
 gi|330953192|gb|EGH53452.1| 50S ribosomal protein L22 [Pseudomonas syringae Cit 7]
 gi|330962520|gb|EGH62780.1| 50S ribosomal protein L22 [Pseudomonas syringae pv. maculicola str.
           ES4326]
 gi|330966906|gb|EGH67166.1| 50S ribosomal protein L22 [Pseudomonas syringae pv. actinidiae str.
           M302091]
 gi|330969816|gb|EGH69882.1| 50S ribosomal protein L22 [Pseudomonas syringae pv. aceris str.
           M302273PT]
 gi|330976645|gb|EGH76689.1| 50S ribosomal protein L22 [Pseudomonas syringae pv. aptata str. DSM
           50252]
 gi|330988277|gb|EGH86380.1| 50S ribosomal protein L22 [Pseudomonas syringae pv. lachrymans str.
           M301315]
 gi|331012418|gb|EGH92474.1| 50S ribosomal protein L22 [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|331018165|gb|EGH98221.1| 50S ribosomal protein L22 [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
 gi|331020287|gb|EGI00344.1| 50S ribosomal protein L22 [Pseudomonas syringae pv. oryzae str.
           1_6]
          Length = 110

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 62/106 (58%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A  S  R+S QK  LVA  IRGK+V +AL  L FS K+ A  ++K L SAVANAE+N
Sbjct: 2   EVAAKLSGARISAQKARLVADQIRGKKVGEALNLLAFSSKKAAEILKKVLESAVANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              DVD L VS  +V +   +KR   R + R  RIV+    +TV V
Sbjct: 62  EGADVDDLKVSTVFVNEGRSLKRIMPRAKGRADRIVKRSCHITVKV 107


>gi|329905171|ref|ZP_08274067.1| LSU ribosomal protein L22p (L17e) [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327547682|gb|EGF32469.1| LSU ribosomal protein L22p (L17e) [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 110

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 62/106 (58%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A    +R+S QK  LVA +IRGK+V  AL  L+FS K+ A  +++ L SA+ANAE+N
Sbjct: 3   ETKATLRGVRLSAQKGRLVADLIRGKKVDQALNILQFSPKKGAVIIKRVLESAIANAEHN 62

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L V+  YV K   +KRF  R + R  RI +    + V V
Sbjct: 63  DGADIDELKVTTIYVEKGSVLKRFTARAKGRGDRISKQSCHIYVTV 108


>gi|94312243|ref|YP_585453.1| 50S ribosomal protein L22 [Cupriavidus metallidurans CH34]
 gi|123081147|sp|Q1LI42|RL22_RALME RecName: Full=50S ribosomal protein L22
 gi|93356095|gb|ABF10184.1| 50S ribosomal subunit protein L22 [Cupriavidus metallidurans CH34]
          Length = 109

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 60/106 (56%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  AI    R+S QK  LVA  IRG  +  AL  L FS K+ AG V+K + SA+ANAE+N
Sbjct: 2   EVKAIHRGARISAQKTRLVADQIRGLPIERALNILAFSPKKAAGIVKKVVESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L V   +V K+  +KRF  R + R  RI +    +TV +
Sbjct: 62  EGADIDELKVKSIFVDKATSLKRFTARAKGRGNRIEKQTCHITVTL 107


>gi|15599454|ref|NP_252948.1| 50S ribosomal protein L22 [Pseudomonas aeruginosa PAO1]
 gi|26987200|ref|NP_742625.1| 50S ribosomal protein L22 [Pseudomonas putida KT2440]
 gi|77461295|ref|YP_350802.1| 50S ribosomal protein L22 [Pseudomonas fluorescens Pf0-1]
 gi|104779760|ref|YP_606258.1| 50S ribosomal protein L22 [Pseudomonas entomophila L48]
 gi|107103771|ref|ZP_01367689.1| hypothetical protein PaerPA_01004842 [Pseudomonas aeruginosa PACS2]
 gi|116052293|ref|YP_788861.1| 50S ribosomal protein L22 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|146308918|ref|YP_001189383.1| 50S ribosomal protein L22 [Pseudomonas mendocina ymp]
 gi|148545744|ref|YP_001265846.1| 50S ribosomal protein L22 [Pseudomonas putida F1]
 gi|152984054|ref|YP_001346228.1| 50S ribosomal protein L22 [Pseudomonas aeruginosa PA7]
 gi|167031505|ref|YP_001666736.1| 50S ribosomal protein L22 [Pseudomonas putida GB-1]
 gi|170723901|ref|YP_001751589.1| 50S ribosomal protein L22 [Pseudomonas putida W619]
 gi|218889414|ref|YP_002438278.1| 50S ribosomal protein L22 [Pseudomonas aeruginosa LESB58]
 gi|229592898|ref|YP_002875017.1| 50S ribosomal protein L22 [Pseudomonas fluorescens SBW25]
 gi|254237121|ref|ZP_04930444.1| 50S ribosomal protein L22 [Pseudomonas aeruginosa C3719]
 gi|296387185|ref|ZP_06876684.1| 50S ribosomal protein L22 [Pseudomonas aeruginosa PAb1]
 gi|312963363|ref|ZP_07777846.1| 50S ribosomal subunit protein L22 [Pseudomonas fluorescens WH6]
 gi|325272012|ref|ZP_08138456.1| 50S ribosomal protein L22 [Pseudomonas sp. TJI-51]
 gi|51316826|sp|Q88QN0|RL22_PSEPK RecName: Full=50S ribosomal protein L22
 gi|51316919|sp|Q9HWE0|RL22_PSEAE RecName: Full=50S ribosomal protein L22
 gi|109893223|sp|Q3K5Z3|RL22_PSEPF RecName: Full=50S ribosomal protein L22
 gi|122261442|sp|Q02T75|RL22_PSEAB RecName: Full=50S ribosomal protein L22
 gi|123381071|sp|Q1IFW1|RL22_PSEE4 RecName: Full=50S ribosomal protein L22
 gi|166221983|sp|A6UZJ3|RL22_PSEA7 RecName: Full=50S ribosomal protein L22
 gi|166221984|sp|A4XZ85|RL22_PSEMY RecName: Full=50S ribosomal protein L22
 gi|166221985|sp|A5VXQ2|RL22_PSEP1 RecName: Full=50S ribosomal protein L22
 gi|189041959|sp|B0KK72|RL22_PSEPG RecName: Full=50S ribosomal protein L22
 gi|226733498|sp|B7V649|RL22_PSEA8 RecName: Full=50S ribosomal protein L22
 gi|226733499|sp|B1JDV9|RL22_PSEPW RecName: Full=50S ribosomal protein L22
 gi|259646254|sp|C3K2X1|RL22_PSEFS RecName: Full=50S ribosomal protein L22
 gi|9950475|gb|AAG07646.1|AE004841_24 50S ribosomal protein L22 [Pseudomonas aeruginosa PAO1]
 gi|24981838|gb|AAN66089.1|AE016238_7 ribosomal protein L22 [Pseudomonas putida KT2440]
 gi|77385298|gb|ABA76811.1| 50S ribosomal protein L22 [Pseudomonas fluorescens Pf0-1]
 gi|95108747|emb|CAK13441.1| 50S ribosomal subunit protein L22 [Pseudomonas entomophila L48]
 gi|115587514|gb|ABJ13529.1| 50S ribosomal protein L22 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126169052|gb|EAZ54563.1| 50S ribosomal protein L22 [Pseudomonas aeruginosa C3719]
 gi|145577119|gb|ABP86651.1| LSU ribosomal protein L22P [Pseudomonas mendocina ymp]
 gi|148509802|gb|ABQ76662.1| LSU ribosomal protein L22P [Pseudomonas putida F1]
 gi|150959212|gb|ABR81237.1| ribosomal protein L22 [Pseudomonas aeruginosa PA7]
 gi|166857993|gb|ABY96400.1| ribosomal protein L22 [Pseudomonas putida GB-1]
 gi|169761904|gb|ACA75220.1| ribosomal protein L22 [Pseudomonas putida W619]
 gi|218769637|emb|CAW25397.1| 50S ribosomal protein L22 [Pseudomonas aeruginosa LESB58]
 gi|229364764|emb|CAY52758.1| 50S ribosomal protein L22 [Pseudomonas fluorescens SBW25]
 gi|310940990|dbj|BAJ24369.1| 50S ribosomal protein L22 [Pseudomonas putida]
 gi|310941020|dbj|BAJ24384.1| 50S ribosomal protein L22 [Pseudomonas putida]
 gi|310941050|dbj|BAJ24399.1| 50S ribosomal protein L22 [Pseudomonas putida]
 gi|310941080|dbj|BAJ24414.1| 50S ribosomal protein L22 [Pseudomonas putida]
 gi|310941611|dbj|BAJ24159.1| 50S ribosomal protein L22 [Pseudomonas putida]
 gi|310941641|dbj|BAJ24174.1| 50S ribosomal protein L22 [Pseudomonas fluorescens]
 gi|310941701|dbj|BAJ24204.1| 50S ribosomal protein L22 [Pseudomonas aeruginosa]
 gi|310941731|dbj|BAJ24219.1| 50S ribosomal protein L22 [Pseudomonas azotoformans]
 gi|310941761|dbj|BAJ24234.1| 50S ribosomal protein L22 [Pseudomonas chlororaphis subsp.
           chlororaphis]
 gi|310941791|dbj|BAJ24249.1| 50S ribosomal protein L22 [Pseudomonas fulva]
 gi|310941821|dbj|BAJ24264.1| 50S ribosomal protein L22 [Pseudomonas mendocina]
 gi|310941851|dbj|BAJ24279.1| 50S ribosomal protein L22 [Pseudomonas straminea]
 gi|310941911|dbj|BAJ24309.1| 50S ribosomal protein L22 [Pseudomonas putida]
 gi|310941941|dbj|BAJ24324.1| 50S ribosomal protein L22 [Pseudomonas fluorescens]
 gi|310941971|dbj|BAJ24339.1| 50S ribosomal protein L22 [Pseudomonas putida]
 gi|310942001|dbj|BAJ24354.1| 50S ribosomal protein L22 [Pseudomonas putida]
 gi|311282443|gb|EFQ61041.1| 50S ribosomal subunit protein L22 [Pseudomonas fluorescens WH6]
 gi|324102843|gb|EGC00246.1| 50S ribosomal protein L22 [Pseudomonas sp. TJI-51]
          Length = 110

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 62/106 (58%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A  S  R+S QK  LVA  IRGK+V +AL  L FS K+ A  ++K L SAVANAE+N
Sbjct: 2   EVAAKLSGARISAQKARLVADQIRGKKVGEALNLLAFSSKKAAEIMKKVLESAVANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              DVD L VS  +V +   +KR   R + R  RIV+    +TV V
Sbjct: 62  EGADVDDLKVSTVFVNEGRSLKRIMPRAKGRADRIVKRSCHITVKV 107


>gi|330944850|gb|EGH46718.1| 50S ribosomal protein L22 [Pseudomonas syringae pv. pisi str.
           1704B]
          Length = 109

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 62/106 (58%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A  S  R+S QK  LVA  IRGK+V +AL  L FS K+ A  ++K L SAVANAE+N
Sbjct: 1   EVAAKLSGARISAQKARLVADQIRGKKVGEALNLLAFSSKKAAEILKKVLESAVANAEHN 60

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              DVD L VS  +V +   +KR   R + R  RIV+    +TV V
Sbjct: 61  EGADVDDLKVSTVFVNEGRSLKRIMPRAKGRADRIVKRSCHITVKV 106


>gi|86610033|ref|YP_478795.1| 50S ribosomal protein L22 [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|109893246|sp|Q2JIM2|RL22_SYNJB RecName: Full=50S ribosomal protein L22
 gi|86558575|gb|ABD03532.1| ribosomal protein L22 [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 124

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 66/117 (56%), Gaps = 2/117 (1%)

Query: 12  MGDN--EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV 69
           M D+  E  A+A  +R+SP K+  V   IRG+  +DAL  LEF        VRK L SAV
Sbjct: 1   MADSSPEVKAVARYIRMSPFKVRRVLDQIRGRTYADALILLEFMPYAACEPVRKVLRSAV 60

Query: 70  ANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           ANAE+N+ LD   L++S+AY  +   +KRF  R + R   I +    +T+ VR + +
Sbjct: 61  ANAEHNNGLDPRDLVISQAYADQGPVLKRFRPRAQGRAYPIRKRTCHITIAVRPIEE 117


>gi|163752599|ref|ZP_02159778.1| ribosomal protein L22 [Shewanella benthica KT99]
 gi|161327511|gb|EDP98718.1| ribosomal protein L22 [Shewanella benthica KT99]
          Length = 110

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 58/99 (58%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R SPQK  LVA  IRG  V+ AL  L FS K+ A  V+K L SA+ANAE+N   D+D L 
Sbjct: 11  RTSPQKCRLVADQIRGLPVAKALEILTFSSKKAAVLVKKVLNSAIANAEHNEGADIDELR 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           V    + +   MKR   R + R  RI++  S +TV+V +
Sbjct: 71  VGAIMIDEGPTMKRIMPRAKGRADRIIKRTSHITVVVSD 109


>gi|88606717|ref|YP_504897.1| 50S ribosomal protein L22 [Anaplasma phagocytophilum HZ]
 gi|109893178|sp|Q2GL54|RL22_ANAPZ RecName: Full=50S ribosomal protein L22
 gi|88597780|gb|ABD43250.1| ribosomal protein L22 [Anaplasma phagocytophilum HZ]
          Length = 112

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 60/100 (60%)

Query: 24  LRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRL 83
           LR +P KLNLVA +IRGK V+ A   L+F +K+ A  + K L SA+ANA  N+ +D D L
Sbjct: 12  LRSTPAKLNLVADLIRGKDVAVAAMYLKFCKKKAALLIDKVLKSAIANARANYGVDADNL 71

Query: 84  IVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            V E  VGK+  ++R   R R R  RI + +  + V + E
Sbjct: 72  YVKEVLVGKAFTLRRVQPRARGRACRISKRYGSVVVKLLE 111


>gi|313667446|ref|YP_004047730.1| 50S ribosomal protein L22 [Neisseria lactamica ST-640]
 gi|313004908|emb|CBN86334.1| 50S ribosomal protein L22 [Neisseria lactamica 020-06]
          Length = 109

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 60/104 (57%)

Query: 18  NAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHD 77
           NA     R+S QK  LVA +IRGK V+ AL  L FS K+ A  ++K L SA+ANAE+N+ 
Sbjct: 4   NAQHKNARISAQKARLVADLIRGKDVAQALNILAFSPKKSAELIKKVLESAIANAEHNNG 63

Query: 78  LDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
            D+D L V   +V K   +KRF  R + R  RI +    + V V
Sbjct: 64  ADIDELKVVTIFVDKGPSLKRFQARAKGRGNRIEKQTCHINVTV 107


>gi|291437834|ref|ZP_06577224.1| 50S ribosomal protein L22 [Streptomyces ghanaensis ATCC 14672]
 gi|291340729|gb|EFE67685.1| 50S ribosomal protein L22 [Streptomyces ghanaensis ATCC 14672]
          Length = 123

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 49/114 (42%), Positives = 67/114 (58%), Gaps = 3/114 (2%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A  +RV+P K   V  +IRG   ++A A L F+ +  +  V K L SA+ANA +N
Sbjct: 10  EARAQARYIRVTPMKARRVVDLIRGMDATEAQAVLRFAPQAASVPVGKVLDSAIANAAHN 69

Query: 76  HD-LDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           +D  DVD L +SEAYV +   +KRF  R + R  RI +  S +TV+V   S EG
Sbjct: 70  YDHTDVDSLFISEAYVDEGPTLKRFRPRAQGRAYRIRKRTSHITVVVS--SKEG 121


>gi|289641161|ref|ZP_06473329.1| ribosomal protein L22 [Frankia symbiont of Datisca glomerata]
 gi|289509102|gb|EFD30033.1| ribosomal protein L22 [Frankia symbiont of Datisca glomerata]
          Length = 140

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 64/111 (57%)

Query: 11  RMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVA 70
           R G   A A A  +RVSP K   V  ++RG+  S+AL  L F+ +  + +V K + SAVA
Sbjct: 11  RSGLAGARASARYVRVSPTKARRVIDLVRGRSASEALDILRFAPQAASEDVYKVVASAVA 70

Query: 71  NAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           NAE+NH LD   L V EA+V +   +KR   R + R  RI +  S +TV+V
Sbjct: 71  NAEHNHGLDPATLWVGEAFVDEGPTLKRIRPRAQGRAYRIRKRTSHITVVV 121


>gi|237653991|ref|YP_002890305.1| 50S ribosomal protein L22 [Thauera sp. MZ1T]
 gi|237625238|gb|ACR01928.1| ribosomal protein L22 [Thauera sp. MZ1T]
          Length = 109

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 45/108 (41%), Positives = 63/108 (58%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  AI   +R+S QK  LVA ++RG  V  AL  L FS K+ A  +RK L SA+ANAE+N
Sbjct: 2   ETKAILRGVRLSAQKGRLVADLVRGMPVGRALDTLAFSPKKGAKIIRKVLESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
              D+D L V   +V + + +KRF  R + R  RI++P   + + V E
Sbjct: 62  DGADIDALKVKTIHVEEGMTLKRFTARAKGRGNRILKPTCHVYLTVGE 109


>gi|70732877|ref|YP_262645.1| 50S ribosomal protein L22 [Pseudomonas fluorescens Pf-5]
 gi|109893221|sp|Q4K538|RL22_PSEF5 RecName: Full=50S ribosomal protein L22
 gi|68347176|gb|AAY94782.1| ribosomal protein L22 [Pseudomonas fluorescens Pf-5]
          Length = 111

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 62/106 (58%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A  S  R+S QK  LVA  IRGK+V +AL  L FS K+ A  ++K L SAVANAE+N
Sbjct: 3   EVAAKLSGARISAQKARLVADQIRGKKVGEALNLLAFSSKKAAEIMKKVLESAVANAEHN 62

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              DVD L VS  +V +   +KR   R + R  RIV+    +TV V
Sbjct: 63  EGADVDDLKVSTVFVNEGRSLKRIMPRAKGRADRIVKRSCHITVKV 108


>gi|83648847|ref|YP_437282.1| 50S ribosomal protein L22 [Hahella chejuensis KCTC 2396]
 gi|109893201|sp|Q2S917|RL22_HAHCH RecName: Full=50S ribosomal protein L22
 gi|83636890|gb|ABC32857.1| ribosomal protein L22 [Hahella chejuensis KCTC 2396]
          Length = 110

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 59/99 (59%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R+S QK  LVA  +RGKRV +AL  L FS K+ +  ++K L SA+ANAE+N  LDVD L 
Sbjct: 11  RLSAQKARLVADQVRGKRVEEALDILTFSPKKASSIIKKVLESAIANAEHNEGLDVDELK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           V+   V +   MKR   R + R  RI +    +TV V E
Sbjct: 71  VATICVDEGPTMKRIKPRAKGRADRIFKRTCHITVKVAE 109


>gi|306819486|ref|ZP_07453193.1| 50S ribosomal protein L22 [Mobiluncus mulieris ATCC 35239]
 gi|304647778|gb|EFM45096.1| 50S ribosomal protein L22 [Mobiluncus mulieris ATCC 35239]
          Length = 231

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 67/117 (57%), Gaps = 5/117 (4%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN- 74
           +A A +  +RV+PQK   V   +RG   + AL  L+F+ ++ A  +RKTL SA+ANAE  
Sbjct: 2   KATAHSRYVRVTPQKARRVIREVRGLPANRALDVLKFAPQKPAVPIRKTLVSALANAEQA 61

Query: 75  ----NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
                   D D + V EAYV +   MKRF  R + R  RI++  S LTV+V + +D+
Sbjct: 62  ARREGKSFDADTMFVIEAYVNEGPTMKRFRARAQGRGARILKRTSHLTVVVGDAADK 118


>gi|225076400|ref|ZP_03719599.1| hypothetical protein NEIFLAOT_01445 [Neisseria flavescens
           NRL30031/H210]
 gi|224952248|gb|EEG33457.1| hypothetical protein NEIFLAOT_01445 [Neisseria flavescens
           NRL30031/H210]
          Length = 109

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 59/97 (60%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R+S QK  LVA +IRGK V+ AL  L FS K+ A  ++K L SA+ANAE+N+ +D+D L 
Sbjct: 11  RISAQKARLVADLIRGKDVAQALNILAFSPKKGAELIKKVLESAIANAEHNNGVDIDELK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           V   +V K   +KRF  R + R  RI +    + V V
Sbjct: 71  VVTIFVDKGPSLKRFQARAKGRGNRIEKQTCHINVTV 107


>gi|189095429|ref|YP_001936442.1| 50S ribosomal protein L22 [Heterosigma akashiwo]
 gi|157694772|gb|ABV66048.1| 50S ribosomal protein L22 [Heterosigma akashiwo]
 gi|157778003|gb|ABV70189.1| 50S ribosomal protein L22 [Heterosigma akashiwo]
          Length = 116

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 60/110 (54%)

Query: 12  MGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVAN 71
           +  N+A AIA  +R+SP K+  V   I+G    +AL  LEF   R  G V + L SA +N
Sbjct: 4   LNQNQAKAIAKYIRMSPTKVRRVLKQIQGLSYKEALMILEFMPYRACGPVWQVLHSAASN 63

Query: 72  AENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           A+NN  L    L +  A+V +   +KRF  R + R  +I++P   + +IV
Sbjct: 64  AQNNLGLSKQNLFIKSAFVNQGPTLKRFRPRSKGRGFKILKPTCHINIIV 113


>gi|227876210|ref|ZP_03994326.1| 50S ribosomal protein L22P [Mobiluncus mulieris ATCC 35243]
 gi|269976884|ref|ZP_06183858.1| 50S ribosomal protein L22 [Mobiluncus mulieris 28-1]
 gi|227843171|gb|EEJ53364.1| 50S ribosomal protein L22P [Mobiluncus mulieris ATCC 35243]
 gi|269934715|gb|EEZ91275.1| 50S ribosomal protein L22 [Mobiluncus mulieris 28-1]
          Length = 231

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 67/117 (57%), Gaps = 5/117 (4%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN- 74
           +A A +  +RV+PQK   V   +RG   + AL  L+F+ ++ A  +RKTL SA+ANAE  
Sbjct: 2   KATAHSRYVRVTPQKARRVIREVRGLPANRALDVLKFAPQKPAVPIRKTLVSALANAEQA 61

Query: 75  ----NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
                   D D + V EAYV +   MKRF  R + R  RI++  S LTV+V + +D+
Sbjct: 62  ARREGKSFDADTMFVIEAYVNEGPTMKRFRARAQGRGARILKRTSHLTVVVGDAADK 118


>gi|160895845|ref|YP_001561427.1| 50S ribosomal protein L22 [Delftia acidovorans SPH-1]
 gi|215274821|sp|A9BPS3|RL22_DELAS RecName: Full=50S ribosomal protein L22
 gi|160361429|gb|ABX33042.1| ribosomal protein L22 [Delftia acidovorans SPH-1]
          Length = 110

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 63/107 (58%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
           +E  A+   +R+S  K  LVA +IRGK+V  AL  L F++K+ A  ++K L SA+ANAE+
Sbjct: 2   SETRAVLRGVRLSVDKGRLVADLIRGKKVDQALNILTFTQKKAAVIIKKVLESAIANAEH 61

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           N   D+D L V   +V +   +KRF  R + R  RI +P   + V V
Sbjct: 62  NDGADIDELKVKTIFVEQGTTLKRFTARAKGRGNRISKPTCHVYVTV 108


>gi|260886881|ref|ZP_05898144.1| ribosomal protein L22 [Selenomonas sputigena ATCC 35185]
 gi|260863480|gb|EEX77980.1| ribosomal protein L22 [Selenomonas sputigena ATCC 35185]
          Length = 90

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 38/87 (43%), Positives = 57/87 (65%)

Query: 37  MIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFM 96
           +IRGK +++A A L+F+ K  A  + K L SAV+NAENN D++VD+L +  AYV +   +
Sbjct: 3   LIRGKNIAEAFAILKFTPKIGADVIEKVLKSAVSNAENNFDMNVDKLYIKTAYVDQGPTL 62

Query: 97  KRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           KR H R R +  +I++  S +TV V E
Sbjct: 63  KRIHPRSRGQAFKILKRTSHVTVAVEE 89


>gi|308272974|emb|CBX29578.1| 50S ribosomal protein L22 [uncultured Desulfobacterium sp.]
          Length = 112

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 62/106 (58%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E   +A  +R+SPQK+  +   ++GK+V  AL +L+F  ++ AG V K + SAVANA  N
Sbjct: 2   EVKTLARYMRISPQKVRKLIGAVKGKKVETALNELKFMPQKSAGIVEKIIRSAVANANQN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
            ++DVD ++V          +KRF  R R R  RI++  + +TV +
Sbjct: 62  PNIDVDSMVVRNIVADTGPTLKRFAARARGRGTRIIKRTTHITVTL 107


>gi|307694147|ref|ZP_07636384.1| 50S ribosomal protein L22 [Ruminococcaceae bacterium D16]
          Length = 110

 Score = 73.6 bits (179), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 45/108 (41%), Positives = 61/108 (56%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A    LR+SP+K+ +V  +IRGK V  A A L  + K  +  V K L SA ANAENN
Sbjct: 2   EAVANLKYLRISPRKVKIVLDLIRGKDVGTAAAILMQTPKSASEPVLKLLKSAAANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           H +D ++L VS  Y      +KR   R + R  RI +  S +T++V E
Sbjct: 62  HQMDPEKLYVSACYANPGPIIKRIRPRAQGRAFRINKRTSHVTIVVSE 109


>gi|192361611|ref|YP_001981213.1| 50S ribosomal protein L22 [Cellvibrio japonicus Ueda107]
 gi|226733445|sp|B3PK42|RL22_CELJU RecName: Full=50S ribosomal protein L22
 gi|190687776|gb|ACE85454.1| ribosomal protein L22 [Cellvibrio japonicus Ueda107]
          Length = 110

 Score = 73.6 bits (179), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 60/106 (56%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A  S  R+S QK  LVA  IRGK V DAL  L FS K+ A  ++K L SA+ANAE+N
Sbjct: 2   EVAAKLSGARLSAQKARLVADQIRGKGVEDALDILAFSTKKGAQIIKKVLESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              DVD L V   +V + V +KR   R + R  RI +    +TV V
Sbjct: 62  EGADVDELKVKTIFVDEGVSLKRIKPRAKGRADRITKRTCHITVKV 107


>gi|239929509|ref|ZP_04686462.1| 50S ribosomal protein L22 [Streptomyces ghanaensis ATCC 14672]
          Length = 115

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 49/114 (42%), Positives = 67/114 (58%), Gaps = 3/114 (2%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A  +RV+P K   V  +IRG   ++A A L F+ +  +  V K L SA+ANA +N
Sbjct: 2   EARAQARYIRVTPMKARRVVDLIRGMDATEAQAVLRFAPQAASVPVGKVLDSAIANAAHN 61

Query: 76  HD-LDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           +D  DVD L +SEAYV +   +KRF  R + R  RI +  S +TV+V   S EG
Sbjct: 62  YDHTDVDSLFISEAYVDEGPTLKRFRPRAQGRAYRIRKRTSHITVVVS--SKEG 113


>gi|121592717|ref|YP_984613.1| 50S ribosomal protein L22 [Acidovorax sp. JS42]
 gi|222109498|ref|YP_002551762.1| 50S ribosomal protein l22 [Acidovorax ebreus TPSY]
 gi|215274808|sp|A1W2R2|RL22_ACISJ RecName: Full=50S ribosomal protein L22
 gi|254800435|sp|B9MB78|RL22_DIAST RecName: Full=50S ribosomal protein L22
 gi|120604797|gb|ABM40537.1| LSU ribosomal protein L22P [Acidovorax sp. JS42]
 gi|221728942|gb|ACM31762.1| ribosomal protein L22 [Acidovorax ebreus TPSY]
          Length = 110

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 63/107 (58%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
           +E  A+   +R+S  K  LVA +IRGK+V  AL  L F++K+ A  V+K L SA+ANAE+
Sbjct: 2   SETRAVLRGVRLSVDKGRLVADLIRGKKVDQALNILAFTQKKAAVIVKKVLESAIANAEH 61

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           N   D+D L V   +V +   +KRF  R + R  RI +P   + V V
Sbjct: 62  NDGADIDDLKVKTIFVEQGTTLKRFTARAKGRGNRISKPTCHIYVTV 108


>gi|154507859|ref|ZP_02043501.1| hypothetical protein ACTODO_00341 [Actinomyces odontolyticus ATCC
           17982]
 gi|293190254|ref|ZP_06608750.1| ribosomal protein L22 [Actinomyces odontolyticus F0309]
 gi|153797493|gb|EDN79913.1| hypothetical protein ACTODO_00341 [Actinomyces odontolyticus ATCC
           17982]
 gi|292821070|gb|EFF80023.1| ribosomal protein L22 [Actinomyces odontolyticus F0309]
          Length = 123

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 68/119 (57%), Gaps = 5/119 (4%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVAN---- 71
           EA A A  +RV+PQK   V   +RGKRV +A   L F+ + +A +VRK L SAVAN    
Sbjct: 2   EAKAQARFIRVTPQKSRRVVNEVRGKRVLEAADILRFAPQAVATDVRKVLLSAVANSKVK 61

Query: 72  AEN-NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEGK 129
           AEN     +   L+V EAYV +   MKR   R + R GRI++  S +T++V    D+ K
Sbjct: 62  AENAGETFNEADLLVLEAYVDEGPTMKRIRPRAQGRAGRILKRTSHITIVVGTKEDKKK 120


>gi|157377444|ref|YP_001476044.1| 50S ribosomal protein L22 [Shewanella sediminis HAW-EB3]
 gi|157960019|ref|YP_001500053.1| 50S ribosomal protein L22 [Shewanella pealeana ATCC 700345]
 gi|167626034|ref|YP_001676328.1| 50S ribosomal protein L22 [Shewanella halifaxensis HAW-EB4]
 gi|170729004|ref|YP_001763030.1| 50S ribosomal protein L22 [Shewanella woodyi ATCC 51908]
 gi|212634834|ref|YP_002311359.1| 50S ribosomal protein L22 [Shewanella piezotolerans WP3]
 gi|294142928|ref|YP_003558906.1| 50S ribosomal protein L22 [Shewanella violacea DSS12]
 gi|189041966|sp|B0TM07|RL22_SHEHH RecName: Full=50S ribosomal protein L22
 gi|189041967|sp|A8GYY1|RL22_SHEPA RecName: Full=50S ribosomal protein L22
 gi|189041968|sp|A8G1E3|RL22_SHESH RecName: Full=50S ribosomal protein L22
 gi|226733511|sp|B8CND8|RL22_SHEPW RecName: Full=50S ribosomal protein L22
 gi|226733512|sp|B1KMX8|RL22_SHEWM RecName: Full=50S ribosomal protein L22
 gi|157319818|gb|ABV38916.1| ribosomal protein L22 [Shewanella sediminis HAW-EB3]
 gi|157845019|gb|ABV85518.1| ribosomal protein L22 [Shewanella pealeana ATCC 700345]
 gi|167356056|gb|ABZ78669.1| ribosomal protein L22 [Shewanella halifaxensis HAW-EB4]
 gi|169814351|gb|ACA88935.1| ribosomal protein L22 [Shewanella woodyi ATCC 51908]
 gi|212556318|gb|ACJ28772.1| Ribosomal protein L22 [Shewanella piezotolerans WP3]
 gi|293329397|dbj|BAJ04128.1| ribosomal protein L22 [Shewanella violacea DSS12]
          Length = 110

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 58/99 (58%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R SPQK  LVA  IRG  V+ AL  L FS K+ A  V+K L SA+ANAE+N   D+D L 
Sbjct: 11  RTSPQKCRLVADQIRGLPVAKALEILTFSPKKAAVLVKKVLDSAIANAEHNEGADIDELR 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           V    + +   MKR   R + R  RI++  S +TV+V +
Sbjct: 71  VGAIMIDEGPTMKRIMPRAKGRADRIIKRTSHITVVVSD 109


>gi|307701169|ref|ZP_07638191.1| ribosomal protein L22 [Mobiluncus mulieris FB024-16]
 gi|307613563|gb|EFN92810.1| ribosomal protein L22 [Mobiluncus mulieris FB024-16]
          Length = 233

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 67/117 (57%), Gaps = 5/117 (4%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN- 74
           +A A +  +RV+PQK   V   +RG   + AL  L+F+ ++ A  +RKTL SA+ANAE  
Sbjct: 2   KATAHSRYVRVTPQKARRVIREVRGLPANRALDVLKFAPQKPAVPIRKTLVSALANAEQA 61

Query: 75  ----NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
                   D D + V EAYV +   MKRF  R + R  RI++  S LTV+V + +D+
Sbjct: 62  ARREGKSFDADTMFVIEAYVNEGPTMKRFRARAQGRGARILKRTSHLTVVVGDAADK 118


>gi|237747370|ref|ZP_04577850.1| large subunit ribosomal protein L22 [Oxalobacter formigenes HOxBLS]
 gi|229378721|gb|EEO28812.1| large subunit ribosomal protein L22 [Oxalobacter formigenes HOxBLS]
          Length = 110

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 59/98 (60%)

Query: 24  LRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRL 83
           + +S QK  L+A +IRGK+V  AL  L F+ K+ A  +++ L SA+ANAE+N   D+D L
Sbjct: 11  VHLSAQKGRLIADLIRGKKVDQALDILSFTPKKGAVIIKQVLESAIANAEHNDGADIDEL 70

Query: 84  IVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
            VS  YV +  FMKR+  R + R  RI +    + V V
Sbjct: 71  KVSSIYVERGTFMKRYSARAKGRGDRISKQTCHIYVTV 108


>gi|116617334|ref|YP_817705.1| 50S ribosomal protein L22P [Leuconostoc mesenteroides subsp.
           mesenteroides ATCC 8293]
 gi|227431336|ref|ZP_03913389.1| ribosomal protein L22 [Leuconostoc mesenteroides subsp. cremoris
           ATCC 19254]
 gi|122272465|sp|Q03ZP0|RL22_LEUMM RecName: Full=50S ribosomal protein L22
 gi|116096181|gb|ABJ61332.1| LSU ribosomal protein L22P [Leuconostoc mesenteroides subsp.
           mesenteroides ATCC 8293]
 gi|227352929|gb|EEJ43102.1| ribosomal protein L22 [Leuconostoc mesenteroides subsp. cremoris
           ATCC 19254]
          Length = 118

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 62/107 (57%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A A ++RV+P+K  LV   IR K V++A A L+F       ++ K L SAVANAENN 
Sbjct: 8   ARATAKIVRVAPRKARLVLDTIRRKSVNEAYAILKFLPNTSTEDIYKVLNSAVANAENNF 67

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            LD + LIV EA+  +   +KRF  R +     I +  S LT++V E
Sbjct: 68  SLDREDLIVKEAFANEGPTLKRFRPRAKGSASPINKRTSHLTIVVAE 114


>gi|255067453|ref|ZP_05319308.1| ribosomal protein L22 [Neisseria sicca ATCC 29256]
 gi|261364860|ref|ZP_05977743.1| ribosomal protein L22 [Neisseria mucosa ATCC 25996]
 gi|261378046|ref|ZP_05982619.1| ribosomal protein L22 [Neisseria cinerea ATCC 14685]
 gi|298370586|ref|ZP_06981901.1| ribosomal protein L22 [Neisseria sp. oral taxon 014 str. F0314]
 gi|255048248|gb|EET43712.1| ribosomal protein L22 [Neisseria sicca ATCC 29256]
 gi|269145496|gb|EEZ71914.1| ribosomal protein L22 [Neisseria cinerea ATCC 14685]
 gi|288566909|gb|EFC88469.1| ribosomal protein L22 [Neisseria mucosa ATCC 25996]
 gi|298281196|gb|EFI22686.1| ribosomal protein L22 [Neisseria sp. oral taxon 014 str. F0314]
          Length = 109

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 60/104 (57%)

Query: 18  NAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHD 77
           NA     R+S QK  LVA +IRGK V+ AL  L FS K+ A  ++K L SA+ANAE+N+ 
Sbjct: 4   NAQHKNARISAQKARLVADLIRGKDVAQALNILTFSPKKGAELIKKVLESAIANAEHNNG 63

Query: 78  LDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
            D+D L V   +V K   +KRF  R + R  RI +    + V V
Sbjct: 64  ADIDELKVVTIFVDKGPSLKRFQARAKGRGNRIEKQTCHINVTV 107


>gi|269792789|ref|YP_003317693.1| 50S ribosomal protein L22 [Thermanaerovibrio acidaminovorans DSM
           6589]
 gi|269100424|gb|ACZ19411.1| ribosomal protein L22 [Thermanaerovibrio acidaminovorans DSM 6589]
          Length = 110

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/108 (40%), Positives = 64/108 (59%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+A  +R++  K+  V  +IRG+ V +AL  L+++ K+ A  V K L SAVANAE+N
Sbjct: 2   EAKAVAKRVRIAASKVRQVLPLIRGREVGEALMILKYTPKKGARVVEKVLKSAVANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           + LDVD+L+V  A   +  +MKRF      R        S +TV+V E
Sbjct: 62  YGLDVDKLVVVRASADQGSYMKRFRPVSMGRAHAYRHHTSHITVVVAE 109


>gi|221133619|ref|ZP_03559924.1| 50S ribosomal protein L22 [Glaciecola sp. HTCC2999]
          Length = 110

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 60/106 (56%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A     R S QK  LVA  IRG  V  AL  L +S K+ A  V+K L SA+ANAE+N
Sbjct: 2   EALAKHRFARTSAQKARLVADQIRGLHVEKALEVLTYSNKKAADLVKKVLESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L V++ +V +   MKR   R + R  RI +  S +TV+V
Sbjct: 62  DGADIDELKVAKIFVDEGPTMKRIKTRAKGRADRIFKRSSHITVVV 107


>gi|71891980|ref|YP_277710.1| 50S ribosomal subunit protein L22 [Candidatus Blochmannia
           pennsylvanicus str. BPEN]
 gi|109893182|sp|Q493K3|RL22_BLOPB RecName: Full=50S ribosomal protein L22
 gi|71796086|gb|AAZ40837.1| 50S ribosomal subunit protein L22 [Candidatus Blochmannia
           pennsylvanicus str. BPEN]
          Length = 109

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 63/98 (64%)

Query: 24  LRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRL 83
           +R S QKL LV   IRGK+VS AL  L+++ K+ A  V+KTL SA+ANAE+N + D++ L
Sbjct: 10  IRSSAQKLRLVVNTIRGKKVSQALDILKYTNKKSAELVKKTLESAIANAEHNDNSDINNL 69

Query: 84  IVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
            + + +V     +KR   R + R  +I++  S LT++V
Sbjct: 70  KIIKIFVDSGPIIKRIMPRAKGRSDKIMKRTSHLTIVV 107


>gi|291280143|ref|YP_003496978.1| 50S ribosomal protein L22 [Deferribacter desulfuricans SSM1]
 gi|290754845|dbj|BAI81222.1| 50S ribosomal protein L22 [Deferribacter desulfuricans SSM1]
          Length = 110

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 63/108 (58%), Gaps = 1/108 (0%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A+    RVSP+K   VA ++RGK V +A+A L+F+ K+ AG + K L SA+ANAE NH
Sbjct: 3   AKAVGKYFRVSPRKARPVADLVRGKNVEEAMAILKFTNKKAAGMIAKVLKSAMANAEENH 62

Query: 77  DL-DVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            + DV +L + E  +      KR+  R   R   I +  S +T+++ E
Sbjct: 63  GVKDVSKLYIKEIRIDGGPTWKRYMPRAYGRATLIRKRTSHITIVLAE 110


>gi|15676074|ref|NP_273205.1| 50S ribosomal protein L22 [Neisseria meningitidis MC58]
 gi|59802155|ref|YP_208867.1| 50S ribosomal protein L22 [Neisseria gonorrhoeae FA 1090]
 gi|121634021|ref|YP_974266.1| 50S ribosomal protein L22 [Neisseria meningitidis FAM18]
 gi|161870910|ref|YP_001600090.1| 50S ribosomal protein L22 [Neisseria meningitidis 053442]
 gi|194099928|ref|YP_002003066.1| 50S ribosomal protein L22 [Neisseria gonorrhoeae NCCP11945]
 gi|218767163|ref|YP_002341675.1| 50S ribosomal protein L22 [Neisseria meningitidis Z2491]
 gi|239997931|ref|ZP_04717855.1| 50S ribosomal protein L22 [Neisseria gonorrhoeae 35/02]
 gi|240015091|ref|ZP_04722004.1| 50S ribosomal protein L22 [Neisseria gonorrhoeae DGI18]
 gi|240017540|ref|ZP_04724080.1| 50S ribosomal protein L22 [Neisseria gonorrhoeae FA6140]
 gi|240081683|ref|ZP_04726226.1| 50S ribosomal protein L22 [Neisseria gonorrhoeae FA19]
 gi|240113961|ref|ZP_04728451.1| 50S ribosomal protein L22 [Neisseria gonorrhoeae MS11]
 gi|240116695|ref|ZP_04730757.1| 50S ribosomal protein L22 [Neisseria gonorrhoeae PID18]
 gi|240118917|ref|ZP_04732979.1| 50S ribosomal protein L22 [Neisseria gonorrhoeae PID1]
 gi|240122163|ref|ZP_04735125.1| 50S ribosomal protein L22 [Neisseria gonorrhoeae PID24-1]
 gi|240124455|ref|ZP_04737411.1| 50S ribosomal protein L22 [Neisseria gonorrhoeae PID332]
 gi|240124676|ref|ZP_04737562.1| 50S ribosomal protein L22 [Neisseria gonorrhoeae SK-92-679]
 gi|240129131|ref|ZP_04741792.1| 50S ribosomal protein L22 [Neisseria gonorrhoeae SK-93-1035]
 gi|254494716|ref|ZP_05107887.1| 50S ribosomal protein L22 [Neisseria gonorrhoeae 1291]
 gi|254805809|ref|YP_003084030.1| 50S ribosomal protein L22 [Neisseria meningitidis alpha14]
 gi|260439546|ref|ZP_05793362.1| 50S ribosomal protein L22 [Neisseria gonorrhoeae DGI2]
 gi|261400057|ref|ZP_05986182.1| ribosomal protein L22 [Neisseria lactamica ATCC 23970]
 gi|268593781|ref|ZP_06127948.1| 50S ribosomal protein L22 [Neisseria gonorrhoeae 35/02]
 gi|268597780|ref|ZP_06131947.1| 50S ribosomal protein L22 [Neisseria gonorrhoeae FA19]
 gi|268600025|ref|ZP_06134192.1| 50S ribosomal protein L22 [Neisseria gonorrhoeae MS11]
 gi|268602363|ref|ZP_06136530.1| 50S ribosomal protein L22 [Neisseria gonorrhoeae PID18]
 gi|268604626|ref|ZP_06138793.1| 50S ribosomal protein L22 [Neisseria gonorrhoeae PID1]
 gi|268683084|ref|ZP_06149946.1| 50S ribosomal protein L22 [Neisseria gonorrhoeae PID332]
 gi|268683250|ref|ZP_06150112.1| 50S ribosomal protein L22 [Neisseria gonorrhoeae SK-92-679]
 gi|268687514|ref|ZP_06154376.1| 50S ribosomal protein L22 [Neisseria gonorrhoeae SK-93-1035]
 gi|291042782|ref|ZP_06568523.1| 50S ribosomal protein L22 [Neisseria gonorrhoeae DGI2]
 gi|293398197|ref|ZP_06642402.1| 50S ribosomal protein L22 [Neisseria gonorrhoeae F62]
 gi|296313370|ref|ZP_06863311.1| ribosomal protein L22 [Neisseria polysaccharea ATCC 43768]
 gi|304388948|ref|ZP_07370995.1| 50S ribosomal protein L22 [Neisseria meningitidis ATCC 13091]
 gi|51316738|sp|Q7DDT5|RL22_NEIMB RecName: Full=50S ribosomal protein L22
 gi|51316922|sp|Q9JRD8|RL22_NEIMA RecName: Full=50S ribosomal protein L22
 gi|75507298|sp|Q5F5T2|RL22_NEIG1 RecName: Full=50S ribosomal protein L22
 gi|166221975|sp|A1KRH8|RL22_NEIMF RecName: Full=50S ribosomal protein L22
 gi|189041955|sp|A9M3W1|RL22_NEIM0 RecName: Full=50S ribosomal protein L22
 gi|226733490|sp|B4RQY3|RL22_NEIG2 RecName: Full=50S ribosomal protein L22
 gi|7225365|gb|AAF40605.1| 50S ribosomal protein L22 [Neisseria meningitidis MC58]
 gi|59719050|gb|AAW90455.1| putative 50S ribosomal subunit protein L22 [Neisseria gonorrhoeae
           FA 1090]
 gi|120865727|emb|CAM09456.1| 50S ribosomal protein L22 [Neisseria meningitidis FAM18]
 gi|121051171|emb|CAM07442.1| 50S ribosomal protein L22 [Neisseria meningitidis Z2491]
 gi|161596463|gb|ABX74123.1| 50S ribosomal protein L22 [Neisseria meningitidis 053442]
 gi|193935218|gb|ACF31042.1| 50S ribosomal protein L22 [Neisseria gonorrhoeae NCCP11945]
 gi|226513756|gb|EEH63101.1| 50S ribosomal protein L22 [Neisseria gonorrhoeae 1291]
 gi|254669351|emb|CBA08432.1| 50S ribosomal protein L22 [Neisseria meningitidis alpha14]
 gi|254670746|emb|CBA06987.1| 50S ribosomal protein L22 [Neisseria meningitidis alpha153]
 gi|254672676|emb|CBA06539.1| 50S ribosomal protein L22 [Neisseria meningitidis alpha275]
 gi|261391683|emb|CAX49132.1| 50S ribosomal protein L22 [Neisseria meningitidis 8013]
 gi|268547170|gb|EEZ42588.1| 50S ribosomal protein L22 [Neisseria gonorrhoeae 35/02]
 gi|268551568|gb|EEZ46587.1| 50S ribosomal protein L22 [Neisseria gonorrhoeae FA19]
 gi|268584156|gb|EEZ48832.1| 50S ribosomal protein L22 [Neisseria gonorrhoeae MS11]
 gi|268586494|gb|EEZ51170.1| 50S ribosomal protein L22 [Neisseria gonorrhoeae PID18]
 gi|268588757|gb|EEZ53433.1| 50S ribosomal protein L22 [Neisseria gonorrhoeae PID1]
 gi|268623368|gb|EEZ55768.1| 50S ribosomal protein L22 [Neisseria gonorrhoeae PID332]
 gi|268623534|gb|EEZ55934.1| 50S ribosomal protein L22 [Neisseria gonorrhoeae SK-92-679]
 gi|268627798|gb|EEZ60198.1| 50S ribosomal protein L22 [Neisseria gonorrhoeae SK-93-1035]
 gi|269210283|gb|EEZ76738.1| ribosomal protein L22 [Neisseria lactamica ATCC 23970]
 gi|291013216|gb|EFE05182.1| 50S ribosomal protein L22 [Neisseria gonorrhoeae DGI2]
 gi|291611460|gb|EFF40530.1| 50S ribosomal protein L22 [Neisseria gonorrhoeae F62]
 gi|296840081|gb|EFH24019.1| ribosomal protein L22 [Neisseria polysaccharea ATCC 43768]
 gi|304337082|gb|EFM03269.1| 50S ribosomal protein L22 [Neisseria meningitidis ATCC 13091]
 gi|308388363|gb|ADO30683.1| 50S ribosomal protein L22 [Neisseria meningitidis alpha710]
 gi|309379154|emb|CBX22285.1| 50S ribosomal protein L22 [Neisseria lactamica Y92-1009]
 gi|319411369|emb|CBY91780.1| 50S ribosomal protein L22 [Neisseria meningitidis WUE 2594]
 gi|325129066|gb|EGC51915.1| ribosomal protein L22 [Neisseria meningitidis N1568]
 gi|325131089|gb|EGC53812.1| ribosomal protein L22 [Neisseria meningitidis OX99.30304]
 gi|325133059|gb|EGC55731.1| ribosomal protein L22 [Neisseria meningitidis M6190]
 gi|325135153|gb|EGC57779.1| ribosomal protein L22 [Neisseria meningitidis M13399]
 gi|325137205|gb|EGC59800.1| ribosomal protein L22 [Neisseria meningitidis M0579]
 gi|325139037|gb|EGC61583.1| ribosomal protein L22 [Neisseria meningitidis ES14902]
 gi|325141161|gb|EGC63661.1| ribosomal protein L22 [Neisseria meningitidis CU385]
 gi|325143237|gb|EGC65576.1| ribosomal protein L22 [Neisseria meningitidis 961-5945]
 gi|325145344|gb|EGC67621.1| ribosomal protein L22 [Neisseria meningitidis M01-240013]
 gi|325197434|gb|ADY92890.1| ribosomal protein L22 [Neisseria meningitidis G2136]
 gi|325199360|gb|ADY94815.1| ribosomal protein L22 [Neisseria meningitidis H44/76]
 gi|325203018|gb|ADY98472.1| ribosomal protein L22 [Neisseria meningitidis M01-240149]
 gi|325203267|gb|ADY98720.1| ribosomal protein L22 [Neisseria meningitidis M01-240355]
 gi|325205240|gb|ADZ00693.1| ribosomal protein L22 [Neisseria meningitidis M04-240196]
 gi|325207183|gb|ADZ02635.1| ribosomal protein L22 [Neisseria meningitidis NZ-05/33]
          Length = 109

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 60/104 (57%)

Query: 18  NAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHD 77
           NA     R+S QK  LVA +IRGK V+ AL  L FS K+ A  ++K L SA+ANAE+N+ 
Sbjct: 4   NAQHKNARISAQKARLVADLIRGKDVAQALNILAFSPKKGAELIKKVLESAIANAEHNNG 63

Query: 78  LDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
            D+D L V   +V K   +KRF  R + R  RI +    + V V
Sbjct: 64  ADIDELKVVTIFVDKGPSLKRFQARAKGRGNRIEKQTCHINVTV 107


>gi|282898352|ref|ZP_06306343.1| Ribosomal protein L22 [Raphidiopsis brookii D9]
 gi|282899957|ref|ZP_06307918.1| Ribosomal protein L22 [Cylindrospermopsis raciborskii CS-505]
 gi|281195227|gb|EFA70163.1| Ribosomal protein L22 [Cylindrospermopsis raciborskii CS-505]
 gi|281196883|gb|EFA71788.1| Ribosomal protein L22 [Raphidiopsis brookii D9]
          Length = 117

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 60/112 (53%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
            E  AIA  +RVSP K+  V   IRG    +AL  LEF   R    V K L SA ANAE+
Sbjct: 6   TEVKAIARYIRVSPYKVRRVLDQIRGLSYREALIILEFMPYRACEPVLKVLRSAAANAEH 65

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           N  LD   L++++AY  +   +KRF  R + R  +I +P   +TV V E + 
Sbjct: 66  NAGLDRASLVITQAYADQGPVLKRFQPRAQGRAYQIRKPTCHITVAVGEAAQ 117


>gi|294630898|ref|ZP_06709458.1| 50S ribosomal protein L22 [Streptomyces sp. e14]
 gi|292834231|gb|EFF92580.1| 50S ribosomal protein L22 [Streptomyces sp. e14]
          Length = 123

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 49/114 (42%), Positives = 67/114 (58%), Gaps = 3/114 (2%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A  +RV+P K   V  +IRG   ++A A L F+ +  +  V K L SA+ANA +N
Sbjct: 10  EARAQARYIRVTPMKARRVVDLIRGMDAAEAQAVLRFAPQAASVPVGKVLDSAIANAAHN 69

Query: 76  HD-LDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           +D  DVD L +SEAYV +   +KRF  R + R  RI +  S +TV+V   S EG
Sbjct: 70  YDHTDVDSLYISEAYVDEGPTLKRFRPRAQGRAYRIRKRTSHITVVVS--SKEG 121


>gi|302336377|ref|YP_003801584.1| LSU ribosomal protein L22P [Olsenella uli DSM 7084]
 gi|301320217|gb|ADK68704.1| LSU ribosomal protein L22P [Olsenella uli DSM 7084]
          Length = 120

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 62/107 (57%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
           NE +A A  +R++P+K+ +V   IR K V  AL  L+FS +  A  V K L SAVANAEN
Sbjct: 8   NEVSATAKYVRMAPRKVRMVVDTIRNKSVERALETLQFSSRAAAEPVAKVLRSAVANAEN 67

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           N+ L    L+V  AYV +   +KR   R +    RI +  S +TV+V
Sbjct: 68  NNGLRSAGLVVKYAYVDEGPTLKRIRPRAKGSASRINKRTSHITVVV 114


>gi|307328035|ref|ZP_07607216.1| ribosomal protein L22 [Streptomyces violaceusniger Tu 4113]
 gi|297159602|gb|ADI09314.1| 50S ribosomal protein L22 [Streptomyces bingchenggensis BCW-1]
 gi|306886340|gb|EFN17345.1| ribosomal protein L22 [Streptomyces violaceusniger Tu 4113]
          Length = 115

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 67/114 (58%), Gaps = 3/114 (2%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A  +RV+P K   V  +IRG   ++A A L F+ +  +  V K L SA+ANA +N
Sbjct: 2   EARAQARYIRVTPMKARRVVDLIRGMSATEAQAVLRFAPQAASVPVGKVLDSAIANAAHN 61

Query: 76  HD-LDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           +D  D D L++SEAYV +   +KRF  R + R  RI +  S +TV+V   S EG
Sbjct: 62  YDHTDADSLVISEAYVDEGPTLKRFRPRAQGRAYRIRKRTSHITVVVS--SKEG 113


>gi|218282166|ref|ZP_03488465.1| hypothetical protein EUBIFOR_01047 [Eubacterium biforme DSM 3989]
 gi|218216845|gb|EEC90383.1| hypothetical protein EUBIFOR_01047 [Eubacterium biforme DSM 3989]
          Length = 111

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 45/108 (41%), Positives = 60/108 (55%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A A  LR+ P+K  LV  +IRGK V +A A L+F   +    V K L SAVANA NN
Sbjct: 2   EVKATAKTLRIQPRKARLVLDLIRGKDVEEAAAILKFLPNKGGYLVGKVLHSAVANAVNN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           +DLD  +L V   +  + + MKRF  R +     I +  S +TV+V E
Sbjct: 62  NDLDESKLYVKACWADEGITMKRFMPRAKGSASAIHKRTSHITVVVAE 109


>gi|323465829|gb|ADX69516.1| 50S ribosomal protein L22 [Lactobacillus helveticus H10]
          Length = 94

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 41/94 (43%), Positives = 59/94 (62%)

Query: 33  LVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLIVSEAYVGK 92
           +V  +IRGK V++ALA LEF+ +  +  V K L SA+ANAE+N+DL+   L VSEAYV +
Sbjct: 1   MVVDLIRGKSVAEALAILEFTPRAASPIVEKVLRSAIANAEHNYDLESANLYVSEAYVNE 60

Query: 93  SVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
              +KRF  R +     I +  S + V+V E +D
Sbjct: 61  GATLKRFRPRAKGMASPINKRTSHVVVVVSEKND 94


>gi|11467465|ref|NP_043611.1| ribosomal protein L22 [Odontella sinensis]
 gi|1350632|sp|P49558|RK22_ODOSI RecName: Full=50S ribosomal protein L22, chloroplastic
 gi|1185160|emb|CAA91643.1| 50S ribosomal protein L22 [Odontella sinensis]
          Length = 115

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 60/107 (56%)

Query: 19  AIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDL 78
           A+A  +R+SP K+  V   IRG+   +AL  LEF      G V + + SA ANA+NN+ L
Sbjct: 9   AVAKYIRMSPHKVRRVLNQIRGRSYQEALMILEFLPYDAGGPVWQVVHSAAANAKNNYGL 68

Query: 79  DVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVS 125
           D  +LI+ E +  +   +KR   R + R   I++P   +TVIV+  S
Sbjct: 69  DKKKLIIEEVFANEGPKLKRIRPRAQGRAYSILKPTCHITVIVKGTS 115


>gi|114561341|ref|YP_748854.1| 50S ribosomal protein L22 [Shewanella frigidimarina NCIMB 400]
 gi|122301111|sp|Q089P9|RL22_SHEFN RecName: Full=50S ribosomal protein L22
 gi|114332634|gb|ABI70016.1| LSU ribosomal protein L22P [Shewanella frigidimarina NCIMB 400]
          Length = 110

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 57/97 (58%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R S QK  LVA  IRG  VS AL  L FS K+ A  V+K L SA+ANAE+N   D+D L 
Sbjct: 11  RTSAQKARLVADQIRGLPVSKALEILTFSPKKAAVLVKKVLDSAIANAEHNEGADIDELK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           V   +V +   MKR   R + R  RI++  S +TV+V
Sbjct: 71  VGAVFVDEGPTMKRIMPRAKGRADRIMKRTSHITVVV 107


>gi|304413150|ref|ZP_07394623.1| 50S ribosomal subunit protein L22 [Candidatus Regiella insecticola
           LSR1]
 gi|304283993|gb|EFL92386.1| 50S ribosomal subunit protein L22 [Candidatus Regiella insecticola
           LSR1]
          Length = 125

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 62/99 (62%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R S QK+ LVA ++RGK V+ AL  L ++ K+ +  V+K L SA+ANAE+N   D+D L 
Sbjct: 11  RSSAQKVRLVADLVRGKPVAQALNILTYTNKKASALVKKVLQSAIANAEHNDGSDIDDLK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           V++ +V     MKR   R + R  RI++  S +TV+V +
Sbjct: 71  VAKIFVDSGPSMKRTMPRAKGRADRILKRTSHITVVVSD 109


>gi|241759608|ref|ZP_04757709.1| ribosomal protein L22 [Neisseria flavescens SK114]
 gi|241319980|gb|EER56361.1| ribosomal protein L22 [Neisseria flavescens SK114]
          Length = 109

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 58/97 (59%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R+S QK  LVA +IRGK V+ AL  L FS K+ A  ++K L SA+ANAE+N+  D+D L 
Sbjct: 11  RISAQKARLVADLIRGKDVAQALNILAFSPKKGAELIKKVLESAIANAEHNNGADIDELK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           V   +V K   +KRF  R + R  RI +    + V V
Sbjct: 71  VVTIFVDKGSSLKRFQARAKGRGNRIEKQTCHINVTV 107


>gi|124268622|ref|YP_001022626.1| 50S ribosomal protein L22 [Methylibium petroleiphilum PM1]
 gi|166221971|sp|A2SLF2|RL22_METPP RecName: Full=50S ribosomal protein L22
 gi|124261397|gb|ABM96391.1| LSU ribosomal protein L22P [Methylibium petroleiphilum PM1]
          Length = 109

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/106 (40%), Positives = 62/106 (58%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  AI   +R+S  K   VA ++RGK+V  AL  LEF++K+ A  ++K L SA+ANAE+N
Sbjct: 2   ETRAIVRGVRLSVDKGRPVADLVRGKKVDQALNILEFTQKKAAVIIKKALESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L V   +V +   +KRF  R + R  RI +P   + V V
Sbjct: 62  DGADIDELKVKTIHVEQGATLKRFSARAKGRGNRISKPTCHIFVTV 107


>gi|71065064|ref|YP_263791.1| 50S ribosomal protein L22 [Psychrobacter arcticus 273-4]
 gi|93005319|ref|YP_579756.1| 50S ribosomal protein L22 [Psychrobacter cryohalolentis K5]
 gi|109893224|sp|Q4FUF1|RL22_PSYA2 RecName: Full=50S ribosomal protein L22
 gi|109893225|sp|Q1QDI1|RL22_PSYCK RecName: Full=50S ribosomal protein L22
 gi|71038049|gb|AAZ18357.1| LSU ribosomal protein L22P [Psychrobacter arcticus 273-4]
 gi|92392997|gb|ABE74272.1| LSU ribosomal protein L22P [Psychrobacter cryohalolentis K5]
          Length = 109

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/98 (43%), Positives = 60/98 (61%)

Query: 26  VSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLIV 85
           +S QK+ LVA  +RGK +  AL  L +S K+ A  V+K L SA+ANAENN+ LD+D L V
Sbjct: 12  ISAQKVRLVADEVRGKSIERALDILTYSNKKGAVFVKKCLNSAIANAENNNGLDIDTLKV 71

Query: 86  SEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           S  YV + + +KR   R + R  RI +    +T+ V E
Sbjct: 72  STIYVDEGITLKRILPRAKGRADRISKRTCHITIKVGE 109


>gi|304373185|ref|YP_003856394.1| 50S ribosomal protein L22 [Mycoplasma hyorhinis HUB-1]
 gi|304309376|gb|ADM21856.1| 50S ribosomal protein L22 [Mycoplasma hyorhinis HUB-1]
 gi|330723955|gb|AEC46325.1| 50S ribosomal protein L22 [Mycoplasma hyorhinis MCLD]
          Length = 121

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/113 (40%), Positives = 66/113 (58%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A A   M R+S QK  LVA +I+ +  ++ALA L+ + K+ +    K L SAVANA NN
Sbjct: 7   QARASVKMQRISAQKARLVARLIKKQPTTNALAILQNTNKKASYFFIKLLNSAVANAVNN 66

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           H L+ D L+V +  V +   +KRF  R +    RI++  S L V+V EVS  G
Sbjct: 67  HGLNGDSLVVKDVIVNEGPTLKRFQPRAKGVAYRILKRTSHLAVVVEEVSLLG 119


>gi|170754424|ref|YP_001783116.1| 50S ribosomal protein L22 [Clostridium botulinum B1 str. Okra]
 gi|169119636|gb|ACA43472.1| 50S ribosomal protein L22 [Clostridium botulinum B1 str. Okra]
          Length = 111

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 72/108 (66%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AI   +R+SP K+ +V  ++RGK V++A A L+++ K  A  + K L SAVANAENN
Sbjct: 2   EAKAIVRYVRMSPSKIGVVLDLVRGKDVNEAFAILKYTPKDAAEVIYKALKSAVANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            +LDV+ L +SEA+VG+   +KR+    + R  RI +  S LT++V+E
Sbjct: 62  LNLDVNNLYISEAHVGQGPTLKRYQPHAQGRAFRIRKRTSHLTLVVKE 109


>gi|302877806|ref|YP_003846370.1| 50S ribosomal protein L22 [Gallionella capsiferriformans ES-2]
 gi|302580595|gb|ADL54606.1| ribosomal protein L22 [Gallionella capsiferriformans ES-2]
          Length = 110

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/103 (42%), Positives = 61/103 (59%)

Query: 19  AIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDL 78
           A+A  + +S QK  LVA  IRG  V+ AL  L FS K+ AG ++K L SA+ANAE+N   
Sbjct: 6   AVAKNIHLSAQKGRLVADQIRGLPVAQALNILNFSPKKGAGIIKKALDSAIANAEHNDGA 65

Query: 79  DVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           D+D L V   Y+ K+  +KRF  R + R  +I +    +TV V
Sbjct: 66  DIDELKVKVIYIDKASSLKRFMARAKGRGNKIEKQTCHITVSV 108


>gi|271962637|ref|YP_003336833.1| 50S ribosomal protein L22 [Streptosporangium roseum DSM 43021]
 gi|270505812|gb|ACZ84090.1| 50S ribosomal protein L22 [Streptosporangium roseum DSM 43021]
          Length = 117

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 63/115 (54%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A     R +P K   V  +IRG   S+A A L+F+ +  +  V K L SA+ANAE+N
Sbjct: 2   EARAQVRFARHTPMKARRVVDLIRGLPASEAQAVLQFAPQSASETVYKVLSSAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEGKV 130
             LD D L VS A+V +   +KRF  R + R  RI +  S +TVIV     +G+ 
Sbjct: 62  FKLDRDTLFVSRAWVDEGPTLKRFRPRAQGRAYRINKRTSHITVIVESREPKGRT 116


>gi|227485520|ref|ZP_03915836.1| ribosomal protein L22 [Anaerococcus lactolyticus ATCC 51172]
 gi|227236519|gb|EEI86534.1| ribosomal protein L22 [Anaerococcus lactolyticus ATCC 51172]
          Length = 113

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 66/108 (61%)

Query: 19  AIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDL 78
           AIA   R+SP K+N +A  IRGK+V +AL  L+F+ K+ A  + + L SA+ANAENN+ L
Sbjct: 5   AIAKYQRISPLKVNYIAREIRGKQVDEALNILKFTNKKGARLLEEVLKSAIANAENNNGL 64

Query: 79  DVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
           D + L V +AY   +  MKR+  + +     I++  S + V + ++ +
Sbjct: 65  DRENLYVEKAYANDAPTMKRYRPKAKGAAYPILKRSSHIGVELADIEE 112


>gi|302543356|ref|ZP_07295698.1| ribosomal protein L22 [Streptomyces hygroscopicus ATCC 53653]
 gi|302460974|gb|EFL24067.1| ribosomal protein L22 [Streptomyces himastatinicus ATCC 53653]
          Length = 123

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 67/114 (58%), Gaps = 3/114 (2%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A  +RV+P K   V  +IRG   ++A A L F+ +  +  V K L SA+ANA +N
Sbjct: 10  EARAQARYIRVTPMKARRVVDLIRGMGATEAQAVLRFAPQAASVPVGKVLDSAIANAAHN 69

Query: 76  HD-LDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           +D  D D L++SEAYV +   +KRF  R + R  RI +  S +TV+V   S EG
Sbjct: 70  YDHTDADSLVISEAYVDEGPTLKRFRPRAQGRAYRIRKRTSHITVVVS--SKEG 121


>gi|119484828|ref|ZP_01619310.1| 50S ribosomal protein L22 [Lyngbya sp. PCC 8106]
 gi|119457646|gb|EAW38770.1| 50S ribosomal protein L22 [Lyngbya sp. PCC 8106]
          Length = 119

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 60/107 (56%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
            E  AIA  +R+SP K+  V   IRG+   +AL  LEF   R    + K L SAVANAE+
Sbjct: 7   TEVKAIARYIRMSPHKVRRVLDQIRGRSYREALIILEFMPYRSCQPILKALRSAVANAEH 66

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           N  LD   L+VS+A+  +   +KR+  R + R  +I +P   +TV V
Sbjct: 67  NQGLDPATLVVSQAFADQGPSLKRYRPRAQGRAYQIRKPTCHITVAV 113


>gi|332172254|gb|AEE21508.1| ribosomal protein L22 [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 110

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 60/106 (56%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A     R S QK  LVA  IRG  V  AL  L +S K+ A  ++K L SA+ANAE+N
Sbjct: 2   EALATHRHARTSAQKARLVADQIRGLHVEKALELLAYSPKKSADLMKKVLESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L V++ +V +   MKR   R + R  RI +  S +TV+V
Sbjct: 62  EGADIDELTVAKVFVDEGPTMKRIKPRAKGRADRIFKRSSHITVVV 107


>gi|329898715|ref|ZP_08272449.1| LSU ribosomal protein L22p (L17e) [gamma proteobacterium IMCC3088]
 gi|328920770|gb|EGG28226.1| LSU ribosomal protein L22p (L17e) [gamma proteobacterium IMCC3088]
          Length = 112

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 57/97 (58%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R+S QK  LVA  +RG  V  AL  L FS K+ A  V+K L SA+ANAENN   DVD L 
Sbjct: 11  RISAQKARLVADQVRGLPVEKALDVLAFSPKKAAHIVKKVLDSAIANAENNEGADVDELK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           VS  +V + + MKR   R + R  RI++    +TV V
Sbjct: 71  VSTIFVDEGMTMKRLRPRAKGRADRILKRTCHITVKV 107


>gi|304310021|ref|YP_003809619.1| 50S ribosomal protein L22 [gamma proteobacterium HdN1]
 gi|301795754|emb|CBL43953.1| 50S ribosomal protein L22 [gamma proteobacterium HdN1]
          Length = 110

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/103 (43%), Positives = 63/103 (61%), Gaps = 3/103 (2%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R+S QK  LVA  +RGK V+ AL  L FS K+ A  ++K + SA+ANAE+N   DVD L 
Sbjct: 11  RISAQKARLVADQVRGKPVAQALNVLTFSPKKAAHLIKKVVESAIANAEHNEGADVDELK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           +S  +V + + MKR   R + R  RIV+    +TV   +VSD+
Sbjct: 71  ISAIFVDEGMSMKRVKPRAKGRADRIVKRTCHITV---KVSDK 110


>gi|218440628|ref|YP_002378957.1| 50S ribosomal protein L22 [Cyanothece sp. PCC 7424]
 gi|218173356|gb|ACK72089.1| ribosomal protein L22 [Cyanothece sp. PCC 7424]
          Length = 121

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/113 (38%), Positives = 63/113 (55%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
           NE  AIA  +R+SP K+  V   IRG+   +AL  LEF   +    + K L SAVANAE+
Sbjct: 9   NEVKAIARYVRMSPYKVRRVLDQIRGRTYREALIILEFMPYKACDVILKLLRSAVANAEH 68

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           N+ LD   L+VS+AY      ++RF  R + R  +I +P   +T+ V    +E
Sbjct: 69  NNGLDPTTLVVSKAYADGGPSLRRFRARAQGRAYQIRKPTCHITLFVAPALEE 121


>gi|15617113|ref|NP_240326.1| 50S ribosomal protein L22 [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
 gi|219681865|ref|YP_002468251.1| 50S ribosomal protein L22 [Buchnera aphidicola str. 5A
           (Acyrthosiphon pisum)]
 gi|219682420|ref|YP_002468804.1| 50S ribosomal protein L22 [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
 gi|257471570|ref|ZP_05635569.1| 50S ribosomal protein L22 [Buchnera aphidicola str. LSR1
           (Acyrthosiphon pisum)]
 gi|11134598|sp|P57586|RL22_BUCAI RecName: Full=50S ribosomal protein L22
 gi|254800425|sp|B8D9U2|RL22_BUCA5 RecName: Full=50S ribosomal protein L22
 gi|254800426|sp|B8D844|RL22_BUCAT RecName: Full=50S ribosomal protein L22
 gi|25295394|pir||D84990 50S ribosomal protein L22 [imported] - Buchnera sp. (strain APS)
 gi|10039178|dbj|BAB13212.1| 50S ribosomal protein L22 [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
 gi|219622153|gb|ACL30309.1| 50S ribosomal protein L22 [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
 gi|219624708|gb|ACL30863.1| 50S ribosomal protein L22 [Buchnera aphidicola str. 5A
           (Acyrthosiphon pisum)]
 gi|311086241|gb|ADP66323.1| 50S ribosomal protein L22 [Buchnera aphidicola str. LL01
           (Acyrthosiphon pisum)]
 gi|311086818|gb|ADP66899.1| 50S ribosomal protein L22 [Buchnera aphidicola str. TLW03
           (Acyrthosiphon pisum)]
 gi|311087405|gb|ADP67485.1| 50S ribosomal protein L22 [Buchnera aphidicola str. JF99
           (Acyrthosiphon pisum)]
 gi|311087900|gb|ADP67979.1| 50S ribosomal protein L22 [Buchnera aphidicola str. JF98
           (Acyrthosiphon pisum)]
          Length = 110

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 61/97 (62%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R S QK+ L+  +IRGK+V  AL  L ++ K+ A  V+K + SAVANAE+N   D+D+L 
Sbjct: 11  RSSAQKVRLIVDLIRGKKVPQALNILTYTNKKAAFLVKKVVESAVANAEHNDGADIDKLR 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           + + +V +   MKR   R + R  RI++  S +TVIV
Sbjct: 71  IKKIFVNEGSTMKRMMPRAKGRADRILKRTSHITVIV 107


>gi|261380564|ref|ZP_05985137.1| ribosomal protein L22 [Neisseria subflava NJ9703]
 gi|319639554|ref|ZP_07994301.1| 50S ribosomal protein L22 [Neisseria mucosa C102]
 gi|284796532|gb|EFC51879.1| ribosomal protein L22 [Neisseria subflava NJ9703]
 gi|317399125|gb|EFV79799.1| 50S ribosomal protein L22 [Neisseria mucosa C102]
          Length = 109

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 58/97 (59%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R+S QK  LVA +IRGK V+ AL  L FS K+ A  ++K L SA+ANAE+N+  D+D L 
Sbjct: 11  RISAQKARLVADLIRGKDVAQALNILAFSPKKGAELIKKVLESAIANAEHNNGADIDELK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           V   +V K   +KRF  R + R  RI +    + V V
Sbjct: 71  VVTIFVDKGPSLKRFQARAKGRGNRIEKQTCHINVTV 107


>gi|114778819|ref|ZP_01453626.1| Ribosomal protein L22 [Mariprofundus ferrooxydans PV-1]
 gi|114550950|gb|EAU53514.1| Ribosomal protein L22 [Mariprofundus ferrooxydans PV-1]
          Length = 113

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/103 (43%), Positives = 59/103 (57%), Gaps = 3/103 (2%)

Query: 26  VSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLIV 85
           +SPQK  L+A  IRG  V  A+A L  S  + A    K L SA+ANAE NH LDVD L V
Sbjct: 14  ISPQKAGLMADAIRGLNVDRAIAVLALSPTKSARLYEKVLKSAIANAEQNHGLDVDALFV 73

Query: 86  SEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           SEA     + +KRF  +G   +GR+ + F R + +   VS+ G
Sbjct: 74  SEAKADAGMTLKRFRPKG---MGRMRKRFHRHSHLTVSVSERG 113


>gi|299830604|ref|YP_003735052.1| 50S ribosomal protein L22 [Durinskia baltica]
 gi|297384968|gb|ADI40267.1| 50S ribosomal protein L22 [Durinskia baltica]
          Length = 115

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 65/107 (60%)

Query: 19  AIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDL 78
           A+A  +R+SP K+  V   IRG+   +AL  LEF   +  G + + + SA ANA++N+ L
Sbjct: 9   AVAKYIRMSPHKIRRVIDQIRGRSYQEALMILEFLPYQAGGPIWQVVHSAAANAKHNYGL 68

Query: 79  DVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVS 125
           D  +L+++E +  +   +KR   R + R  +I++P   +TV+++E++
Sbjct: 69  DKKKLVINEIFADEGPKLKRIRPRAQGRAYKILKPTCHITVVMKEIN 115


>gi|254785084|ref|YP_003072512.1| 50S ribosomal protein L22 [Teredinibacter turnerae T7901]
 gi|259646259|sp|C5BQ66|RL22_TERTT RecName: Full=50S ribosomal protein L22
 gi|237686963|gb|ACR14227.1| ribosomal protein L22 [Teredinibacter turnerae T7901]
          Length = 110

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 47/105 (44%), Positives = 62/105 (59%), Gaps = 3/105 (2%)

Query: 20  IASMLR---VSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           +A+ LR   +S QK  LVA  IRGK V +AL  L FS K+ A  ++K L SA+ANAE+N 
Sbjct: 3   VAAKLRGAGLSAQKARLVADQIRGKSVEEALDLLAFSTKKGAAVIKKVLESAIANAEHNE 62

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
             DVD L VS  +V + + MKR   R + R  RI +    +TV V
Sbjct: 63  GADVDELKVSTIFVDEGLTMKRIRPRAKGRADRIFKRTCHITVKV 107


>gi|221194620|ref|ZP_03567677.1| ribosomal protein L22 [Atopobium rimae ATCC 49626]
 gi|221185524|gb|EEE17914.1| ribosomal protein L22 [Atopobium rimae ATCC 49626]
          Length = 120

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/106 (41%), Positives = 61/106 (57%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A A  +RV+P+K   V A++RGK V  AL  L+FS +  A ++ K L SAVANAE N
Sbjct: 9   EVRATAKYVRVAPRKARTVIALVRGKSVEKALEILQFSTRAAAVDIAKVLRSAVANAEYN 68

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           + L    L+V  AYV +   +KR   R +    RI +  S +TV+V
Sbjct: 69  NHLHARDLVVKYAYVDEGPTLKRIRPRAKGSASRINKRMSHITVVV 114


>gi|330718967|ref|ZP_08313567.1| 50S ribosomal protein L22 [Leuconostoc fallax KCTC 3537]
          Length = 118

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 63/107 (58%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A A ++RV+P+K  LV   +R K V++A A L+F     + ++ K L SAVANAENN 
Sbjct: 8   ARATAKIVRVAPRKARLVLDTLRRKSVNEAFAILQFLPNTSSEDIYKVLNSAVANAENNF 67

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            LD + LIV EA+  +   +KRF  R +     I +  S +T++V E
Sbjct: 68  SLDREDLIVKEAFANEGPTLKRFRPRAKGSASPINKRTSHITIVVAE 114


>gi|310829580|ref|YP_003961937.1| ribosomal protein L22 [Eubacterium limosum KIST612]
 gi|308741314|gb|ADO38974.1| ribosomal protein L22 [Eubacterium limosum KIST612]
          Length = 114

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 64/108 (59%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A  +RVS +K  LVA +IRGK + +AL+ L  +  + A    K + SA+ANAENN
Sbjct: 2   EARATAKYVRVSSRKAKLVADLIRGKSLGEALSILALTPNKAAKITEKVVKSALANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           H++D ++L + + Y  +   +KR+    + R   I +  S +T +++E
Sbjct: 62  HNMDPEKLYIDQIYADQGPTLKRYKAGPQGRAFPIKKRTSHITAVLKE 109


>gi|296113792|ref|YP_003627730.1| 50S ribosomal protein L22 [Moraxella catarrhalis RH4]
 gi|295921486|gb|ADG61837.1| 50S ribosomal protein L22 [Moraxella catarrhalis RH4]
 gi|326562137|gb|EGE12465.1| 50S ribosomal protein L22 [Moraxella catarrhalis 7169]
 gi|326564498|gb|EGE14724.1| 50S ribosomal protein L22 [Moraxella catarrhalis 46P47B1]
 gi|326565681|gb|EGE15844.1| 50S ribosomal protein L22 [Moraxella catarrhalis 12P80B1]
 gi|326566250|gb|EGE16402.1| 50S ribosomal protein L22 [Moraxella catarrhalis 103P14B1]
 gi|326567098|gb|EGE17220.1| 50S ribosomal protein L22 [Moraxella catarrhalis BC1]
 gi|326568362|gb|EGE18442.1| 50S ribosomal protein L22 [Moraxella catarrhalis BC7]
 gi|326572263|gb|EGE22258.1| 50S ribosomal protein L22 [Moraxella catarrhalis BC8]
 gi|326574605|gb|EGE24545.1| 50S ribosomal protein L22 [Moraxella catarrhalis O35E]
 gi|326574861|gb|EGE24791.1| 50S ribosomal protein L22 [Moraxella catarrhalis 101P30B1]
 gi|326576185|gb|EGE26100.1| 50S ribosomal protein L22 [Moraxella catarrhalis CO72]
          Length = 109

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/98 (43%), Positives = 61/98 (62%)

Query: 26  VSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLIV 85
           +S QK+ LVA  +RGK +  AL  L FS K+ A  V+K L SA+ANAE+N+ LD+D+L V
Sbjct: 12  ISAQKVRLVADEVRGKPIERALDILTFSNKKGAKLVKKCLDSAIANAEHNNGLDIDKLRV 71

Query: 86  SEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           +  YV + + +KR   R + R  RI +    +TV V E
Sbjct: 72  TTIYVDEGITLKRIMPRAKGRADRISKRTCHITVKVGE 109


>gi|225024795|ref|ZP_03713987.1| hypothetical protein EIKCOROL_01682 [Eikenella corrodens ATCC
           23834]
 gi|224942502|gb|EEG23711.1| hypothetical protein EIKCOROL_01682 [Eikenella corrodens ATCC
           23834]
          Length = 109

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 56/97 (57%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R+S QK  LVA +IRGK V  AL  L FS K+ A  ++K L SA+ANAE+N   D+D L 
Sbjct: 11  RISAQKARLVADLIRGKEVEQALNILTFSTKKGAELIKKVLESAIANAEHNEGADIDELK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           V   +V K   +KRF  R + R  RI +    + V V
Sbjct: 71  VVTIFVDKGPSLKRFRARAKGRGNRIEKQTCHINVTV 107


>gi|120553657|ref|YP_958008.1| 50S ribosomal protein L22 [Marinobacter aquaeolei VT8]
 gi|166199506|sp|A1TYK2|RL22_MARAV RecName: Full=50S ribosomal protein L22
 gi|120323506|gb|ABM17821.1| LSU ribosomal protein L22P [Marinobacter aquaeolei VT8]
          Length = 110

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 57/97 (58%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R+S QK  LVA  +RGK V DAL  L FS K+ A  ++K L SA+ANAE+N  LDVD L 
Sbjct: 11  RLSAQKARLVADQVRGKAVEDALNILTFSPKKAAVVIKKALESAIANAEHNEGLDVDDLR 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           VS   V +   +KR   R + R  RI +    +TV V
Sbjct: 71  VSTVMVDEGPTLKRIKARAKGRADRIFKRTCHITVKV 107


>gi|257095035|ref|YP_003168676.1| 50S ribosomal protein L22 [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
 gi|257047559|gb|ACV36747.1| ribosomal protein L22 [Candidatus Accumulibacter phosphatis clade
           IIA str. UW-1]
          Length = 109

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 60/106 (56%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A+   +R+S QK  LVA  IRG  V  AL+ L FS K+ A  ++K L SA+ANAE+N
Sbjct: 2   ETRAVLRGVRLSSQKGRLVADQIRGLPVDRALSILTFSPKKGAAIIKKVLESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L V    V K   +KRF  R + R  RIV+P   + + V
Sbjct: 62  DGADIDELTVKTICVEKGTVLKRFTARAKGRGNRIVKPTCHVFLTV 107


>gi|91791544|ref|YP_561195.1| 50S ribosomal protein L22 [Shewanella denitrificans OS217]
 gi|123166586|sp|Q12SV4|RL22_SHEDO RecName: Full=50S ribosomal protein L22
 gi|91713546|gb|ABE53472.1| LSU ribosomal protein L22P [Shewanella denitrificans OS217]
          Length = 110

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 57/97 (58%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R S QK  LVA  IRG  VS AL  L FS K+ A  V+K L SA+ANAE+N   D+D L 
Sbjct: 11  RTSAQKARLVADQIRGLPVSKALEILTFSPKKAAVLVKKVLDSAIANAEHNEGADIDELR 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           V   +V +   MKR   R + R  RI++  S +TV+V
Sbjct: 71  VGAVFVDEGPTMKRIMPRAKGRADRIMKRTSHITVVV 107


>gi|153854975|ref|ZP_01996188.1| hypothetical protein DORLON_02194 [Dorea longicatena DSM 13814]
 gi|167759857|ref|ZP_02431984.1| hypothetical protein CLOSCI_02220 [Clostridium scindens ATCC 35704]
 gi|225571558|ref|ZP_03780554.1| hypothetical protein CLOHYLEM_07656 [Clostridium hylemonae DSM
           15053]
 gi|149752472|gb|EDM62403.1| hypothetical protein DORLON_02194 [Dorea longicatena DSM 13814]
 gi|167662476|gb|EDS06606.1| hypothetical protein CLOSCI_02220 [Clostridium scindens ATCC 35704]
 gi|225159635|gb|EEG72254.1| hypothetical protein CLOHYLEM_07656 [Clostridium hylemonae DSM
           15053]
          Length = 128

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 47/124 (37%), Positives = 68/124 (54%), Gaps = 3/124 (2%)

Query: 3   GKRSVSKRRMG---DNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAG 59
           G RS  KR      D   +A  S  RVS QK   V   IRGK V+ AL  L ++ +  + 
Sbjct: 4   GHRSQIKRERNANKDTRPSAKLSYARVSVQKACFVLDAIRGKDVTTALGILTYNPRYASS 63

Query: 60  EVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTV 119
            ++K L SA+ANAENN+ ++ + L ++EAY  K   MKR   R + R  RI +  S +T+
Sbjct: 64  LIKKLLESAIANAENNNGMNAENLYIAEAYANKGPTMKRIRPRAQGRAYRIEKRMSHITL 123

Query: 120 IVRE 123
           ++ E
Sbjct: 124 VLDE 127


>gi|171913920|ref|ZP_02929390.1| ribosomal protein L22 [Verrucomicrobium spinosum DSM 4136]
          Length = 129

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/106 (41%), Positives = 59/106 (55%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  ++    R+S QK   VA  I+G  VS AL+ L F+ K+ A  + K L SAVANAENN
Sbjct: 2   EVKSVLKYARISDQKAREVARAIQGMPVSQALSVLNFTPKKAALLIGKALRSAVANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           H++D D L V  A   K   +KR   R R   G I +  S +T+I+
Sbjct: 62  HEMDADELFVKSATATKGPVLKRIMPRARGSAGGIKKRMSHITLIL 107


>gi|126680606|gb|ABO26529.1| ribosomal protein L22 [Pigeon pea witches'-broom phytoplasma]
          Length = 126

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/111 (38%), Positives = 62/111 (55%)

Query: 19  AIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDL 78
           AIA  + ++P+K  LVA +IRGK + +A A L F+ K  +  V K L SA+ANA NN  L
Sbjct: 5   AIAKQMPITPRKTRLVADLIRGKNIKEAQAILMFTPKSASSIVLKLLKSAIANATNNFSL 64

Query: 79  DVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEGK 129
           D   L V E +V + + + R   R + R  RI +  S +T++V     E K
Sbjct: 65  DDKNLYVKEIFVNEGLRLTRLFPRAKGRADRIKKRTSHITIVVAPQLSENK 115


>gi|42561265|ref|NP_975716.1| 50S ribosomal protein L22 [Mycoplasma mycoides subsp. mycoides SC
           str. PG1]
 gi|51316232|sp|Q6MSN0|RL22_MYCMS RecName: Full=50S ribosomal protein L22
 gi|42492763|emb|CAE77358.1| 50S RIBOSOMAL PROTEIN L22 [Mycoplasma mycoides subsp. mycoides SC
           str. PG1]
 gi|301321272|gb|ADK69915.1| ribosomal protein L22 [Mycoplasma mycoides subsp. mycoides SC str.
           Gladysdale]
          Length = 111

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 48/112 (42%), Positives = 64/112 (57%), Gaps = 3/112 (2%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A  SM+R+SP+K+ LVA  IR K V  A+A L+   K  A  + K L SAVANA NN
Sbjct: 2   EAKAKLSMIRISPRKMRLVADTIRNKAVLVAVATLKNLNKDAAEPILKLLNSAVANAVNN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           + ++ D+L V   +V +   +KRF  R     GR    F R + +V  VSDE
Sbjct: 62  NGMEADKLYVKTIFVNEGPTLKRFRPRAH---GRAYEIFKRTSHVVIVVSDE 110


>gi|125975389|ref|YP_001039299.1| 50S ribosomal protein L22P [Clostridium thermocellum ATCC 27405]
 gi|281419351|ref|ZP_06250366.1| ribosomal protein L22 [Clostridium thermocellum JW20]
 gi|215274820|sp|A3DJH7|RL22_CLOTH RecName: Full=50S ribosomal protein L22
 gi|125715614|gb|ABN54106.1| LSU ribosomal protein L22P [Clostridium thermocellum ATCC 27405]
 gi|281406971|gb|EFB37234.1| ribosomal protein L22 [Clostridium thermocellum JW20]
          Length = 125

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 71/125 (56%)

Query: 1   MSGKRSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGE 60
           M  KR   +  +G ++  AI    R+SP+K+ +V  +I+GK + +A A L ++ K  +  
Sbjct: 1   MLTKREKKELGIGKDQGKAILRYARISPRKVRIVLDLIKGKDIDEAYAILRYTPKAASSI 60

Query: 61  VRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVI 120
           + K L SA ANA NN+ L+ D L V+EAY  +   +KR   R R    RI +  S +T++
Sbjct: 61  LFKLLKSAEANATNNNGLNRDNLYVAEAYADQGPTLKRILPRARGSADRIRKRTSHITLV 120

Query: 121 VREVS 125
           V+E S
Sbjct: 121 VKERS 125


>gi|170017938|ref|YP_001728857.1| ribosomal protein L22 [Leuconostoc citreum KM20]
 gi|296111434|ref|YP_003621816.1| ribosomal protein L22 [Leuconostoc kimchii IMSNU 11154]
 gi|300174026|ref|YP_003773192.1| 50S ribosomal protein L22 [Leuconostoc gasicomitatum LMG 18811]
 gi|326692232|ref|ZP_08229237.1| 50S ribosomal protein L22 [Leuconostoc argentinum KCTC 3773]
 gi|226733482|sp|B1MW09|RL22_LEUCK RecName: Full=50S ribosomal protein L22
 gi|169804795|gb|ACA83413.1| Ribosomal protein L22 [Leuconostoc citreum KM20]
 gi|295832966|gb|ADG40847.1| ribosomal protein L22 [Leuconostoc kimchii IMSNU 11154]
 gi|299888405|emb|CBL92373.1| 50S ribosomal protein L22 [Leuconostoc gasicomitatum LMG 18811]
          Length = 118

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 62/107 (57%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A A ++RV+P+K  LV   IR K V++A A L+F       ++ K L SAVANAENN 
Sbjct: 8   ARATAKIVRVAPRKARLVLDTIRRKSVNEAYAILKFLPNTSTEDIYKVLNSAVANAENNF 67

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            LD + LIV EA+  +   +KRF  R +     I +  S +T++V E
Sbjct: 68  SLDREDLIVKEAFANEGPTLKRFRPRAKGSASPINKRTSHITIVVAE 114


>gi|118411196|ref|YP_874590.1| 50S ribosomal protein L22 [Thalassiosira pseudonana]
 gi|125987559|sp|A0T0X8|RK22_THAPS RecName: Full=50S ribosomal protein L22, chloroplastic
 gi|116739943|gb|ABK20813.1| 50S ribosomal protein L22 [Thalassiosira pseudonana]
          Length = 115

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 62/107 (57%)

Query: 19  AIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDL 78
           A+A  +R+SP K+  V   IRG+   +AL  LEF        + + + S  ANA+NN++L
Sbjct: 9   AVAKYVRISPHKVRQVLDQIRGRSYQEALMILEFLPYDAGSPIWQVVHSVAANAKNNYNL 68

Query: 79  DVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVS 125
           D  +L++SE +  +   +KR   R + R  +I++P   +TV+V+ +S
Sbjct: 69  DKKKLVISEIFADEGPKLKRIRPRAQGRAYKILKPTCHITVVVKSIS 115


>gi|148377804|ref|YP_001256680.1| 50S ribosomal protein L22 [Mycoplasma agalactiae PG2]
 gi|291320501|ref|YP_003515765.1| 50S ribosomal protein L22 [Mycoplasma agalactiae]
 gi|215274837|sp|A5IYY1|RL22_MYCAP RecName: Full=50S ribosomal protein L22
 gi|148291850|emb|CAL59240.1| 50S ribosomal protein L22 [Mycoplasma agalactiae PG2]
 gi|290752836|emb|CBH40811.1| 50S ribosomal protein L22 [Mycoplasma agalactiae]
          Length = 114

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/112 (36%), Positives = 61/112 (54%)

Query: 12  MGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVAN 71
           M +  A A+  + R+SP+K  LVA + RGK V  AL  L  + K+ +    K L SA+AN
Sbjct: 1   MNNQSAKAVVKIQRISPRKARLVADLFRGKDVKVALGILNNTNKKASQLFIKLLNSAIAN 60

Query: 72  AENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           A NNH +D  +L V E  V +   +KR+  R + R   I +  S L++ + E
Sbjct: 61  ATNNHGMDASKLFVKEVLVNEGPTLKRYQPRSQGRAYSIFKRTSNLSITLEE 112


>gi|315925251|ref|ZP_07921465.1| 50S ribosomal protein L22 [Pseudoramibacter alactolyticus ATCC
           23263]
 gi|315621485|gb|EFV01452.1| 50S ribosomal protein L22 [Pseudoramibacter alactolyticus ATCC
           23263]
          Length = 114

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 63/108 (58%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A  +RVS +K  LVA  IRGK V +AL+ L+ +  + A  + K + SA ANAENN
Sbjct: 2   EAKATAKYVRVSSRKAKLVADAIRGKSVGEALSVLQLTPNKAARMIEKVVLSAYANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           H+++ D L + +    +   +KR+    + R   I +  S LTV+++E
Sbjct: 62  HNMNTDTLYIHQISANQGPTLKRWKAGPQGRAFPIKKRTSVLTVVLKE 109


>gi|172038932|ref|YP_001805433.1| 50S ribosomal protein L22 [Cyanothece sp. ATCC 51142]
 gi|254800432|sp|B1WQR5|RL22_CYAA5 RecName: Full=50S ribosomal protein L22
 gi|171700386|gb|ACB53367.1| 50S ribosomal protein L22 [Cyanothece sp. ATCC 51142]
          Length = 120

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 60/107 (56%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
            EA AIA  +R+SP K+  V   IRG+   +AL  LEF   R    + K L SAVANAE+
Sbjct: 7   TEAKAIARYIRMSPFKVRRVLDQIRGRSYREALIILEFMPYRACEPILKLLRSAVANAEH 66

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           N  LD   L+VS+AY      ++R+  R + R  +I +P   +T+ V
Sbjct: 67  NQGLDPTTLVVSQAYADGGPSLRRYRPRAQGRAYQIRKPTCHITIAV 113


>gi|121511595|gb|ABM55291.1| ribosomal protein L22 [Pigeon pea witches'-broom phytoplasma]
 gi|121511598|gb|ABM55293.1| ribosomal protein L22 [Pigeon pea witches'-broom phytoplasma]
 gi|121511601|gb|ABM55295.1| ribosomal protein L22 [Pigeon pea witches'-broom phytoplasma]
 gi|124494166|gb|ABN13126.1| ribosomal protein L22 [Rhynchosia little leaf phytoplasma]
 gi|124494169|gb|ABN13128.1| ribosomal protein L22 [Gliricidia little leaf phytoplasma]
          Length = 126

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 43/111 (38%), Positives = 62/111 (55%)

Query: 19  AIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDL 78
           AIA  + ++P+K  LVA +IRGK + +A A L F+ K  +  V K L SA+ANA NN  L
Sbjct: 5   AIAKQMPITPRKTRLVADLIRGKNIKEAQAILMFTPKSASPIVLKLLKSAIANATNNFSL 64

Query: 79  DVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEGK 129
           D   L V E +V + + + R   R + R  RI +  S +T++V     E K
Sbjct: 65  DDKNLYVKEIFVNEGLRLTRLFPRAKGRADRIKKRTSHITIVVAPQLSENK 115


>gi|21223087|ref|NP_628866.1| 50S ribosomal protein L22 [Streptomyces coelicolor A3(2)]
 gi|7321297|emb|CAB82075.1| 50S ribosomal protein L22 [Streptomyces coelicolor A3(2)]
          Length = 125

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 66/114 (57%), Gaps = 3/114 (2%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A  +RV+P K   V  +IRG   ++A A L F+ +  +  V K L SA+ANA +N
Sbjct: 12  EARAQARYIRVTPMKARRVVDLIRGMDATEAQAVLRFAPQAASVPVGKVLDSAIANAAHN 71

Query: 76  HD-LDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           +D  D D L +SEAYV +   +KRF  R + R  RI +  S +TV+V   S EG
Sbjct: 72  YDHTDADSLFISEAYVDEGPTLKRFRPRAQGRAYRIRKRTSHITVVVS--SKEG 123


>gi|269837071|ref|YP_003319299.1| 50S ribosomal protein L22 [Sphaerobacter thermophilus DSM 20745]
 gi|269786334|gb|ACZ38477.1| ribosomal protein L22 [Sphaerobacter thermophilus DSM 20745]
          Length = 114

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 49/109 (44%), Positives = 66/109 (60%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A A  LRVSP+K  LV  M+RGK V +ALA L F   + A  V K + SA ANAE+N
Sbjct: 2   EVMAKARGLRVSPRKARLVVDMVRGKSVPEALAILRFVPNKSAEYVAKVVKSAAANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV 124
           HDLD DRL + + Y  +    +R+  R R R+ R ++  + +TVIV E+
Sbjct: 62  HDLDPDRLYIKQIYADEGPTYRRWRARARGRVNRRLKRTAHITVIVDEM 110


>gi|224827022|ref|ZP_03700119.1| ribosomal protein L22 [Lutiella nitroferrum 2002]
 gi|224600688|gb|EEG06874.1| ribosomal protein L22 [Lutiella nitroferrum 2002]
          Length = 109

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 60/100 (60%)

Query: 22  SMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVD 81
           + +R+S QK  LVA +IRGK V  AL  L FS K+ A  V+K L SA+ANAE+N   D+D
Sbjct: 8   NTVRLSAQKCRLVADLIRGKSVDQALNILAFSPKKGAVIVKKVLESAIANAEHNEGADID 67

Query: 82  RLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
            L V+  +V K   +KRF  R + R  RI +    +T+ V
Sbjct: 68  TLKVAAIFVDKGPSLKRFAARAKGRGNRIEKQTCHITLTV 107


>gi|27904937|ref|NP_778063.1| 50S ribosomal protein L22 [Buchnera aphidicola str. Bp (Baizongia
           pistaciae)]
 gi|29839492|sp|P59558|RL22_BUCBP RecName: Full=50S ribosomal protein L22
 gi|27904335|gb|AAO27168.1| 50S ribosomal protein L22 [Buchnera aphidicola str. Bp (Baizongia
           pistaciae)]
          Length = 119

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 63/108 (58%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A  S  R S QKL LVA +IRGK +  AL  L F  K+ +  V+K L SA++NAE+N
Sbjct: 2   ETIARHSQARSSAQKLRLVADLIRGKNIEHALNILTFCNKKASILVKKVLKSAISNAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           H  D++ L V +  + +   MKR   R + R  RI++  S +T++V +
Sbjct: 62  HGSDINNLQVKKILIDEGPTMKRMMPRAKGRSDRILKRTSHITIVVSD 109


>gi|206896208|ref|YP_002247330.1| ribosomal protein L22 [Coprothermobacter proteolyticus DSM 5265]
 gi|206738825|gb|ACI17903.1| ribosomal protein L22 [Coprothermobacter proteolyticus DSM 5265]
          Length = 114

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 63/107 (58%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A A  +R+SP+K  LV   IR K VS+A A L++S  + A    K L SAVANA NN+
Sbjct: 7   AKATAKYVRISPRKARLVVDEIRNKSVSEARAILKYSPNKAARFTLKVLNSAVANAVNNN 66

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            LD +RL V   +V +   +KR++ R   R   + R  S +TVIV+E
Sbjct: 67  GLDEERLYVYRVFVDEGPRLKRYYPRAFGRADIMKRRLSHITVIVKE 113


>gi|24371834|ref|NP_715876.1| 50S ribosomal protein L22 [Shewanella oneidensis MR-1]
 gi|113968549|ref|YP_732342.1| 50S ribosomal protein L22 [Shewanella sp. MR-4]
 gi|114045712|ref|YP_736262.1| 50S ribosomal protein L22 [Shewanella sp. MR-7]
 gi|117918662|ref|YP_867854.1| 50S ribosomal protein L22 [Shewanella sp. ANA-3]
 gi|120596994|ref|YP_961568.1| 50S ribosomal protein L22 [Shewanella sp. W3-18-1]
 gi|126176350|ref|YP_001052499.1| 50S ribosomal protein L22 [Shewanella baltica OS155]
 gi|146294836|ref|YP_001185260.1| 50S ribosomal protein L22 [Shewanella putrefaciens CN-32]
 gi|152998754|ref|YP_001364435.1| 50S ribosomal protein L22 [Shewanella baltica OS185]
 gi|160873331|ref|YP_001552647.1| 50S ribosomal protein L22 [Shewanella baltica OS195]
 gi|217975196|ref|YP_002359947.1| 50S ribosomal protein L22 [Shewanella baltica OS223]
 gi|304412770|ref|ZP_07394372.1| ribosomal protein L22 [Shewanella baltica OS183]
 gi|307307434|ref|ZP_07587169.1| ribosomal protein L22 [Shewanella baltica BA175]
 gi|51316853|sp|Q8EK63|RL22_SHEON RecName: Full=50S ribosomal protein L22
 gi|122944223|sp|Q0HNT2|RL22_SHESM RecName: Full=50S ribosomal protein L22
 gi|123031027|sp|Q0I0A0|RL22_SHESR RecName: Full=50S ribosomal protein L22
 gi|166221993|sp|A3DA67|RL22_SHEB5 RecName: Full=50S ribosomal protein L22
 gi|166221994|sp|A6WHT3|RL22_SHEB8 RecName: Full=50S ribosomal protein L22
 gi|166221996|sp|A4YBX8|RL22_SHEPC RecName: Full=50S ribosomal protein L22
 gi|166221997|sp|A0KRM9|RL22_SHESA RecName: Full=50S ribosomal protein L22
 gi|166221998|sp|A1REB9|RL22_SHESW RecName: Full=50S ribosomal protein L22
 gi|189041965|sp|A9KWA7|RL22_SHEB9 RecName: Full=50S ribosomal protein L22
 gi|254800458|sp|B8EBK0|RL22_SHEB2 RecName: Full=50S ribosomal protein L22
 gi|24345647|gb|AAN53321.1|AE015473_8 ribosomal protein L22 [Shewanella oneidensis MR-1]
 gi|113883233|gb|ABI37285.1| LSU ribosomal protein L22P [Shewanella sp. MR-4]
 gi|113887154|gb|ABI41205.1| LSU ribosomal protein L22P [Shewanella sp. MR-7]
 gi|117610994|gb|ABK46448.1| LSU ribosomal protein L22P [Shewanella sp. ANA-3]
 gi|120557087|gb|ABM23014.1| LSU ribosomal protein L22P [Shewanella sp. W3-18-1]
 gi|125999555|gb|ABN63630.1| LSU ribosomal protein L22P [Shewanella baltica OS155]
 gi|145566526|gb|ABP77461.1| LSU ribosomal protein L22P [Shewanella putrefaciens CN-32]
 gi|151363372|gb|ABS06372.1| ribosomal protein L22 [Shewanella baltica OS185]
 gi|160858853|gb|ABX47387.1| ribosomal protein L22 [Shewanella baltica OS195]
 gi|217500331|gb|ACK48524.1| ribosomal protein L22 [Shewanella baltica OS223]
 gi|304348850|gb|EFM13266.1| ribosomal protein L22 [Shewanella baltica OS183]
 gi|306910222|gb|EFN40655.1| ribosomal protein L22 [Shewanella baltica BA175]
 gi|315265558|gb|ADT92411.1| ribosomal protein L22 [Shewanella baltica OS678]
 gi|319424585|gb|ADV52659.1| ribosomal protein L22 [Shewanella putrefaciens 200]
          Length = 110

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 58/99 (58%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R S QK  LVA  IRG  V+ AL  L FS K+ A  V+K L SA+ANAE+N   D+D L 
Sbjct: 11  RTSAQKARLVADQIRGLPVAKALEILTFSPKKAAVLVKKVLDSAIANAEHNEGADIDELK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           V   +V +   MKR   R + R  RI++  S +TV+V +
Sbjct: 71  VGAVFVDEGPTMKRIMPRAKGRADRIMKRTSHITVVVSD 109


>gi|307154837|ref|YP_003890221.1| 50S ribosomal protein L22 [Cyanothece sp. PCC 7822]
 gi|306985065|gb|ADN16946.1| ribosomal protein L22 [Cyanothece sp. PCC 7822]
          Length = 122

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 61/107 (57%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
           NE  AIA  +R+SP K+  V   IRG+   +AL  LEF   R    + K L SAVANAE+
Sbjct: 9   NEVKAIARYVRMSPYKVRRVLDQIRGRTYQEALIILEFMPYRACDPILKVLRSAVANAEH 68

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           N+ LD   L++S+AY      ++R+  R + R  +I +P   +T+ V
Sbjct: 69  NNGLDRATLVISKAYADGGPSLRRYRARAQGRAYQIRKPTCHITISV 115


>gi|284053308|ref|ZP_06383518.1| 50S ribosomal protein L22 [Arthrospira platensis str. Paraca]
 gi|291567789|dbj|BAI90061.1| 50S ribosomal protein L22 [Arthrospira platensis NIES-39]
          Length = 117

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 59/107 (55%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
           +E  AIA  +R+SP K+  V   IRG+   +AL  LEF   R    V K L SAVANAE+
Sbjct: 7   SEVKAIARYIRMSPLKVRRVLDQIRGRSYREALIILEFMPYRACTPVLKVLRSAVANAEH 66

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           N  LD   LIVS+A+      +KR+  R + R   I +P   +TV V
Sbjct: 67  NQGLDPATLIVSQAFADAGPSLKRYRPRAQGRAYPIRKPTCHITVTV 113


>gi|302558989|ref|ZP_07311331.1| 50S ribosomal protein L22 [Streptomyces griseoflavus Tu4000]
 gi|302476607|gb|EFL39700.1| 50S ribosomal protein L22 [Streptomyces griseoflavus Tu4000]
          Length = 123

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 66/114 (57%), Gaps = 3/114 (2%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A  +RV+P K   V  +IRG   ++A A L F+ +  +  V K L SA+ANA +N
Sbjct: 10  EARAQARYIRVTPMKARRVVDLIRGMDATEAQAVLRFAPQAASVPVGKVLDSAIANAAHN 69

Query: 76  HD-LDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           +D  D D L +SEAYV +   +KRF  R + R  RI +  S +TV+V   S EG
Sbjct: 70  YDHTDADSLYISEAYVDEGPTLKRFRPRAQGRAYRIRKRTSHITVVVS--SKEG 121


>gi|29831474|ref|NP_826108.1| 50S ribosomal protein L22 [Streptomyces avermitilis MA-4680]
 gi|256785818|ref|ZP_05524249.1| 50S ribosomal protein L22 [Streptomyces lividans TK24]
 gi|289769710|ref|ZP_06529088.1| 50S ribosomal protein L22 [Streptomyces lividans TK24]
 gi|51316804|sp|Q82DP0|RL22_STRAW RecName: Full=50S ribosomal protein L22
 gi|215273883|sp|Q9L0D5|RL22_STRCO RecName: Full=50S ribosomal protein L22
 gi|29608589|dbj|BAC72643.1| putative ribosomal protein L22 [Streptomyces avermitilis MA-4680]
 gi|289699909|gb|EFD67338.1| 50S ribosomal protein L22 [Streptomyces lividans TK24]
          Length = 115

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 66/114 (57%), Gaps = 3/114 (2%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A  +RV+P K   V  +IRG   ++A A L F+ +  +  V K L SA+ANA +N
Sbjct: 2   EARAQARYIRVTPMKARRVVDLIRGMDATEAQAVLRFAPQAASVPVGKVLDSAIANAAHN 61

Query: 76  HD-LDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           +D  D D L +SEAYV +   +KRF  R + R  RI +  S +TV+V   S EG
Sbjct: 62  YDHTDADSLFISEAYVDEGPTLKRFRPRAQGRAYRIRKRTSHITVVVS--SKEG 113


>gi|153816247|ref|ZP_01968915.1| hypothetical protein RUMTOR_02496 [Ruminococcus torques ATCC 27756]
 gi|317501779|ref|ZP_07959965.1| 50S ribosomal protein L22 [Lachnospiraceae bacterium 8_1_57FAA]
 gi|331088700|ref|ZP_08337610.1| 50S ribosomal protein L22 [Lachnospiraceae bacterium 3_1_46FAA]
 gi|145846430|gb|EDK23348.1| hypothetical protein RUMTOR_02496 [Ruminococcus torques ATCC 27756]
 gi|316896812|gb|EFV18897.1| 50S ribosomal protein L22 [Lachnospiraceae bacterium 8_1_57FAA]
 gi|330407223|gb|EGG86726.1| 50S ribosomal protein L22 [Lachnospiraceae bacterium 3_1_46FAA]
          Length = 128

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 47/124 (37%), Positives = 64/124 (51%), Gaps = 3/124 (2%)

Query: 3   GKRSVSKRRMG---DNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAG 59
           G RS  KR      D   +A  S  R+S QK   V   IRGK V  AL  L ++ +  + 
Sbjct: 4   GHRSQIKRERNEQRDTRPSAKISYARISVQKACYVLDAIRGKDVQTALGILAYNPRYASA 63

Query: 60  EVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTV 119
            + K L SA+ANAENN+ + VD L + E Y  K   MKR   R + R  RI +  S +T+
Sbjct: 64  VIEKLLKSAIANAENNNGMSVDNLYIEECYANKGPTMKRIRPRAQGRAYRIEKRMSHITI 123

Query: 120 IVRE 123
           ++ E
Sbjct: 124 VLNE 127


>gi|160902251|ref|YP_001567832.1| ribosomal protein L22 [Petrotoga mobilis SJ95]
 gi|215274848|sp|A9BHA0|RL22_PETMO RecName: Full=50S ribosomal protein L22
 gi|160359895|gb|ABX31509.1| ribosomal protein L22 [Petrotoga mobilis SJ95]
          Length = 149

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 63/110 (57%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A+   +R+SP+K   +A  IR K +S+AL  L FS K+ A  + KTL SA+ANAENN
Sbjct: 37  EARAVTKYVRISPRKARSMANSIRNKDISEALQILTFSPKKSARILYKTLMSAIANAENN 96

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVS 125
             L+ + L VSE  V +   +KR   R   R   + +  S + + VR+ S
Sbjct: 97  FGLNAENLYVSEIMVNEGPRLKRLWPRSHGRADILQKRMSHIYITVRDKS 146


>gi|313678370|ref|YP_004056110.1| 50S ribosomal protein L22 [Mycoplasma bovis PG45]
 gi|312950396|gb|ADR24991.1| ribosomal protein L22 [Mycoplasma bovis PG45]
          Length = 114

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 41/112 (36%), Positives = 61/112 (54%)

Query: 12  MGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVAN 71
           M   +A A+  + R+SP+K  LVA + RGK V  AL  L  + K+ +    K L SA+AN
Sbjct: 1   MSTQQAKAVVKIQRISPRKARLVADLFRGKDVKVALGILNNTNKKASQLFIKLLNSAIAN 60

Query: 72  AENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           A NNH +D  +L V E  V +   +KR+  R + R   I +  S L++ + E
Sbjct: 61  ATNNHGMDASKLFVKEVLVNEGPTLKRYQPRSQGRAYSIFKRTSNLSIALEE 112


>gi|323144969|ref|ZP_08079529.1| ribosomal protein L22 [Succinatimonas hippei YIT 12066]
 gi|322415248|gb|EFY06022.1| ribosomal protein L22 [Succinatimonas hippei YIT 12066]
          Length = 111

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 46/108 (42%), Positives = 59/108 (54%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A+    R S QK  LVA  +RG  V  AL  L+FS ++ A  + K + SAV+NAE N
Sbjct: 3   EVKAVHRYARSSAQKTRLVADQVRGMPVDKALNLLKFSPRKAAQLIYKVVQSAVSNAEQN 62

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
             LD DRL VS   V +   +KR   R + R  RIV+  S +TV V E
Sbjct: 63  QSLDADRLFVSRILVDEGPSLKRIMPRAKGRADRIVKRTSHITVYVAE 110


>gi|94676478|ref|YP_588781.1| ribosomal protein L22 [Baumannia cicadellinicola str. Hc
           (Homalodisca coagulata)]
 gi|123260549|sp|Q1LTD3|RL22_BAUCH RecName: Full=50S ribosomal protein L22
 gi|94219628|gb|ABF13787.1| ribosomal protein L22 [Baumannia cicadellinicola str. Hc
           (Homalodisca coagulata)]
          Length = 110

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 60/97 (61%)

Query: 27  SPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLIVS 86
           S QKL LV  +IRGK VS AL  L ++ K+ A  V+K L SA+ANAE+N   DVD L ++
Sbjct: 13  SAQKLRLVINLIRGKEVSKALEILTYTNKKAANLVKKVLESAIANAEHNDGADVDDLKIA 72

Query: 87  EAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           + +V     +KR   R + R+  I++  S +TV+V +
Sbjct: 73  KIFVDVGPSIKRIMPRAKGRVDHILKRTSHITVVVSD 109


>gi|210611130|ref|ZP_03288744.1| hypothetical protein CLONEX_00934 [Clostridium nexile DSM 1787]
 gi|331091662|ref|ZP_08340496.1| 50S ribosomal protein L22 [Lachnospiraceae bacterium 2_1_46FAA]
 gi|210152117|gb|EEA83124.1| hypothetical protein CLONEX_00934 [Clostridium nexile DSM 1787]
 gi|330403419|gb|EGG82978.1| 50S ribosomal protein L22 [Lachnospiraceae bacterium 2_1_46FAA]
          Length = 128

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 47/124 (37%), Positives = 66/124 (53%), Gaps = 3/124 (2%)

Query: 3   GKRSVSKRRMG---DNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAG 59
           G RS  KR      D   +A  S  RVS QK   V   IRGK V  AL  L ++ +  + 
Sbjct: 4   GHRSQIKRERNANKDTRPSAKLSYARVSVQKACFVLDAIRGKDVQTALGILTYNPRYASS 63

Query: 60  EVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTV 119
            ++K L SA+ANAENN+ ++V+ L + E Y  K   MKR   R + R  RI +  S +T+
Sbjct: 64  LIKKLLESAIANAENNNGMNVENLYIEECYANKGPTMKRIKPRAQGRAYRIEKRMSHITL 123

Query: 120 IVRE 123
           ++ E
Sbjct: 124 VLNE 127


>gi|300309461|ref|YP_003773553.1| 50S ribosomal protein L22 [Herbaspirillum seropedicae SmR1]
 gi|300072246|gb|ADJ61645.1| 50S ribosomal subunit L22 protein [Herbaspirillum seropedicae SmR1]
          Length = 110

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 59/106 (55%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A    + +S QK  LVA +IRGK+V  AL  L FS K+ A  ++K L SA+ANAE+N
Sbjct: 3   ETKATLRGVHLSAQKGRLVADLIRGKKVDQALNILAFSPKKGAVIIKKVLESAIANAEHN 62

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L V   YV K   +KRF  R + R  RI +    + V V
Sbjct: 63  DGADIDELKVKTIYVEKGAVLKRFTARAKGRGDRISKQSCHIYVTV 108


>gi|257454052|ref|ZP_05619326.1| ribosomal protein L22 [Enhydrobacter aerosaccus SK60]
 gi|257448530|gb|EEV23499.1| ribosomal protein L22 [Enhydrobacter aerosaccus SK60]
          Length = 109

 Score = 71.6 bits (174), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 59/96 (61%)

Query: 26  VSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLIV 85
           +S QK+ LVA  +RGK +  AL  L FS K+ A  V+K L SA+ANAE+N+ LD+D L V
Sbjct: 12  ISAQKVRLVADEVRGKSIERALDILTFSNKKAAKLVKKCLESAIANAEHNNGLDIDTLRV 71

Query: 86  SEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           S  YV + + +KR   R + R  RI +    +TV V
Sbjct: 72  STIYVDEGITLKRVLPRAKGRADRISKRTCHITVKV 107


>gi|297625787|ref|YP_003687550.1| 50S ribosomal protein L22 [Propionibacterium freudenreichii subsp.
           shermanii CIRM-BIA1]
 gi|296921552|emb|CBL56106.1| 50S ribosomal protein L22 [Propionibacterium freudenreichii subsp.
           shermanii CIRM-BIA1]
          Length = 161

 Score = 71.6 bits (174), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 67/118 (56%), Gaps = 1/118 (0%)

Query: 12  MGDNEAN-AIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVA 70
           +GD   + AIA  +R+S QK+  VA  +RG   + A+A L F+ +  A  VRK + SAVA
Sbjct: 15  LGDRPGSYAIARHVRMSAQKVRRVADTVRGMDATQAIATLRFAPQAAAEPVRKVIESAVA 74

Query: 71  NAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           NAE +  L  ++L++S+ YV + V M+R   R +    RI++  S +T +V      G
Sbjct: 75  NAETSEGLHNEQLVISQIYVDEGVTMRRIRPRAKGSASRILKRASHITAVVEPAETAG 132


>gi|260655378|ref|ZP_05860866.1| ribosomal protein L22 [Jonquetella anthropi E3_33 E1]
 gi|260629826|gb|EEX48020.1| ribosomal protein L22 [Jonquetella anthropi E3_33 E1]
          Length = 109

 Score = 71.6 bits (174), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 52/84 (61%)

Query: 16 EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
          +A AIA  +R+SP K+  V  +IRGK VS A+  L +S K+ A  V K L SAVANA NN
Sbjct: 2  QAKAIARSVRISPFKVRQVLPLIRGKGVSAAITALHYSPKKAARLVEKVLKSAVANAANN 61

Query: 76 HDLDVDRLIVSEAYVGKSVFMKRF 99
            LDVD L V EA   +   MKRF
Sbjct: 62 LSLDVDTLKVVEATADQGPVMKRF 85


>gi|325663057|ref|ZP_08151507.1| 50S ribosomal protein L22 [Lachnospiraceae bacterium 4_1_37FAA]
 gi|331086664|ref|ZP_08335741.1| 50S ribosomal protein L22 [Lachnospiraceae bacterium 9_1_43BFAA]
 gi|325470511|gb|EGC73741.1| 50S ribosomal protein L22 [Lachnospiraceae bacterium 4_1_37FAA]
 gi|330409830|gb|EGG89265.1| 50S ribosomal protein L22 [Lachnospiraceae bacterium 9_1_43BFAA]
          Length = 128

 Score = 71.6 bits (174), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 47/124 (37%), Positives = 66/124 (53%), Gaps = 3/124 (2%)

Query: 3   GKRSVSKRRMG---DNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAG 59
           G RS  KR      D   +A  S  RVS QK   V   IRGK V  AL  L ++ +  + 
Sbjct: 4   GHRSQIKRERNANKDTRPSAKLSYARVSVQKACFVLDAIRGKDVQTALGILTYNPRYASS 63

Query: 60  EVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTV 119
            ++K L SA+ANAENN+ ++V+ L + E Y  K   MKR   R + R  RI +  S +T+
Sbjct: 64  LIKKLLESAIANAENNNGMNVENLYIEECYANKGPTMKRIRPRAQGRAYRIEKRMSHITL 123

Query: 120 IVRE 123
           ++ E
Sbjct: 124 VLNE 127


>gi|295394343|ref|ZP_06804568.1| 50S ribosomal protein L22 [Brevibacterium mcbrellneri ATCC 49030]
 gi|294972801|gb|EFG48651.1| 50S ribosomal protein L22 [Brevibacterium mcbrellneri ATCC 49030]
          Length = 124

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 67/117 (57%), Gaps = 8/117 (6%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANA--- 72
           EA A A  LRV+PQK   V  ++RG++ ++ALA L+F+ +  +  V K + S VANA   
Sbjct: 2   EAKAKARYLRVTPQKARRVVDLVRGQQATEALAVLKFAEQSASEPVYKLIASGVANARVL 61

Query: 73  --ENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
             +N    + D L +SE YV +   MKRF  R + R  RI +  S +TV+   +SDE
Sbjct: 62  ADKNGEAFNEDDLYISEIYVDEGPTMKRFRPRAQGRAFRINKRTSHITVV---LSDE 115


>gi|149376679|ref|ZP_01894438.1| 50S ribosomal protein L22 [Marinobacter algicola DG893]
 gi|149359052|gb|EDM47517.1| 50S ribosomal protein L22 [Marinobacter algicola DG893]
          Length = 110

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 57/97 (58%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R+S QK  LVA  +RGK V DAL  L FS K+ A  ++K L SA+ANAE+N  LDVD L 
Sbjct: 11  RLSAQKARLVADQVRGKAVEDALNILTFSPKKAAVILKKALESAIANAEHNEGLDVDDLR 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           VS   V +   +KR   R + R  RI +    +TV V
Sbjct: 71  VSTVMVDEGPTLKRIKARAKGRADRIFKRTCHITVKV 107


>gi|225574706|ref|ZP_03783316.1| hypothetical protein RUMHYD_02783 [Blautia hydrogenotrophica DSM
           10507]
 gi|225038071|gb|EEG48317.1| hypothetical protein RUMHYD_02783 [Blautia hydrogenotrophica DSM
           10507]
          Length = 129

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 69/125 (55%), Gaps = 4/125 (3%)

Query: 3   GKRSVSKRRMGDNE----ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIA 58
           G RS  KR   +N      +A  S  R+S QK   V  +IRGK V  AL  L ++ +  +
Sbjct: 4   GHRSQIKRSRNENNKDTRPSAKLSYARISVQKACYVLDVIRGKDVQSALGILTYNPRYAS 63

Query: 59  GEVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLT 118
             ++K L SA+ANAENN+ ++++ L ++E Y  K   MKR   R + R  RI +  S +T
Sbjct: 64  SVLKKLLESAIANAENNNGMNIENLYIAECYANKGPTMKRIQPRAQGRAYRIEKRTSHIT 123

Query: 119 VIVRE 123
           +++ E
Sbjct: 124 IVLDE 128


>gi|283796554|ref|ZP_06345707.1| ribosomal protein L22 [Clostridium sp. M62/1]
 gi|291075968|gb|EFE13332.1| ribosomal protein L22 [Clostridium sp. M62/1]
 gi|295092552|emb|CBK78659.1| LSU ribosomal protein L22P [Clostridium cf. saccharolyticum K10]
 gi|295115271|emb|CBL36118.1| LSU ribosomal protein L22P [butyrate-producing bacterium SM4/1]
          Length = 128

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 48/124 (38%), Positives = 67/124 (54%), Gaps = 3/124 (2%)

Query: 3   GKRSVSKRRMG---DNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAG 59
           G RS  KR      D   +A  S  RVS QK   V   IRGK V  AL  + ++ +  + 
Sbjct: 4   GHRSQIKRERNANKDTRPSAKLSYARVSVQKACFVLDAIRGKDVQTALGIVTYNPRYAST 63

Query: 60  EVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTV 119
            ++K L SA+ANAENN+ ++V+ L V+E Y  K   MKR   R + R  RI +  S +TV
Sbjct: 64  LIKKLLESAIANAENNNQMNVENLYVAECYANKGPTMKRVKPRAQGRAYRIEKRMSHITV 123

Query: 120 IVRE 123
           ++ E
Sbjct: 124 VLDE 127


>gi|307543830|ref|YP_003896309.1| 50S ribosomal protein L22 [Halomonas elongata DSM 2581]
 gi|307215854|emb|CBV41124.1| 50S ribosomal protein L22 [Halomonas elongata DSM 2581]
          Length = 110

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 61/99 (61%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R+S QK  LVA  +RGK V++AL  L FS K+ +  V+K L SA+ANAE N+ +D+D L 
Sbjct: 11  RLSAQKARLVADQVRGKPVAEALDLLTFSPKKASKLVKKVLQSAIANAEENNGMDIDELR 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           VS   V + + +KR   R + R  RI++    +TV V E
Sbjct: 71  VSTICVDEGMTLKRIRPRAKGRADRILKRTCHITVKVAE 109


>gi|167749434|ref|ZP_02421561.1| hypothetical protein EUBSIR_00388 [Eubacterium siraeum DSM 15702]
 gi|167657606|gb|EDS01736.1| hypothetical protein EUBSIR_00388 [Eubacterium siraeum DSM 15702]
 gi|291532098|emb|CBK97683.1| LSU ribosomal protein L22P [Eubacterium siraeum 70/3]
          Length = 124

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 44/123 (35%), Positives = 70/123 (56%), Gaps = 1/123 (0%)

Query: 1   MSGKRSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGE 60
           M   + VSK      EA A    +R+SP+K+ +V  +IR K    A+A L+ + K  +  
Sbjct: 1   MQEAKQVSKEETS-MEARAELRQVRISPRKVGVVLDLIRNKPCDMAMAILKHTPKSASEP 59

Query: 61  VRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVI 120
           ++K L SA+ANAENNH +D+ +  VS  +VG  V +KR   +   R  RI++  S + ++
Sbjct: 60  LQKLLKSAMANAENNHSMDLSKCYVSSCHVGAGVTLKRIRHKDHGRAHRILKRTSNIVLV 119

Query: 121 VRE 123
           V+E
Sbjct: 120 VKE 122


>gi|311693276|gb|ADP96149.1| ribosomal protein L22, bacterial-type [marine bacterium HP15]
          Length = 110

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 56/96 (58%)

Query: 26  VSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLIV 85
           +S QK  LVA  +RGK V DAL  L FS K+ A  ++K L SA+ANAE+N  LDVD L V
Sbjct: 12  LSAQKARLVADQVRGKAVEDALNILTFSPKKAAVVIKKALESAIANAEHNEGLDVDELRV 71

Query: 86  SEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           S   V +   +KR   R + R  RI +    +TV V
Sbjct: 72  STVMVDEGPTLKRIKARAKGRADRIFKRTCHITVKV 107


>gi|163815980|ref|ZP_02207350.1| hypothetical protein COPEUT_02160 [Coprococcus eutactus ATCC 27759]
 gi|158448790|gb|EDP25785.1| hypothetical protein COPEUT_02160 [Coprococcus eutactus ATCC 27759]
 gi|295093646|emb|CBK82737.1| LSU ribosomal protein L22P [Coprococcus sp. ART55/1]
          Length = 128

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 48/124 (38%), Positives = 68/124 (54%), Gaps = 3/124 (2%)

Query: 3   GKRSVSKRRMGDNE---ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAG 59
           G RS  KR   +N+    +A  S  RVS  K   V   IRGK V  ALA +E++ +  + 
Sbjct: 4   GHRSHDKRLRNENKDTRPSAKVSYARVSVTKACFVLDAIRGKDVQTALAIVEYNPRYGSS 63

Query: 60  EVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTV 119
            + K L SA+ANAENN+ +  + L V+E Y  K   MKR H R + R  RI +  S +T+
Sbjct: 64  VIEKLLKSAIANAENNNGMKKEDLYVAECYANKGPTMKRVHPRAQGRAYRIEKRTSHITI 123

Query: 120 IVRE 123
           ++ E
Sbjct: 124 VLDE 127


>gi|154505164|ref|ZP_02041902.1| hypothetical protein RUMGNA_02677 [Ruminococcus gnavus ATCC 29149]
 gi|153794643|gb|EDN77063.1| hypothetical protein RUMGNA_02677 [Ruminococcus gnavus ATCC 29149]
          Length = 128

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 47/124 (37%), Positives = 65/124 (52%), Gaps = 3/124 (2%)

Query: 3   GKRSVSKRR---MGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAG 59
           G RS  KR      D   +A  S  RVS QK   V   IRGK V  AL  L ++ +  + 
Sbjct: 4   GHRSQIKRERNEQKDTRPSAKISYARVSVQKACYVLDAIRGKDVQTALGILAYNPRYASS 63

Query: 60  EVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTV 119
            + K L SA+ANAENN+ ++V+ L + E Y  K   MKR   R + R  RI +  S +T+
Sbjct: 64  VIEKLLKSAIANAENNNGMNVENLYIEECYANKGPTMKRIRPRAQGRAYRIEKRMSHITI 123

Query: 120 IVRE 123
           ++ E
Sbjct: 124 VLNE 127


>gi|295111417|emb|CBL28167.1| LSU ribosomal protein L22P [Synergistetes bacterium SGP1]
          Length = 114

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 60/107 (56%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A+A   R++P K+  V  +IRGK   +AL  L FS ++ A  V K L SAVANAE+N+
Sbjct: 7   ARAMARQARIAPTKVRQVLTLIRGKGAEEALTILRFSPQKAARIVYKVLQSAVANAEHNY 66

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            +D+D+L V  A+  +   MKRF      R    V   S +TV V E
Sbjct: 67  GMDMDKLYVLTAFADQGPVMKRFRPVSMGRAHPYVHRTSHVTVTVAE 113


>gi|256005324|ref|ZP_05430290.1| ribosomal protein L22 [Clostridium thermocellum DSM 2360]
 gi|255990760|gb|EEU00876.1| ribosomal protein L22 [Clostridium thermocellum DSM 2360]
 gi|316939505|gb|ADU73539.1| ribosomal protein L22 [Clostridium thermocellum DSM 1313]
          Length = 158

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 42/114 (36%), Positives = 67/114 (58%)

Query: 12  MGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVAN 71
           +G ++  AI    R+SP+K+ +V  +I+GK + +A A L ++ K  +  + K L SA AN
Sbjct: 45  IGKDQGKAILRYARISPRKVRIVLDLIKGKDIDEAYAILRYTPKAASSILFKLLKSAEAN 104

Query: 72  AENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVS 125
           A NN+ L+ D L V+EAY  +   +KR   R R    RI +  S +T++V+E S
Sbjct: 105 ATNNNGLNRDNLYVAEAYADQGPTLKRILPRARGSADRIRKRTSHITLVVKERS 158


>gi|158520730|ref|YP_001528600.1| ribosomal protein L22 [Desulfococcus oleovorans Hxd3]
 gi|215274822|sp|A8ZV62|RL22_DESOH RecName: Full=50S ribosomal protein L22
 gi|158509556|gb|ABW66523.1| ribosomal protein L22 [Desulfococcus oleovorans Hxd3]
          Length = 114

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 62/108 (57%), Gaps = 1/108 (0%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           + +A A  LR+ PQK+ ++   I+GK V   L  L F   + AG V K L SAVANAE  
Sbjct: 3   QVSATARYLRIGPQKVRMLVDGIKGKSVEKGLNTLRFMPNKGAGLVEKALRSAVANAE-E 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            ++DVD L++    V +   +KRF  R R R  RI++  S +TV++ E
Sbjct: 62  KNMDVDGLVILNVLVDQGPTLKRFRPRARGRATRILKRTSHITVVLAE 109


>gi|269468080|gb|EEZ79794.1| ribosomal protein L22 [uncultured SUP05 cluster bacterium]
          Length = 110

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 59/104 (56%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A+    + S  K  LVA  IR K V +AL  L +S K+ A  V+K L SA++NAE+N
Sbjct: 3   EVKAVHKYAKTSAFKARLVADQIRLKSVEEALNILSYSNKKAAVLVKKVLNSAISNAEHN 62

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTV 119
             LD+D L VS  Y+ +   MKR   R + R  RI++  S +TV
Sbjct: 63  DGLDIDELKVSSVYIDEGSTMKRIRPRAKGRANRILKRTSHITV 106


>gi|170077680|ref|YP_001734318.1| 50S ribosomal protein L22 [Synechococcus sp. PCC 7002]
 gi|226733521|sp|B1XJT4|RL22_SYNP2 RecName: Full=50S ribosomal protein L22
 gi|169885349|gb|ACA99062.1| ribosomal protein L22 [Synechococcus sp. PCC 7002]
          Length = 119

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 60/114 (52%)

Query: 14  DNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAE 73
             E  AIA  +R+SP K+  V   IRG+   +AL  LEF   R    V K L SAVANAE
Sbjct: 6   QTEVKAIARYIRMSPIKVRRVLDQIRGRSYREALIILEFMPYRACEPVLKVLRSAVANAE 65

Query: 74  NNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           +N  LD   L+VS A+      +KRF  R + R  +I +P   +TV V   S E
Sbjct: 66  HNEGLDPADLVVSAAFADAGPVLKRFRPRAQGRAYQIRKPTCHITVAVAPGSAE 119


>gi|294669829|ref|ZP_06734888.1| hypothetical protein NEIELOOT_01722 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291308222|gb|EFE49465.1| hypothetical protein NEIELOOT_01722 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 109

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 57/97 (58%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R+S QK  LVA +IRGK V+ AL  L FS K+ A  +RK L SA+ANAE+N   D+D L 
Sbjct: 11  RISAQKARLVADLIRGKNVAHALNILTFSPKKGAELIRKVLESAIANAEHNEGADIDDLK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           V    V K+  +KRF  R + R  RI +    + V V
Sbjct: 71  VVMICVDKAASLKRFQARAKGRGNRIEKQTCHIAVTV 107


>gi|67923588|ref|ZP_00517060.1| Ribosomal protein L22, bacterial and organelle form [Crocosphaera
           watsonii WH 8501]
 gi|67854558|gb|EAM49845.1| Ribosomal protein L22, bacterial and organelle form [Crocosphaera
           watsonii WH 8501]
          Length = 120

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 60/107 (56%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
            EA AIA  +R+SP K+  V   IRG+   +AL  LEF   R    + K L SAVANAE+
Sbjct: 7   TEAKAIARYIRMSPFKVRRVLDQIRGRSYREALIILEFMPYRACEPILKLLRSAVANAEH 66

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           N  LD   L+VS+AY      ++R+  R + R  +I +P   +T+ V
Sbjct: 67  NQGLDPGSLVVSKAYADGGPGLRRYRPRAQGRAYQIRKPTCHITIAV 113


>gi|328955909|ref|YP_004373242.1| LSU ribosomal protein L22P [Coriobacterium glomerans PW2]
 gi|328456233|gb|AEB07427.1| LSU ribosomal protein L22P [Coriobacterium glomerans PW2]
          Length = 123

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 44/106 (41%), Positives = 61/106 (57%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A+A  +RVS  K  LV  +IR K V +AL  L F  +  A +V K L SAVANAENN
Sbjct: 12  EVRAVAKYVRVSAGKARLVIDLIRRKPVPEALDILRFCERAAAVDVEKVLRSAVANAENN 71

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           + +  D L++  AYV +   +KR   R +    RI++  S +TV+V
Sbjct: 72  NGMRADDLVIVSAYVDQGPTLKRIRPRAKGSASRILKRMSHITVVV 117


>gi|166031654|ref|ZP_02234483.1| hypothetical protein DORFOR_01354 [Dorea formicigenerans ATCC
           27755]
 gi|166028631|gb|EDR47388.1| hypothetical protein DORFOR_01354 [Dorea formicigenerans ATCC
           27755]
          Length = 129

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 62/110 (56%)

Query: 14  DNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAE 73
           D   +A  S  RVS QK   V   IRGK V  AL  L ++ +  +  ++K L SA+ANAE
Sbjct: 19  DTRPSAKLSYARVSVQKACFVLDAIRGKDVQTALGILTYNPRYASSLIKKLLESAIANAE 78

Query: 74  NNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           NN+ ++ + L ++EAY  K   MKR   R + R  RI +  S +T+++ E
Sbjct: 79  NNNGMNAENLYIAEAYANKGPTMKRIRPRAQGRAYRIEKRMSHITLVLDE 128


>gi|260438211|ref|ZP_05792027.1| ribosomal protein L22 [Butyrivibrio crossotus DSM 2876]
 gi|292809403|gb|EFF68608.1| ribosomal protein L22 [Butyrivibrio crossotus DSM 2876]
          Length = 128

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 66/124 (53%), Gaps = 3/124 (2%)

Query: 3   GKRSVSKRRMG---DNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAG 59
           G RS  KR      D   +A  S  RVS QK   V   IRGK V+ ALA + ++ +  + 
Sbjct: 4   GHRSQIKRERNANKDTRPSAKVSYARVSVQKACFVLDAIRGKDVTTALAIVSYNPRYAST 63

Query: 60  EVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTV 119
            + K L SA+ANAENN+ +  + L + E Y G+   MKR   R + R  RI +  S +T+
Sbjct: 64  VIEKLLKSAIANAENNNGMKAENLYIEECYAGEGPIMKRVRPRAQGRAYRIEKRMSNITI 123

Query: 120 IVRE 123
           ++ E
Sbjct: 124 VLNE 127


>gi|240145873|ref|ZP_04744474.1| ribosomal protein L22 [Roseburia intestinalis L1-82]
 gi|257202022|gb|EEV00307.1| ribosomal protein L22 [Roseburia intestinalis L1-82]
 gi|291535435|emb|CBL08547.1| LSU ribosomal protein L22P [Roseburia intestinalis M50/1]
 gi|291537921|emb|CBL11032.1| LSU ribosomal protein L22P [Roseburia intestinalis XB6B4]
          Length = 128

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 48/124 (38%), Positives = 67/124 (54%), Gaps = 3/124 (2%)

Query: 3   GKRSVSKRR---MGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAG 59
           G RS  KR    + D   +A  S  RVS QK   V   IRGK V  ALA + ++ +  + 
Sbjct: 4   GHRSQIKRERNEVKDTRPSAKLSYARVSVQKACFVLDAIRGKDVQTALAIVTYNPRYASS 63

Query: 60  EVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTV 119
            V+K L SA+ANAENN+ +  + L V+E Y  K   MKR   R + R  RI +  S +T+
Sbjct: 64  LVKKLLESAIANAENNNGMKAENLYVAECYANKGPTMKRIRPRAQGRAYRIEKRMSHITI 123

Query: 120 IVRE 123
           ++ E
Sbjct: 124 VLDE 127


>gi|257054475|ref|YP_003132307.1| 50S ribosomal protein L22P [Saccharomonospora viridis DSM 43017]
 gi|256584347|gb|ACU95480.1| LSU ribosomal protein L22P [Saccharomonospora viridis DSM 43017]
          Length = 142

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 59/101 (58%)

Query: 21  ASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDV 80
           A  +R SP K+  V  +I+G+  ++AL  L F+ +  + +V K L SA+ANAENN DLD 
Sbjct: 21  ARFVRDSPTKVRRVIELIKGRNANEALTVLRFAPQAASDQVAKVLASAMANAENNLDLDP 80

Query: 81  DRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           D L V  AY  +   +KR   R + R  RI +  S +TV+V
Sbjct: 81  DTLWVKNAYADEGPTLKRIRPRAQGRAYRIRKRTSHITVVV 121


>gi|225376414|ref|ZP_03753635.1| hypothetical protein ROSEINA2194_02056 [Roseburia inulinivorans DSM
           16841]
 gi|225211790|gb|EEG94144.1| hypothetical protein ROSEINA2194_02056 [Roseburia inulinivorans DSM
           16841]
          Length = 128

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 48/124 (38%), Positives = 67/124 (54%), Gaps = 3/124 (2%)

Query: 3   GKRSVSKRR---MGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAG 59
           G RS  KR    + D   +A  S  RVS QK   V   IRGK V  ALA + ++ +  + 
Sbjct: 4   GHRSQIKRERNEVKDTRPSAKLSYARVSVQKACFVLDAIRGKDVQTALAIVTYNPRYASS 63

Query: 60  EVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTV 119
            V+K L SA+ANAENN+ +  + L V+E Y  K   MKR   R + R  RI +  S +T+
Sbjct: 64  LVKKLLESAIANAENNNGMKAENLYVAECYANKGPTMKRIRPRAQGRAYRIEKRMSHITI 123

Query: 120 IVRE 123
           ++ E
Sbjct: 124 VLDE 127


>gi|226323015|ref|ZP_03798533.1| hypothetical protein COPCOM_00787 [Coprococcus comes ATCC 27758]
 gi|225208582|gb|EEG90936.1| hypothetical protein COPCOM_00787 [Coprococcus comes ATCC 27758]
          Length = 128

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 47/124 (37%), Positives = 66/124 (53%), Gaps = 3/124 (2%)

Query: 3   GKRSVSKRRMG---DNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAG 59
           G RS  KR      D   +A  S  RVS QK   V   IRGK V+ AL  L ++ +  + 
Sbjct: 4   GHRSQIKRERNANKDTRPSAKLSYARVSVQKACFVLDAIRGKDVTTALGILTYNPRYASS 63

Query: 60  EVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTV 119
            ++K L SA+ANAENN+ + V+ L + E Y  K   MKR   R + R  RI +  S +T+
Sbjct: 64  IIKKLLESAIANAENNNGMSVENLYIEECYANKGPTMKRIRPRAQGRAYRIEKRMSHITL 123

Query: 120 IVRE 123
           ++ E
Sbjct: 124 VLNE 127


>gi|291460723|ref|ZP_06600113.1| ribosomal protein L22 [Oribacterium sp. oral taxon 078 str. F0262]
 gi|291416682|gb|EFE90401.1| ribosomal protein L22 [Oribacterium sp. oral taxon 078 str. F0262]
          Length = 129

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 48/124 (38%), Positives = 68/124 (54%), Gaps = 3/124 (2%)

Query: 3   GKRSVSKRRMGDNE---ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAG 59
           G RS  KR   D +    +A  S  RVS QK   V   IRGK ++ A+  + ++ +  + 
Sbjct: 4   GHRSQIKRERNDKKDKRPSATLSYARVSVQKACFVLDAIRGKDLAQAIGIVSYNPRYAST 63

Query: 60  EVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTV 119
            V+K L SA ANAENN +L  D L V+E +   +  MKR H R + R  RI++  S +TV
Sbjct: 64  LVKKLLESAAANAENNCELQRDSLYVAECFANTAPTMKRIHPRAQGRAYRILKRSSHITV 123

Query: 120 IVRE 123
           I+ E
Sbjct: 124 ILDE 127


>gi|17547733|ref|NP_521135.1| 50S ribosomal protein L22 [Ralstonia solanacearum GMI1000]
 gi|51316884|sp|Q8XV17|RL22_RALSO RecName: Full=50S ribosomal protein L22
 gi|17430038|emb|CAD16723.1| probable 50s ribosomal protein l22 [Ralstonia solanacearum GMI1000]
 gi|299065420|emb|CBJ36589.1| 50S ribosomal subunit protein L22 [Ralstonia solanacearum CMR15]
          Length = 109

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 44/106 (41%), Positives = 59/106 (55%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  AI    R+S QK  LVA  IRG  +  AL  L FS K+ A  V+K + SA+ANAE+N
Sbjct: 2   EVKAIHRGARISAQKTRLVADQIRGLPIERALNVLAFSPKKAAVIVKKVVESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L V   Y+ K+  +KRF  R + R  RI +    +TV +
Sbjct: 62  EGADIDELKVKSIYIDKATSLKRFTARAKGRGNRIEKQTCHITVTL 107


>gi|320094575|ref|ZP_08026341.1| 50S ribosomal protein L22 [Actinomyces sp. oral taxon 178 str.
           F0338]
 gi|319978490|gb|EFW10067.1| 50S ribosomal protein L22 [Actinomyces sp. oral taxon 178 str.
           F0338]
          Length = 123

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 67/119 (56%), Gaps = 5/119 (4%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVAN---- 71
           EA A A  +RV+PQK   V   +RGKR  +A   L F+ + +A +VRK L SA+AN    
Sbjct: 2   EAKAQARYIRVTPQKSRRVVNEVRGKRALEAADILRFAPQAVATDVRKVLMSAIANSRVK 61

Query: 72  AEN-NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEGK 129
           AEN     +   L+V EAYV +   MKR   R + R GRI++  S +T++V    D+ K
Sbjct: 62  AENAGETFNEADLLVLEAYVDEGPTMKRIRPRAQGRAGRILKRTSHITIVVGTKEDKKK 120


>gi|293363565|ref|ZP_06610321.1| ribosomal protein L22 [Mycoplasma alligatoris A21JP2]
 gi|292552914|gb|EFF41668.1| ribosomal protein L22 [Mycoplasma alligatoris A21JP2]
          Length = 119

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 44/117 (37%), Positives = 65/117 (55%)

Query: 7   VSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLC 66
           ++K+ +   +A A+  + RVS +K  LVA + RGK V  AL  L+ + K+ A    K L 
Sbjct: 1   MAKQEIQVQQAKALVKLQRVSARKARLVADLFRGKDVRVALGILQNTAKKAAPLFVKLLN 60

Query: 67  SAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           SAVANA NNH +D  +L V E  V +   +KRF  R + R   I +  S L++ + E
Sbjct: 61  SAVANATNNHGMDASKLFVKEVLVNEGPTLKRFQPRSQGRAYSIFKRTSHLSITLEE 117


>gi|158337815|ref|YP_001518991.1| 50S ribosomal protein L22 [Acaryochloris marina MBIC11017]
 gi|189041939|sp|B0C1D8|RL22_ACAM1 RecName: Full=50S ribosomal protein L22
 gi|158308056|gb|ABW29673.1| 50S ribosomal protein L22 [Acaryochloris marina MBIC11017]
          Length = 120

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 59/107 (55%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
           N A A A  +R+SP+K+  V   IRG+   +AL  LEF   R    V K L SAVANAE 
Sbjct: 9   NGAYAKAKYIRMSPRKVRRVLDQIRGRSYREALIVLEFMPYRACEPVLKVLRSAVANAET 68

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           N  LD   L+VS AY  +   +KRF  R + R  +I +P   +T+ V
Sbjct: 69  NRGLDPVDLVVSHAYADQGPRLKRFRPRAQGRAYQIQKPTCHITIAV 115


>gi|302519656|ref|ZP_07271998.1| ribosomal protein L22 [Streptomyces sp. SPB78]
 gi|302428551|gb|EFL00367.1| ribosomal protein L22 [Streptomyces sp. SPB78]
          Length = 123

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 63/107 (58%), Gaps = 1/107 (0%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A  +RV+P K   V  +IRG   ++A A L F+ +  +  V K L SA+ANA +N
Sbjct: 10  EARAQARYIRVTPMKARRVVDLIRGMDATEAQAVLRFAPQAASEPVGKVLDSAIANAAHN 69

Query: 76  HD-LDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           +D  D   L++SEAYV +   +KRF  R + R  RI +  S +TV+V
Sbjct: 70  YDHTDASTLVISEAYVDEGPTLKRFRPRAQGRAYRIRKRTSHITVVV 116


>gi|124494172|gb|ABN13130.1| ribosomal protein L22 [Knautia arvensis phyllody phytoplasma]
          Length = 126

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 42/111 (37%), Positives = 63/111 (56%)

Query: 19  AIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDL 78
           AIA  + ++P+K  LVA +IRGK + +A A L F+ + ++  V K L SA+ANA NN  L
Sbjct: 5   AIAKQIPITPRKTRLVADLIRGKNIKEAQAILMFTPRSVSLIVLKLLKSAIANATNNFSL 64

Query: 79  DVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEGK 129
           D   L V E +V + + + R   R + R  RI +  S +T++V     E K
Sbjct: 65  DEKNLYVKEIFVNEGLRLTRLFPRAKGRADRIKKRTSHITIVVAPHLSENK 115


>gi|269128511|ref|YP_003301881.1| 50S ribosomal protein L22 [Thermomonospora curvata DSM 43183]
 gi|268313469|gb|ACY99843.1| ribosomal protein L22 [Thermomonospora curvata DSM 43183]
          Length = 125

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 44/111 (39%), Positives = 64/111 (57%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A  +RV+P+K   V  +IRG   ++A   L F+ +  +  V K L SA+ANAE+N
Sbjct: 2   EARARARYVRVTPRKARRVVDLIRGLPAAEAQTVLRFAPQAASEPVGKVLASAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
             L+ D L+VS A+V +   +KRF  R + R  RI +  S +TV+V    D
Sbjct: 62  FKLNRDTLVVSRAWVDEGPTLKRFRPRAQGRAYRINKRTSHITVVVESRED 112


>gi|317485817|ref|ZP_07944681.1| ribosomal protein L22 [Bilophila wadsworthia 3_1_6]
 gi|316922923|gb|EFV44145.1| ribosomal protein L22 [Bilophila wadsworthia 3_1_6]
          Length = 112

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 62/108 (57%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E+ A A  +RVSP+K  LVA  ++G  V  A+  L F+  + AG +   + SA+ANAE+N
Sbjct: 2   ESKATAKFVRVSPRKTRLVARNVKGMPVEAAMNLLRFTPNKPAGVILGVVRSALANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
             +DVD L+V E  V +    KRF  R + R   I +  S +TVI+ E
Sbjct: 62  ASMDVDALVVKEILVNEGPTWKRFMPRAQGRATNIHKRTSHITVILAE 109


>gi|329298528|ref|ZP_08255864.1| 50S ribosomal protein L22 [Plautia stali symbiont]
          Length = 110

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 63/99 (63%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R S QK+ LVA +IRGK+VS AL  L ++ K+ A  V+K L SA+ANAE+N   D+D L 
Sbjct: 11  RSSAQKVRLVADLIRGKKVSQALDILTYTNKKAAVLVKKVLESAIANAEHNDGADIDDLK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           V++ +V +   +KR   R + R   I++  S +TV+V +
Sbjct: 71  VAKIFVDEGPSIKRIMPRAKGRADCILKRTSHITVVVSD 109


>gi|212697258|ref|ZP_03305386.1| hypothetical protein ANHYDRO_01826 [Anaerococcus hydrogenalis DSM
           7454]
 gi|325848901|ref|ZP_08170411.1| ribosomal protein L22 [Anaerococcus hydrogenalis ACS-025-V-Sch4]
 gi|212675707|gb|EEB35314.1| hypothetical protein ANHYDRO_01826 [Anaerococcus hydrogenalis DSM
           7454]
 gi|325480545|gb|EGC83607.1| ribosomal protein L22 [Anaerococcus hydrogenalis ACS-025-V-Sch4]
          Length = 115

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 63/108 (58%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A A  +R+SP K+N +   IRGK+V +AL  L F+ K+ A  +   L SA+ANAENN
Sbjct: 2   EVKATAKYVRISPLKVNYICREIRGKQVDEALTILRFTNKKGARLLSDVLKSAIANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           + L  D LIV +A+   +  MKR+  + +     I++  S + V++ E
Sbjct: 62  NGLSRDNLIVKKAFANDAPTMKRWRPKAKGAAYPILKRSSHIGVVLTE 109


>gi|124494178|gb|ABN13134.1| ribosomal protein L22 [Almond witches'-broom phytoplasma]
 gi|307043538|gb|ADN23591.1| ribosomal protein L22 [Almond witches'-broom phytoplasma]
          Length = 126

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 43/111 (38%), Positives = 62/111 (55%)

Query: 19  AIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDL 78
           AIA  + ++P+K  LVA +IRGK + +A A L F+ K  +  V K L SA+ANA NN  L
Sbjct: 5   AIAKQMPITPRKTRLVADLIRGKNIKEAQAILMFTPKAASPIVLKLLKSAIANATNNFSL 64

Query: 79  DVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEGK 129
           D   L V E +V + + + R   R + R  RI +  S +T++V     E K
Sbjct: 65  DEAFLYVKEIFVNEGLRLTRLFPRAKGRADRIKKRTSHITIVVAPQLSENK 115


>gi|295838409|ref|ZP_06825342.1| ribosomal protein L22 [Streptomyces sp. SPB74]
 gi|197695794|gb|EDY42727.1| ribosomal protein L22 [Streptomyces sp. SPB74]
          Length = 123

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 63/107 (58%), Gaps = 1/107 (0%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A  +RV+P K   V  +IRG   ++A A L F+ +  +  V K L SA+ANA +N
Sbjct: 10  EARAQARYIRVTPMKARRVVDLIRGMDATEAQAVLRFAPQAASEPVGKVLDSAIANAAHN 69

Query: 76  HD-LDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           +D  D   L++SEAYV +   +KRF  R + R  RI +  S +TV+V
Sbjct: 70  YDHTDASSLVISEAYVDEGPTLKRFRPRAQGRAYRIRKRTSHITVVV 116


>gi|197303817|ref|ZP_03168853.1| hypothetical protein RUMLAC_02556 [Ruminococcus lactaris ATCC
           29176]
 gi|197297110|gb|EDY31674.1| hypothetical protein RUMLAC_02556 [Ruminococcus lactaris ATCC
           29176]
          Length = 128

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 47/124 (37%), Positives = 64/124 (51%), Gaps = 3/124 (2%)

Query: 3   GKRSVSKRR---MGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAG 59
           G RS  KR      D   +A  S  RVS QK   V   IRGK V  AL  L ++ +  + 
Sbjct: 4   GHRSQIKRERNAQKDTRPSAKISYARVSVQKACFVLDAIRGKDVQTALGILAYNPRYASS 63

Query: 60  EVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTV 119
            + K L SA+ANAENN+ + V+ L + E Y  K   MKR   R + R  RI +  S +T+
Sbjct: 64  VIEKLLKSAIANAENNNGMSVENLYIEECYANKGPTMKRIRPRAQGRAYRIEKRMSHITI 123

Query: 120 IVRE 123
           ++ E
Sbjct: 124 VLNE 127


>gi|315320570|ref|YP_004072627.1| 50S ribosomal protein L22 [Thalassiosira oceanica CCMP1005]
 gi|283569043|gb|ADB27580.1| 50S ribosomal protein L22 [Thalassiosira oceanica CCMP1005]
          Length = 115

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 62/107 (57%)

Query: 19  AIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDL 78
           A+A  +R+SP K+  V   IRG+   +AL  LEF        + + + S  ANA+NN++L
Sbjct: 9   AVAKYVRISPHKVRKVLDQIRGRSYQEALMILEFLPYDAGSPIWQVVHSVAANAKNNYNL 68

Query: 79  DVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVS 125
           D  +LI+SE +  +   +KR   R + R  +I++P   +TV+V+ ++
Sbjct: 69  DKKKLIISEIFADEGPKLKRIRPRAQGRAFKILKPTCHITVVVKSIN 115


>gi|291286317|ref|YP_003503133.1| 50S ribosomal protein L22 [Denitrovibrio acetiphilus DSM 12809]
 gi|290883477|gb|ADD67177.1| ribosomal protein L22 [Denitrovibrio acetiphilus DSM 12809]
          Length = 110

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 63/107 (58%), Gaps = 1/107 (0%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A   RVSP+K   VA +IRGK+V +ALA L+F+  + A  + K + SA +NAE N
Sbjct: 2   EAIARAKYQRVSPRKTRPVADLIRGKKVEEALAILKFTPNKGAKILYKAVKSAASNAEEN 61

Query: 76  HD-LDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           H+  D  R++V E  V +    KRF  R   R   + +P S +TV++
Sbjct: 62  HNHADASRMVVKEVRVDQGPVWKRFLPRAYGRATGLRKPTSNITVVL 108


>gi|154498888|ref|ZP_02037266.1| hypothetical protein BACCAP_02880 [Bacteroides capillosus ATCC
           29799]
 gi|150271728|gb|EDM98954.1| hypothetical protein BACCAP_02880 [Bacteroides capillosus ATCC
           29799]
          Length = 114

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 59/107 (55%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A     R+SP+K+ +V  +IRGK V +A A L  + K  +  + K L SA ANAENNH
Sbjct: 7   AQATLRYARISPRKVQIVCDLIRGKSVPEATAILMATPKAASELMLKILKSAAANAENNH 66

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            +D ++L VS  Y      +KR   R + R  RI +  S +T+ V E
Sbjct: 67  QMDPEKLYVSATYANPGPIIKRMRPRAQGRAFRINKRTSHITIAVSE 113


>gi|319938502|ref|ZP_08012896.1| 50S ribosomal protein L22 [Coprobacillus sp. 29_1]
 gi|319806418|gb|EFW03085.1| 50S ribosomal protein L22 [Coprobacillus sp. 29_1]
          Length = 110

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 61/108 (56%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A M+RVSPQK  LV  ++RGK + +AL  LE++ K     + K + SA  NA  N
Sbjct: 2   EARAQAKMIRVSPQKARLVVDLVRGKNLKEALGILEYTNKSATPAIIKVVKSAAQNAVFN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
              + ++L + E YV +   +KRF  R +    +I++  S +T +V E
Sbjct: 62  EGAEEEKLFIKEIYVDEGPTLKRFRARAKGSGTQILKRTSHITCVVAE 109


>gi|291549411|emb|CBL25673.1| LSU ribosomal protein L22P [Ruminococcus torques L2-14]
          Length = 128

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 47/124 (37%), Positives = 64/124 (51%), Gaps = 3/124 (2%)

Query: 3   GKRSVSKRRMG---DNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAG 59
           G RS  KR      D   +A  S  RVS QK   V   IRGK V  AL  L ++ +  + 
Sbjct: 4   GHRSQIKRERNEQRDTRPSAKISYARVSVQKACFVLDAIRGKDVQTALGILAYNPRYASS 63

Query: 60  EVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTV 119
            + K L SA+ANAENN+ + V+ L + E Y  K   MKR   R + R  RI +  S +T+
Sbjct: 64  VIEKLLKSAIANAENNNGMSVENLYIEECYANKGPTMKRIKPRAQGRAYRIEKRMSHITI 123

Query: 120 IVRE 123
           ++ E
Sbjct: 124 VLNE 127


>gi|318058123|ref|ZP_07976846.1| 50S ribosomal protein L22 [Streptomyces sp. SA3_actG]
 gi|318076024|ref|ZP_07983356.1| 50S ribosomal protein L22 [Streptomyces sp. SA3_actF]
          Length = 115

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 63/107 (58%), Gaps = 1/107 (0%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A  +RV+P K   V  +IRG   ++A A L F+ +  +  V K L SA+ANA +N
Sbjct: 2   EARAQARYIRVTPMKARRVVDLIRGMDATEAQAVLRFAPQAASEPVGKVLDSAIANAAHN 61

Query: 76  HD-LDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           +D  D   L++SEAYV +   +KRF  R + R  RI +  S +TV+V
Sbjct: 62  YDHTDASTLVISEAYVDEGPTLKRFRPRAQGRAYRIRKRTSHITVVV 108


>gi|218245135|ref|YP_002370506.1| 50S ribosomal protein L22 [Cyanothece sp. PCC 8801]
 gi|257058160|ref|YP_003136048.1| 50S ribosomal protein L22 [Cyanothece sp. PCC 8802]
 gi|226733452|sp|B7K330|RL22_CYAP8 RecName: Full=50S ribosomal protein L22
 gi|218165613|gb|ACK64350.1| ribosomal protein L22 [Cyanothece sp. PCC 8801]
 gi|256588326|gb|ACU99212.1| ribosomal protein L22 [Cyanothece sp. PCC 8802]
          Length = 120

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 44/113 (38%), Positives = 63/113 (55%), Gaps = 1/113 (0%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  AIA  +R+SP K+  V   IRG+   +AL  LEF   R    + K L SA ANAE+N
Sbjct: 8   EVKAIARYIRMSPHKVRRVLDQIRGRSYREALIILEFMPYRACDPILKVLRSAAANAEHN 67

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV-REVSDE 127
             LD   L+VS+AY      ++R+  R + R  +I +P   +TV V  E+++E
Sbjct: 68  EGLDRATLVVSQAYADGGPSLRRYRPRAQGRAYQIRKPTCHITVAVAPEITEE 120


>gi|295099232|emb|CBK88321.1| LSU ribosomal protein L22P [Eubacterium cylindroides T2-87]
          Length = 111

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 60/108 (55%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A A  LR+ P+K  LV  +IRGK V +A A  +F+  +    V K L SAV+NA NN
Sbjct: 2   EVKATAKTLRIQPRKARLVLNLIRGKDVEEAAAICKFTPNKGGYLVGKVLKSAVSNAVNN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           +DLD  +L V   +  + + MKR+  R +     I +  S +TV+V E
Sbjct: 62  NDLDESKLYVKACWADEGITMKRYMPRAKGSASPINKRTSHITVVVAE 109


>gi|258651368|ref|YP_003200524.1| 50S ribosomal protein L22 [Nakamurella multipartita DSM 44233]
 gi|258554593|gb|ACV77535.1| ribosomal protein L22 [Nakamurella multipartita DSM 44233]
          Length = 139

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 42/106 (39%), Positives = 63/106 (59%), Gaps = 1/106 (0%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R++P K   V  +IRG+  +DA + L+F+ +  +  V K L SAVANAENN  L+ + LI
Sbjct: 21  RLTPMKARRVVNLIRGRSAADAASILQFAPQAASEPVAKLLASAVANAENNQGLNPESLI 80

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVS-DEGK 129
           V + YV +   +KRF  R + R  RI +  S +T+ +  VS D+ K
Sbjct: 81  VDKVYVNEGPTLKRFQPRAQGRAFRIRKRTSHITIELVSVSADQSK 126


>gi|254423331|ref|ZP_05037049.1| ribosomal protein L22 [Synechococcus sp. PCC 7335]
 gi|196190820|gb|EDX85784.1| ribosomal protein L22 [Synechococcus sp. PCC 7335]
          Length = 120

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 61/108 (56%)

Query: 14  DNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAE 73
           D++  A A  +R+SP+K+  V   IRG+   +AL  LEF   +    + K L SAVANAE
Sbjct: 7   DSQVKATAKFVRMSPRKVRRVLDQIRGRSYREALIMLEFMPYKSCEPILKVLRSAVANAE 66

Query: 74  NNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           +N+ LD   L +SEAY  +   +KRF  R + R  +I +P   + + V
Sbjct: 67  HNNGLDPVSLYISEAYADQGPVLKRFRPRAQGRAYQIRKPTCHIAIAV 114


>gi|148244334|ref|YP_001219028.1| 50S ribosomal protein L22 [Candidatus Vesicomyosocius okutanii HA]
 gi|226734101|sp|A5CXK9|RL22_VESOH RecName: Full=50S ribosomal protein L22
 gi|146326161|dbj|BAF61304.1| 50S ribosomal protein L22 [Candidatus Vesicomyosocius okutanii HA]
          Length = 110

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 58/104 (55%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A+    + S  K  LVA  IR K V +AL  L FS K+ A  V+K L S ++NAE+N
Sbjct: 3   EVKAVHKYAKTSAFKARLVADQIRLKSVEEALNILSFSNKKAAVLVKKVLNSVISNAEHN 62

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTV 119
             LD+D L V+  Y+ +   MKR   R + R  RI++  S +TV
Sbjct: 63  DGLDIDELFVTSIYIDEGSTMKRIRPRAKGRANRILKRTSHITV 106


>gi|11465775|ref|NP_053919.1| ribosomal protein L22 [Porphyra purpurea]
 gi|1710459|sp|P51309|RK22_PORPU RecName: Full=50S ribosomal protein L22, chloroplastic
 gi|1276775|gb|AAC08195.1| 50S ribosomal protein L22 [Porphyra purpurea]
          Length = 116

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 62/108 (57%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A+   +R+SP K+  V   IRG++  +AL  LEF   R    +++ L SA ANAE+N
Sbjct: 9   ETKAVGKYIRLSPHKVRRVLDQIRGRKYQEALIILEFMPYRACYHIKQILESAGANAEHN 68

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           + L+ ++L +++A+  K   +KRF  R + R   I +P   +T+ V E
Sbjct: 69  NGLNKNQLFITKAFADKGPTLKRFQPRAQGRAFPIHKPTCHITLGVSE 116


>gi|254391388|ref|ZP_05006591.1| 50S ribosomal protein L22 [Streptomyces clavuligerus ATCC 27064]
 gi|294814472|ref|ZP_06773115.1| 50S ribosomal protein L22 [Streptomyces clavuligerus ATCC 27064]
 gi|197705078|gb|EDY50890.1| 50S ribosomal protein L22 [Streptomyces clavuligerus ATCC 27064]
 gi|294327071|gb|EFG08714.1| 50S ribosomal protein L22 [Streptomyces clavuligerus ATCC 27064]
          Length = 126

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 66/114 (57%), Gaps = 3/114 (2%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A  +RV+P K   V  +IRG   ++A A L F+ +  +  V K L SA+ANA +N
Sbjct: 13  EARAQARYIRVTPMKARRVVDLIRGMDATEAQAVLRFAPQAASVPVGKVLDSAIANAAHN 72

Query: 76  HD-LDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           +D  D   L++SEAYV +   +KRF  R + R  RI +  S +TV+V   S EG
Sbjct: 73  YDHTDASTLVISEAYVDEGPTLKRFRPRAQGRAYRIRKRTSHITVVVS--SKEG 124


>gi|301122775|ref|XP_002909114.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gi|262099876|gb|EEY57928.1| conserved hypothetical protein [Phytophthora infestans T30-4]
          Length = 201

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 63/106 (59%)

Query: 24  LRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRL 83
           +R SP+KL  +A  IRG   ++A+  ++FS KR A   +KT+ +A+  A+  + ++ + L
Sbjct: 69  IRASPRKLTYLAQQIRGLSANEAILQMKFSPKRKAEIFQKTVQNAINLADIKYQIEPENL 128

Query: 84  IVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEGK 129
           +V+E +V K  ++KR    GR R G +  P + +TV++RE     K
Sbjct: 129 MVAECFVNKGTYLKRLRIMGRGRSGVMHHPHTHVTVVLREFDPSKK 174


>gi|160894751|ref|ZP_02075526.1| hypothetical protein CLOL250_02302 [Clostridium sp. L2-50]
 gi|156863685|gb|EDO57116.1| hypothetical protein CLOL250_02302 [Clostridium sp. L2-50]
          Length = 128

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 48/124 (38%), Positives = 66/124 (53%), Gaps = 3/124 (2%)

Query: 3   GKRSVSKRRMGDNE---ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAG 59
           G RS  KR   +N+    +A  S  RVS  K   V   IRGK V  AL  L ++ +  + 
Sbjct: 4   GHRSHDKRLRNENKDTRPSAKVSYARVSVTKACFVLDAIRGKDVQTALGILAYNPRYGSS 63

Query: 60  EVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTV 119
            + K L SA+ANAENN+ L  + L V+E Y  K   MKR H R + R  RI +  S +T+
Sbjct: 64  VIEKLLKSAIANAENNNGLKAEDLYVAECYANKGPTMKRVHPRAQGRAYRIEKRTSHITI 123

Query: 120 IVRE 123
           ++ E
Sbjct: 124 VLDE 127


>gi|34499636|ref|NP_903851.1| 50S ribosomal protein L22 [Chromobacterium violaceum ATCC 12472]
 gi|51316330|sp|Q7NQF7|RL22_CHRVO RecName: Full=50S ribosomal protein L22
 gi|34105486|gb|AAQ61841.1| 50S ribosomal protein L22 [Chromobacterium violaceum ATCC 12472]
          Length = 109

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 59/98 (60%)

Query: 24  LRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRL 83
           +R+S QK  LVA ++RGK V  AL  L FS K+ A  ++K L SA+ANAE+N   D+D L
Sbjct: 10  VRLSAQKCRLVADLVRGKSVDQALNILAFSPKKGAVIIKKVLESAIANAEHNEGADIDTL 69

Query: 84  IVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
            V+  +V K   +KRF  R + R  RI +    +++ V
Sbjct: 70  RVTSIFVDKGASLKRFTARAKGRGNRIEKQTCHISLTV 107


>gi|163840901|ref|YP_001625306.1| 50S ribosomal protein L22 [Renibacterium salmoninarum ATCC 33209]
 gi|189041960|sp|A9WSV4|RL22_RENSM RecName: Full=50S ribosomal protein L22
 gi|162954377|gb|ABY23892.1| LSU ribosomal protein L22P [Renibacterium salmoninarum ATCC 33209]
          Length = 121

 Score = 70.1 bits (170), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 66/117 (56%), Gaps = 5/117 (4%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AIA  +RV+P K   V  +IRGK+ ++ALA L+F+ +  +  V K L SAVANA   
Sbjct: 2   EAKAIARHIRVTPMKARRVVNLIRGKQANEALAILKFAPQAASEPVFKVLQSAVANARVL 61

Query: 76  HD-----LDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
            D      D   L +SEA+V +   MKRF  R + R  RI +  S +TV+V   + E
Sbjct: 62  ADRDSVAFDEGDLFISEAFVDEGPTMKRFQPRAQGRAYRIRKRTSHITVVVATPASE 118


>gi|291451908|ref|ZP_06591298.1| 50S ribosomal protein L22 [Streptomyces albus J1074]
 gi|291354857|gb|EFE81759.1| 50S ribosomal protein L22 [Streptomyces albus J1074]
          Length = 123

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 66/114 (57%), Gaps = 3/114 (2%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A  +RV+P K   V  +IRG   ++A A L F+ +  +  V K L SA+ANA +N
Sbjct: 10  EARAQARYIRVTPMKARRVVDLIRGMDATEAQAVLRFAPQAASVPVGKVLDSAIANAAHN 69

Query: 76  HD-LDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           +D  D   L++SEAYV +   +KRF  R + R  RI +  S +TV+V   S EG
Sbjct: 70  YDHTDASSLVISEAYVDEGPTLKRFRPRAQGRAYRIRKRTSHITVVVS--SKEG 121


>gi|282860815|ref|ZP_06269881.1| ribosomal protein L22 [Streptomyces sp. ACTE]
 gi|282564551|gb|EFB70087.1| ribosomal protein L22 [Streptomyces sp. ACTE]
          Length = 123

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 66/114 (57%), Gaps = 3/114 (2%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A  +RV+P K   V  +IRG   ++A A L F+ +  +  V K L SA+ANA +N
Sbjct: 10  EARAQARYIRVTPMKARRVVDLIRGMDATEAQAVLRFAPQAASVPVGKVLDSAIANAAHN 69

Query: 76  HD-LDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           +D  D   L++SEAYV +   +KRF  R + R  RI +  S +TV+V   S EG
Sbjct: 70  YDHTDASSLVISEAYVDEGPTLKRFRPRAQGRAYRIRKRTSHITVVVS--SKEG 121


>gi|296268555|ref|YP_003651187.1| 50S ribosomal protein L22 [Thermobispora bispora DSM 43833]
 gi|296091342|gb|ADG87294.1| ribosomal protein L22 [Thermobispora bispora DSM 43833]
          Length = 125

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 61/106 (57%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A     R +P+K   V  +IRG   S+A A L+F+ +  +  V K L SA+ANAE+N
Sbjct: 2   EARAQVRFARHTPRKARRVVDLIRGLPASEAQAVLKFAPQAASKTVYKVLQSAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
             LD D L VS A+V +   +KRF  R + R  RI +  S +TVIV
Sbjct: 62  FKLDKDTLWVSRAWVDEGPTLKRFRPRAQGRAYRINKRTSHITVIV 107


>gi|326442861|ref|ZP_08217595.1| 50S ribosomal protein L22 [Streptomyces clavuligerus ATCC 27064]
          Length = 115

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 66/114 (57%), Gaps = 3/114 (2%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A  +RV+P K   V  +IRG   ++A A L F+ +  +  V K L SA+ANA +N
Sbjct: 2   EARAQARYIRVTPMKARRVVDLIRGMDATEAQAVLRFAPQAASVPVGKVLDSAIANAAHN 61

Query: 76  HD-LDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           +D  D   L++SEAYV +   +KRF  R + R  RI +  S +TV+V   S EG
Sbjct: 62  YDHTDASTLVISEAYVDEGPTLKRFRPRAQGRAYRIRKRTSHITVVVS--SKEG 113


>gi|182436622|ref|YP_001824341.1| 50S ribosomal protein L22 [Streptomyces griseus subsp. griseus NBRC
           13350]
 gi|297192698|ref|ZP_06910096.1| 50S ribosomal protein L22 [Streptomyces pristinaespiralis ATCC
           25486]
 gi|326777244|ref|ZP_08236509.1| ribosomal protein L22 [Streptomyces cf. griseus XylebKG-1]
 gi|178465138|dbj|BAG19658.1| putative 50S ribosomal protein L22 [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|197721647|gb|EDY65555.1| 50S ribosomal protein L22 [Streptomyces pristinaespiralis ATCC
           25486]
 gi|320009097|gb|ADW03947.1| ribosomal protein L22 [Streptomyces flavogriseus ATCC 33331]
 gi|326657577|gb|EGE42423.1| ribosomal protein L22 [Streptomyces cf. griseus XylebKG-1]
          Length = 123

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 66/114 (57%), Gaps = 3/114 (2%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A  +RV+P K   V  +IRG   ++A A L F+ +  +  V K L SA+ANA +N
Sbjct: 10  EARAQARYIRVTPMKARRVVDLIRGMDATEAQAVLRFAPQAASVPVGKVLDSAIANAAHN 69

Query: 76  HD-LDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           +D  D   L++SEAYV +   +KRF  R + R  RI +  S +TV+V   S EG
Sbjct: 70  YDHTDASSLVISEAYVDEGPTLKRFRPRAQGRAYRIRKRTSHITVVVS--SKEG 121


>gi|126643091|ref|YP_001086075.1| 50S ribosomal protein L22 [Acinetobacter baumannii ATCC 17978]
 gi|184159593|ref|YP_001847932.1| 50S ribosomal protein L22 [Acinetobacter baumannii ACICU]
 gi|183211187|gb|ACC58585.1| 50S ribosomal protein L22 [Acinetobacter baumannii ACICU]
          Length = 91

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 56/89 (62%)

Query: 33  LVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLIVSEAYVGK 92
           +VA +IRGK V+ AL  L FS K+ A  V+K L SA+ANAE+N+ LDVD L VS  YV +
Sbjct: 1   MVADLIRGKSVAHALNILNFSNKKAAVLVKKALESAIANAEHNNSLDVDDLKVSTIYVDE 60

Query: 93  SVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
            + +KR   R + R  RI +    +TV V
Sbjct: 61  GMSLKRIMPRAKGRADRITKRTCHITVKV 89


>gi|299830383|ref|YP_003734598.1| ribosomal protein L22 [Kryptoperidinium foliaceum]
 gi|297385085|gb|ADI40383.1| ribosomal protein L22 [Kryptoperidinium foliaceum]
          Length = 115

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 63/107 (58%)

Query: 19  AIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDL 78
           A+A  +R+SP K+  V   IRG+   +AL  LEF   +  G + + + SA ANA++N+ L
Sbjct: 9   AVAKYIRMSPHKIRRVIDQIRGRSYQEALMILEFLPYQAGGPIWQVVHSAAANAKHNYGL 68

Query: 79  DVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVS 125
           D  +L++ E +  +   +KR   R + R  +I++P   +TV++ E++
Sbjct: 69  DKKKLVIDEIFADEGPKLKRIRPRAQGRAYKILKPTCHITVVMTEMN 115


>gi|24158670|pdb|1I4J|A Chain A, Crystal Structure Of L22 Ribosomal Protein Mutant
 gi|24158671|pdb|1I4J|B Chain B, Crystal Structure Of L22 Ribosomal Protein Mutant
          Length = 110

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 65/110 (59%), Gaps = 7/110 (6%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AIA  +R+SP+K+ LV  +IRGK + +A   L ++ KR A  V K L SA ANA NN
Sbjct: 2   EAKAIARYVRISPRKVRLVVDLIRGKSLEEARNILRYTNKRGAYFVAKVLESAAANAVNN 61

Query: 76  HDLDVDRLIVSEAYV--GKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           HD   DRL V  AYV  G +V  +    RGR  I  I +  S +TVI+ E
Sbjct: 62  HDALEDRLYVKAAYVDEGPAVLPR---ARGRADI--IKKRTSHITVILGE 106


>gi|124494175|gb|ABN13132.1| ribosomal protein L22 [Picris echioides phyllody phytoplasma]
          Length = 126

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 59/103 (57%)

Query: 19  AIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDL 78
           AIA  + ++P+K  LV  +IRGK + +A A L F+ K  +  V K L SA+ANA NN  L
Sbjct: 5   AIAKQMPITPRKTRLVVDLIRGKNIKEAQAILMFTPKSASPIVLKLLKSAIANATNNFGL 64

Query: 79  DVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           D   L V E +V + + + R   R + R  RI R  S +T++V
Sbjct: 65  DEKNLYVKEIFVNEGLRLTRLFPRAKGRADRIKRRTSHITIVV 107


>gi|258406180|ref|YP_003198922.1| 50S ribosomal protein L22 [Desulfohalobium retbaense DSM 5692]
 gi|257798407|gb|ACV69344.1| ribosomal protein L22 [Desulfohalobium retbaense DSM 5692]
          Length = 110

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 61/109 (55%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A+A  +RVSPQK  ++A  I+G  V DAL  L+F+ K+ A  + K L SAVANA   
Sbjct: 2   EVKALARFIRVSPQKTRVLAKNIQGMPVEDALNTLKFTPKKGANILSKVLQSAVANANQL 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV 124
             +D+D L V    + +    KR   R   R  RI++  S +TV+V E+
Sbjct: 62  PGMDIDALYVKRVCIDEGPTWKRIRPRAMGRATRILKRTSHITVVVDEL 110


>gi|126657993|ref|ZP_01729145.1| 50S ribosomal protein L22 [Cyanothece sp. CCY0110]
 gi|126620631|gb|EAZ91348.1| 50S ribosomal protein L22 [Cyanothece sp. CCY0110]
          Length = 120

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 60/107 (56%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
            EA A+A  +R+SP K+  V   IRG+   +AL  LEF   R    + K L SAVANAE+
Sbjct: 7   TEAKAVARYIRMSPFKVRRVLDQIRGRSYREALIILEFMPYRACEPILKLLRSAVANAEH 66

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           N  LD   L+VS+AY      ++R+  R + R  +I +P   +T+ V
Sbjct: 67  NQGLDPATLVVSKAYADGGPSLRRYRPRAQGRAYQIRKPTCHITIAV 113


>gi|162446962|ref|YP_001620094.1| 50S ribosomal protein L22 [Acholeplasma laidlawii PG-8A]
 gi|189041940|sp|A9NED8|RL22_ACHLI RecName: Full=50S ribosomal protein L22
 gi|161985069|gb|ABX80718.1| large subunit ribosomal protein L22 [Acholeplasma laidlawii PG-8A]
          Length = 111

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 42/109 (38%), Positives = 66/109 (60%), Gaps = 2/109 (1%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AI   +R++P+K+ LV  +IRGK V +A A L F+ +  +  + K L SA+ANA +N
Sbjct: 2   EAKAIGKTIRIAPRKVRLVVDLIRGKNVKEAQAILMFTPRGASPVIAKVLDSAIANATHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRP-FSRLTVIVRE 123
            +L+ + L V E +  +S+ MKR   R +   G ++R   S +TV+V E
Sbjct: 62  LNLNPENLFVKEVWANESITMKRMLPRAKGS-GHLIRKRTSHITVVVAE 109


>gi|256821667|ref|YP_003145630.1| 50S ribosomal protein L22 [Kangiella koreensis DSM 16069]
 gi|256795206|gb|ACV25862.1| ribosomal protein L22 [Kangiella koreensis DSM 16069]
          Length = 110

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/105 (43%), Positives = 62/105 (59%), Gaps = 3/105 (2%)

Query: 20  IASMLR---VSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           +A+ LR   +S QK+ LVA  IRG  V  AL  LEFS K+ A  ++K L SA+ANAE+N 
Sbjct: 3   VAAKLRNASISAQKMRLVADQIRGLPVEKALNVLEFSPKKAARLIKKVLESAIANAEHNE 62

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
             D+D L VS  +V +    KR   R + R  RI++  S +TV V
Sbjct: 63  GADIDELKVSTVFVDEGPTAKRMRPRAKGRGDRILKRSSHVTVKV 107


>gi|30248423|ref|NP_840493.1| ribosomal protein L22p / L17e [Nitrosomonas europaea ATCC 19718]
 gi|51316808|sp|Q82X83|RL22_NITEU RecName: Full=50S ribosomal protein L22
 gi|30138309|emb|CAD84317.1| Ribosomal protein L22p / L17e [Nitrosomonas europaea ATCC 19718]
          Length = 110

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 42/106 (39%), Positives = 62/106 (58%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E +A+   +R+S QK  LVA  IRG +V  A+  L FS K+ A  + K L SAVANAE+N
Sbjct: 2   ETSAVLRSVRLSAQKGRLVADQIRGLQVERAIRLLTFSPKKGASIILKLLESAVANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L +S+ ++G+   +KR   R + R  RI +P   + + V
Sbjct: 62  EGADIDELKISQIFIGQGATLKRVSPRAKGRGNRISKPTCNIFLTV 107


>gi|239943582|ref|ZP_04695519.1| 50S ribosomal protein L22 [Streptomyces roseosporus NRRL 15998]
 gi|239980051|ref|ZP_04702575.1| 50S ribosomal protein L22 [Streptomyces albus J1074]
 gi|239990035|ref|ZP_04710699.1| 50S ribosomal protein L22 [Streptomyces roseosporus NRRL 11379]
 gi|290958146|ref|YP_003489328.1| 50S ribosomal protein L22 [Streptomyces scabiei 87.22]
 gi|291447049|ref|ZP_06586439.1| 50S ribosomal protein L22 [Streptomyces roseosporus NRRL 15998]
 gi|215274929|sp|B1W402|RL22_STRGG RecName: Full=50S ribosomal protein L22
 gi|260647672|emb|CBG70777.1| 50S ribosomal protein L22 [Streptomyces scabiei 87.22]
 gi|291349996|gb|EFE76900.1| 50S ribosomal protein L22 [Streptomyces roseosporus NRRL 15998]
          Length = 115

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 66/114 (57%), Gaps = 3/114 (2%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A  +RV+P K   V  +IRG   ++A A L F+ +  +  V K L SA+ANA +N
Sbjct: 2   EARAQARYIRVTPMKARRVVDLIRGMDATEAQAVLRFAPQAASVPVGKVLDSAIANAAHN 61

Query: 76  HD-LDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           +D  D   L++SEAYV +   +KRF  R + R  RI +  S +TV+V   S EG
Sbjct: 62  YDHTDASSLVISEAYVDEGPTLKRFRPRAQGRAYRIRKRTSHITVVVS--SKEG 113


>gi|317131374|ref|YP_004090688.1| ribosomal protein L22 [Ethanoligenens harbinense YUAN-3]
 gi|315469353|gb|ADU25957.1| ribosomal protein L22 [Ethanoligenens harbinense YUAN-3]
          Length = 116

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 61/103 (59%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R++P+K+ +V  +IR K V  A+A L+ + K  +  + K L SA+ANAENNH +DV RL 
Sbjct: 11  RIAPRKVQIVLDLIRNKPVDVAVAILKHTPKSASEYLIKLLQSAIANAENNHAMDVSRLY 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           VSE +V     +KR   R   R   I++  S +T+ + E ++ 
Sbjct: 71  VSECFVCPGPMLKRIRPRAHGRAFPILKRTSHVTIALEEAAEP 113


>gi|315605904|ref|ZP_07880935.1| 50S ribosomal protein L22 [Actinomyces sp. oral taxon 180 str.
           F0310]
 gi|315312186|gb|EFU60272.1| 50S ribosomal protein L22 [Actinomyces sp. oral taxon 180 str.
           F0310]
          Length = 123

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 67/119 (56%), Gaps = 5/119 (4%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVAN---- 71
           EA A A  +RV+PQK   V   +RGK V +A   L F+ + +A +VRK L SAVAN    
Sbjct: 2   EAKAQARFIRVTPQKSRRVVNEVRGKGVLEAADILRFAPQAVATDVRKVLLSAVANSKVK 61

Query: 72  AEN-NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEGK 129
           AEN     +   L++ EAYV +   MKR   R + R GRI++  S +T++V    D+ K
Sbjct: 62  AENAGETFNEADLLILEAYVDEGPTMKRIRPRAQGRAGRILKRTSHITIVVGTKEDKKK 120


>gi|291547987|emb|CBL21095.1| LSU ribosomal protein L22P [Ruminococcus sp. SR1/5]
          Length = 129

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 66/125 (52%), Gaps = 4/125 (3%)

Query: 3   GKRSVSKRRMGDNE----ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIA 58
           G RS  KR   +N      +A  S  R+S QK   V   IRGK V  AL  L ++ +  +
Sbjct: 4   GHRSQIKRARNENNRETRPSAKLSYARISVQKACYVLDAIRGKDVQTALGILTYNPRYAS 63

Query: 59  GEVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLT 118
             ++K L SAVANAENN+ ++ D L V+  Y  K   MKR   R + R  RI +  S +T
Sbjct: 64  SVIKKLLESAVANAENNNGMNADNLYVAACYADKGPTMKRIQPRAQGRAYRIEKRTSHIT 123

Query: 119 VIVRE 123
           V++ E
Sbjct: 124 VVLDE 128


>gi|289449479|ref|YP_003475779.1| 50S ribosomal protein L22 [Clostridiales genomosp. BVAB3 str.
           UPII9-5]
 gi|289184026|gb|ADC90451.1| ribosomal protein L22 [Clostridiales genomosp. BVAB3 str. UPII9-5]
          Length = 158

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 68/112 (60%)

Query: 12  MGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVAN 71
           +G ++  A A  +R++P+K+N+V  +I+ K +++ALA L+++ K  +  + K L SA AN
Sbjct: 45  IGKDQGLATAKNVRIAPRKVNIVIKLIKNKSLNEALAILQYTPKAASVVLTKLLKSAEAN 104

Query: 72  AENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           A NN++L+ D L V+  +      +KR   R R    RI +  S +TV+++E
Sbjct: 105 AVNNNELNSDNLYVTSCFANPGPVLKRIMPRARGSANRINKRTSHVTVVLKE 156


>gi|42524370|ref|NP_969750.1| 50S ribosomal protein L22 [Bdellovibrio bacteriovorus HD100]
 gi|51316231|sp|Q6MJ19|RL22_BDEBA RecName: Full=50S ribosomal protein L22
 gi|39576579|emb|CAE80743.1| 50S ribosomal protein L22 [Bdellovibrio bacteriovorus HD100]
          Length = 110

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 60/108 (55%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A     RV  QK  LVA ++RGK V++A+  L F  K+ AG V+K + SAVANAE  
Sbjct: 2   EVKASLKYARVGAQKARLVADLVRGKDVNEAVKTLTFLNKKTAGMVKKLIESAVANAEYK 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
             +DVD L V   +V +   +KRF  R + R   + +  S + V++ E
Sbjct: 62  KVMDVDSLYVKAIWVDQGPVLKRFRPRAQGRAFGVRKKTSHINVVLEE 109


>gi|325261499|ref|ZP_08128237.1| ribosomal protein L22 [Clostridium sp. D5]
 gi|324032953|gb|EGB94230.1| ribosomal protein L22 [Clostridium sp. D5]
          Length = 128

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 65/124 (52%), Gaps = 3/124 (2%)

Query: 3   GKRSVSKRR---MGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAG 59
           G RS  KR      D   +A  S  RVS QK   V   IRGK V  AL  L ++ +  + 
Sbjct: 4   GHRSQIKRERNEQKDTRPSAKISYARVSVQKACFVLDAIRGKDVQTALGILAYNPRYASS 63

Query: 60  EVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTV 119
            + K L SA+ANAENN+ ++V+ L + E +  K   MKR   R + R  RI +  S +T+
Sbjct: 64  VIEKLLKSAIANAENNNGMNVENLYIEECFANKGPTMKRIKPRAQGRAYRIEKRMSHITI 123

Query: 120 IVRE 123
           ++ E
Sbjct: 124 VLNE 127


>gi|238922835|ref|YP_002936348.1| 50S ribosomal protein L22 [Eubacterium rectale ATCC 33656]
 gi|259646246|sp|C4ZBS4|RL22_EUBR3 RecName: Full=50S ribosomal protein L22
 gi|238874507|gb|ACR74214.1| 50S ribosomal protein L22 [Eubacterium rectale ATCC 33656]
 gi|291523737|emb|CBK89324.1| LSU ribosomal protein L22P [Eubacterium rectale DSM 17629]
 gi|291528797|emb|CBK94383.1| LSU ribosomal protein L22P [Eubacterium rectale M104/1]
          Length = 131

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 48/127 (37%), Positives = 69/127 (54%), Gaps = 6/127 (4%)

Query: 3   GKRSVSKRRMG---DNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAG 59
           G RS  KR      D   +A  S  RVS QK   V   IRGK V++ALA + ++ +  + 
Sbjct: 4   GHRSKIKRERNEVRDTRPSAKLSYARVSVQKACFVLDAIRGKSVNEALAIVTYNPRYASS 63

Query: 60  EVRKTLCSAVANAENNH---DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSR 116
            V+K L SA+ANAENN+   +   + L V+E +  K   MKR H R + R  RI +  S 
Sbjct: 64  LVKKLLESAIANAENNYPEKNYKAENLYVAECFANKGPTMKRIHPRAQGRAYRIEKRMSH 123

Query: 117 LTVIVRE 123
           +T+++ E
Sbjct: 124 ITIVLDE 130


>gi|297201734|ref|ZP_06919131.1| ribosomal protein L22 [Streptomyces sviceus ATCC 29083]
 gi|197710891|gb|EDY54925.1| ribosomal protein L22 [Streptomyces sviceus ATCC 29083]
          Length = 120

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 66/114 (57%), Gaps = 3/114 (2%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A  +RV+P K   V  +IRG   ++A A L F+ +  +  V K L SA+ANA +N
Sbjct: 7   EARAQARYIRVTPMKARRVVDLIRGMDATEAQAVLRFAPQAASVPVGKVLDSAIANAAHN 66

Query: 76  HD-LDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           +D  D   L++SEAYV +   +KRF  R + R  RI +  S +TV+V   S EG
Sbjct: 67  YDHTDAGSLVISEAYVDEGPTLKRFRPRAQGRAYRIRKRTSHITVVVS--SKEG 118


>gi|156372892|ref|XP_001629269.1| predicted protein [Nematostella vectensis]
 gi|156216265|gb|EDO37206.1| predicted protein [Nematostella vectensis]
          Length = 112

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 63/103 (61%), Gaps = 5/103 (4%)

Query: 24  LRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDL-DVDR 82
           +R  P+K+NLVA  IRG  V++A+  +EFS K+ A  V++ L  A   A+ N+ + D + 
Sbjct: 11  VRSGPRKMNLVARQIRGLSVTEAIKQMEFSPKKAATTVKEVLQEAQNTAQRNYGIEDKEN 70

Query: 83  LIVSEAYVGKSVFMK--RFHCRGRQRIGRIVRPFSRLTVIVRE 123
           L V+E+YVGK  + K  R+H RGR  I  +   +S   +++RE
Sbjct: 71  LWVAESYVGKGKYFKKLRYHARGRFGIEHV--HYSHYFLVLRE 111


>gi|82701905|ref|YP_411471.1| ribosomal protein L22 [Nitrosospira multiformis ATCC 25196]
 gi|109893213|sp|Q2YAZ2|RL22_NITMU RecName: Full=50S ribosomal protein L22
 gi|82409970|gb|ABB74079.1| LSU ribosomal protein L22P [Nitrosospira multiformis ATCC 25196]
          Length = 115

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 59/106 (55%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A+   +R+S QK  LVA  IRG  V  AL  L FS K+ A  +RK L SA+ANAE+N
Sbjct: 2   ETTAVLRGVRLSEQKGRLVADQIRGLPVERALNLLAFSPKKAAVIIRKLLESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L VS  YV +   + R   R + R  RIV+P   + + V
Sbjct: 62  EGADIDELKVSRIYVDRGPSLMRTSARAKGRGNRIVKPTCHILLTV 107


>gi|152964662|ref|YP_001360446.1| 50S ribosomal protein L22 [Kineococcus radiotolerans SRS30216]
 gi|226733474|sp|A6W5U3|RL22_KINRD RecName: Full=50S ribosomal protein L22
 gi|151359179|gb|ABS02182.1| ribosomal protein L22 [Kineococcus radiotolerans SRS30216]
          Length = 126

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 43/111 (38%), Positives = 64/111 (57%), Gaps = 5/111 (4%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A    LRV+PQK   V  ++RGK+ ++A+A L F+ +  A  VRK + SA+ANA+ +
Sbjct: 2   EAKAQTRYLRVTPQKARRVVDLVRGKQATEAVAVLSFAPQSAAEPVRKLVESAMANAKFH 61

Query: 76  HD-----LDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
            D      D    +V   +V +   MKRF  R + R GRI++  S +TV+V
Sbjct: 62  ADKHSEAFDPAEYVVKAIHVDEGPTMKRFRPRAQGRAGRILKRTSHITVVV 112


>gi|320335518|ref|YP_004172229.1| 50S ribosomal protein L22 [Deinococcus maricopensis DSM 21211]
 gi|319756807|gb|ADV68564.1| ribosomal protein L22 [Deinococcus maricopensis DSM 21211]
          Length = 111

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 61/107 (57%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A AIA  +R++P+K+ LV  +IRGK V DA   L F  +  +  V K L SA ANA NNH
Sbjct: 3   AKAIAKYIRIAPRKVRLVVDVIRGKNVRDAEDLLRFIPRGASEPVSKVLKSAKANAVNNH 62

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           D+  DRL V++ +V     +KR   R R     I +  S +T+I+ E
Sbjct: 63  DMIEDRLYVAQVFVDAGPTLKRLLPRARGAANIIKKRTSHITIILEE 109


>gi|291558161|emb|CBL35278.1| LSU ribosomal protein L22P [Eubacterium siraeum V10Sc8a]
          Length = 111

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 65/108 (60%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A    +R+SP+K+ +V  +IR K    A+A L+ + K  +  ++K L SA+ANAENN
Sbjct: 2   EARAELRQVRISPRKVGVVLDLIRNKPCDMAMAILKHTPKSASEPLQKLLKSAMANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           H +D+ +  VS  +VG  V +KR   +   R  RI++  S + ++V+E
Sbjct: 62  HSMDLSKCYVSCCHVGAGVTLKRIRHKDHGRAHRILKRTSNIVLVVKE 109


>gi|56751879|ref|YP_172580.1| 50S ribosomal protein L22 [Synechococcus elongatus PCC 6301]
 gi|81301036|ref|YP_401244.1| 50S ribosomal protein L22 [Synechococcus elongatus PCC 7942]
 gi|3122705|sp|O24694|RL22_SYNP6 RecName: Full=50S ribosomal protein L22
 gi|109893247|sp|Q31L12|RL22_SYNE7 RecName: Full=50S ribosomal protein L22
 gi|2446895|dbj|BAA22454.1| 50S ribosomal protein L22 [Synechococcus elongatus PCC 6301]
 gi|56686838|dbj|BAD80060.1| 50S ribosomal protein L22 [Synechococcus elongatus PCC 6301]
 gi|81169917|gb|ABB58257.1| LSU ribosomal protein L22P [Synechococcus elongatus PCC 7942]
          Length = 117

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 60/107 (56%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
           NE  AIA  +R+SP K+  V   +RG+   +AL  LEF   +    + K L SAVANAE+
Sbjct: 7   NEVKAIARYIRMSPSKVRRVLDQLRGRSYREALILLEFMPYKSCEPILKVLRSAVANAEH 66

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           N  LD  +L++S+AY      +KRF  R + R  +I +    +T+ V
Sbjct: 67  NQGLDPTQLVISQAYADMGPSLKRFRPRAQGRAYQIRKQTCHITIAV 113


>gi|304391023|ref|ZP_07372975.1| 50S ribosomal protein L22 [Mobiluncus curtisii subsp. curtisii ATCC
           35241]
 gi|304325906|gb|EFL93152.1| 50S ribosomal protein L22 [Mobiluncus curtisii subsp. curtisii ATCC
           35241]
          Length = 235

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 63/113 (55%), Gaps = 5/113 (4%)

Query: 24  LRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN-----NHDL 78
           +RV+PQK   +   +RG   + AL  L+F+ ++ A  +RKTL SA+ANAE          
Sbjct: 10  VRVTPQKARRIMNEVRGMEANKALDLLKFAPQKPALPIRKTLVSALANAEQAARNAGTSF 69

Query: 79  DVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEGKVV 131
           + D + V EAYV     MKRF  R + R  RI++  S LT++V +  D+ ++ 
Sbjct: 70  NSDEMYVVEAYVNDGPTMKRFRARAQGRGARILKRTSHLTIVVGDAEDKKELA 122


>gi|291518040|emb|CBK73261.1| LSU ribosomal protein L22P [Butyrivibrio fibrisolvens 16/4]
          Length = 129

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 66/122 (54%), Gaps = 3/122 (2%)

Query: 3   GKRSVSKRR---MGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAG 59
           G RS  KR    + D   +A  S  R+S QK   V   IRGK V  ALA + ++ +  + 
Sbjct: 4   GHRSQIKRERNDVKDTRPSAKLSYARMSVQKACFVLDAIRGKDVDTALAIVMYNPRYASS 63

Query: 60  EVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTV 119
            + K L SA+ANAENN+ LD   L+V+E Y  K   MKR   R + R  RI +  S LT+
Sbjct: 64  VIEKLLKSAIANAENNNGLDRKDLVVAECYANKGPTMKRIRPRAQGRAYRIEKRMSHLTI 123

Query: 120 IV 121
           ++
Sbjct: 124 VL 125


>gi|298345467|ref|YP_003718154.1| 50S ribosomal protein L22 [Mobiluncus curtisii ATCC 43063]
 gi|298235528|gb|ADI66660.1| 50S ribosomal protein L22 [Mobiluncus curtisii ATCC 43063]
          Length = 235

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 63/113 (55%), Gaps = 5/113 (4%)

Query: 24  LRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN-----NHDL 78
           +RV+PQK   +   +RG   + AL  L+F+ ++ A  +RKTL SA+ANAE          
Sbjct: 10  VRVTPQKARRIMNEVRGMEANKALDLLKFAPQKPALPIRKTLVSALANAEQAARNAGTSF 69

Query: 79  DVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEGKVV 131
           + D + V EAYV     MKRF  R + R  RI++  S LT++V +  D+ ++ 
Sbjct: 70  NSDEMYVVEAYVNDGPTMKRFRARAQGRGARILKRTSHLTIVVGDAEDKKELA 122


>gi|220906724|ref|YP_002482035.1| 50S ribosomal protein L22 [Cyanothece sp. PCC 7425]
 gi|219863335|gb|ACL43674.1| ribosomal protein L22 [Cyanothece sp. PCC 7425]
          Length = 119

 Score = 69.3 bits (168), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 58/105 (55%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A A  +R+SP K+  V   IRG+   +AL  LEF   R    + K L SAVANAE+N 
Sbjct: 10  AYATARYIRMSPHKVRRVLDQIRGRSYREALIILEFMPYRACDPILKVLRSAVANAEHNE 69

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
            L+   L+VS+AY  +   +KRF  R + R   I +P   +T+ V
Sbjct: 70  GLNPTDLVVSQAYADQGPSLKRFRPRAQGRAYPIRKPTCHITIAV 114


>gi|186684505|ref|YP_001867701.1| 50S ribosomal protein L22 [Nostoc punctiforme PCC 73102]
 gi|226733491|sp|B2ITQ0|RL22_NOSP7 RecName: Full=50S ribosomal protein L22
 gi|186466957|gb|ACC82758.1| ribosomal protein L22 [Nostoc punctiforme PCC 73102]
          Length = 118

 Score = 69.3 bits (168), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 59/107 (55%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
            E  AIA  +R+S  K+  V   IRG+   +AL  LEF   R    + K L SA ANAE+
Sbjct: 6   TEVKAIARFIRISAYKVRRVLDQIRGRSYREALIILEFMPYRATEPILKVLRSAAANAEH 65

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           N  LD  +L++++AY  +   +KRF  R + R  +I +P   +TV V
Sbjct: 66  NAGLDRTQLVITQAYADQGPPLKRFQPRAQGRAYQIRKPTCHITVAV 112


>gi|193216756|ref|YP_001999998.1| 50S ribosomal protein L22 [Mycoplasma arthritidis 158L3-1]
 gi|215274836|sp|B3PMP2|RL22_MYCA5 RecName: Full=50S ribosomal protein L22
 gi|193002079|gb|ACF07294.1| ribosomal protein L22 [Mycoplasma arthritidis 158L3-1]
          Length = 210

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 65/110 (59%), Gaps = 2/110 (1%)

Query: 18  NAIASM--LRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A+AS+   R+SP+K  LVA +IR K  + AL  L+ + K+ +G + K L SA+ANA NN
Sbjct: 9   SAVASVKAQRISPRKARLVADLIRYKTATQALIILQTTNKKASGIILKLLNSAIANATNN 68

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVS 125
           + LD  +L+V+E  V     +KR+    R R   I++  S   + V EVS
Sbjct: 69  NGLDATKLVVTEILVNDGPTLKRYQPHSRGRAYPILKRTSHFFIRVSEVS 118


>gi|167771262|ref|ZP_02443315.1| hypothetical protein ANACOL_02620 [Anaerotruncus colihominis DSM
           17241]
 gi|167666513|gb|EDS10643.1| hypothetical protein ANACOL_02620 [Anaerotruncus colihominis DSM
           17241]
          Length = 111

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 60/108 (55%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A     R+SP+K+ +V  +IR K    A+A L  + K     + K L SA+ANAENN
Sbjct: 2   EAKASLRHARISPRKVQIVLDLIRNKPADQAMAILRHTPKAACEPLSKLLKSAMANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            ++D D L VSE YV     MKR   R + R  R+++  S + + V+E
Sbjct: 62  FNMDRDSLYVSECYVTPGPTMKRIRPRAQGRAFRVLKRTSHVFITVKE 109


>gi|84494781|ref|ZP_00993900.1| 50S ribosomal protein L22 [Janibacter sp. HTCC2649]
 gi|84384274|gb|EAQ00154.1| 50S ribosomal protein L22 [Janibacter sp. HTCC2649]
          Length = 133

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/111 (38%), Positives = 62/111 (55%), Gaps = 5/111 (4%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A  +RV+PQK   V  +IRGK  ++A+A L F+ +  +  + K L SA+ANA   
Sbjct: 10  EARAQARSVRVTPQKARRVIDLIRGKNATEAIATLRFAPQGASDPILKVLESAIANARFK 69

Query: 76  HD-----LDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
            D      D   L+++ AYV +   MKRF  R + R  RI +  S +TV+V
Sbjct: 70  ADKTAERFDEHELVITSAYVDEGATMKRFRPRAQGRASRINKRTSHITVVV 120


>gi|148655332|ref|YP_001275537.1| 50S ribosomal protein L22 [Roseiflexus sp. RS-1]
 gi|166221991|sp|A5USI4|RL22_ROSS1 RecName: Full=50S ribosomal protein L22
 gi|148567442|gb|ABQ89587.1| LSU ribosomal protein L22P [Roseiflexus sp. RS-1]
          Length = 113

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/114 (37%), Positives = 64/114 (56%), Gaps = 4/114 (3%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A A+   +R+SP K+  V  ++RGK V  ALA L +   + A E+ +T+ SA ANA NN
Sbjct: 2   QAKAVTKYVRISPTKVRPVMDLVRGKPVDRALAILRYLPHKAAREIARTIESARANATNN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEGK 129
           +D+  D LIV   +  +    KR   R R R  RI +  + +TVIV    D+G+
Sbjct: 62  YDMAPDALIVKYIFADEGPAFKRIMPRARGRADRIRKRTTHITVIV----DDGE 111


>gi|323483296|ref|ZP_08088686.1| 50S ribosomal protein L22 [Clostridium symbiosum WAL-14163]
 gi|323691206|ref|ZP_08105482.1| 50S ribosomal protein L22 [Clostridium symbiosum WAL-14673]
 gi|323403394|gb|EGA95702.1| 50S ribosomal protein L22 [Clostridium symbiosum WAL-14163]
 gi|323504725|gb|EGB20511.1| 50S ribosomal protein L22 [Clostridium symbiosum WAL-14673]
          Length = 128

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 66/124 (53%), Gaps = 3/124 (2%)

Query: 3   GKRSVSKRR---MGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAG 59
           G RS  KR      D   +A  S  RVS QK   V   IRGK V  AL  + ++ +  + 
Sbjct: 4   GHRSQIKRERNAQKDTRPSAKLSYARVSVQKACFVLDAIRGKDVQTALGIVTYNSRYAST 63

Query: 60  EVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTV 119
            ++K L SA+ANAENN+ ++ + L V+E Y  K   MKR   R + R  RI +  S +T+
Sbjct: 64  LIKKLLESAIANAENNNQMNPENLYVAECYANKGPTMKRVKPRAQGRAYRIEKRMSHITI 123

Query: 120 IVRE 123
           ++ E
Sbjct: 124 VLDE 127


>gi|238921437|ref|YP_002934952.1| 50S ribosomal protein L22, putative [Edwardsiella ictaluri 93-146]
 gi|238871006|gb|ACR70717.1| 50S ribosomal protein L22, putative [Edwardsiella ictaluri 93-146]
          Length = 91

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 58/90 (64%)

Query: 34  VAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKS 93
           +A +IRGK+VS AL  L ++ K+ A  V+K L SA+ANAE+N   D+D L VS+ +V + 
Sbjct: 1   MADLIRGKKVSQALEVLTYTNKKAAVLVKKVLESAIANAEHNDGADIDDLKVSKIFVDEG 60

Query: 94  VFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
             MKR   R + R  RI++  S +TV+V +
Sbjct: 61  PTMKRIMPRAKGRADRILKRTSHITVVVSD 90


>gi|284929566|ref|YP_003422088.1| 50S ribosomal protein L22P [cyanobacterium UCYN-A]
 gi|284810010|gb|ADB95707.1| LSU ribosomal protein L22P [cyanobacterium UCYN-A]
          Length = 120

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 59/107 (55%)

Query: 15  NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN 74
            EA AI+  +R+SP K+  V   IRG+   +AL  LEF   +    + K L SAVANAE+
Sbjct: 7   TEAKAISKYIRMSPFKVRRVLDQIRGRSYREALIILEFMPYKACEPIIKLLRSAVANAEH 66

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           N  LD   L +S+AY      +KRF  R + R  +I +P   +T+ V
Sbjct: 67  NKGLDPATLFISKAYADGGPSLKRFRPRAQGRAYQIRKPTCHITIAV 113


>gi|315655876|ref|ZP_07908774.1| 50S ribosomal protein L22 [Mobiluncus curtisii ATCC 51333]
 gi|315489940|gb|EFU79567.1| 50S ribosomal protein L22 [Mobiluncus curtisii ATCC 51333]
          Length = 230

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 63/113 (55%), Gaps = 5/113 (4%)

Query: 24  LRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN-----NHDL 78
           +RV+PQK   +   +RG   + AL  L+F+ ++ A  +RKTL SA+ANAE          
Sbjct: 10  VRVTPQKARRIMNEVRGMEANKALDLLKFAPQKPALPIRKTLVSALANAEQAARNAGTSF 69

Query: 79  DVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEGKVV 131
           + D + + EAYV     MKRF  R + R  RI++  S LT++V +  D+ ++ 
Sbjct: 70  NSDEMYIVEAYVNDGPTMKRFRARAQGRGARILKRTSHLTIVVGDAEDKKELA 122


>gi|226356892|ref|YP_002786632.1| 50S ribosomal protein L22 [Deinococcus deserti VCD115]
 gi|259646240|sp|C1CXG1|RL22_DEIDV RecName: Full=50S ribosomal protein L22
 gi|226318882|gb|ACO46878.1| putative 50S ribosomal protein L22 [Deinococcus deserti VCD115]
          Length = 139

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 45/108 (41%), Positives = 63/108 (58%)

Query: 19  AIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDL 78
           AIA  +R+SP+K+ LV  +IRGK VSDA A L F  K  +  V K L SA  NA +N ++
Sbjct: 26  AIAKYVRMSPRKVRLVVDVIRGKSVSDAEAILRFLPKSASEPVAKVLNSAKHNALHNDEM 85

Query: 79  DVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSD 126
             DRL+++ AYV     +KR   R R     + +  S +T+IV E +D
Sbjct: 86  LEDRLVITAAYVDAGPTLKRLIPRARGSANILKKRTSHITIIVGERND 133


>gi|325981810|ref|YP_004294212.1| 50S ribosomal protein L22 [Nitrosomonas sp. AL212]
 gi|325531329|gb|ADZ26050.1| ribosomal protein L22 [Nitrosomonas sp. AL212]
          Length = 118

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 58/101 (57%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R+S QK  LVA  IRG  V  AL+ L FS K+ A  + K L SA+ANAE+N   D+D L 
Sbjct: 11  RISAQKCRLVADQIRGLAVDRALSILTFSSKKGAELIHKLLESAIANAEHNDGADIDELK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVS 125
           +S   V +   MKR   R + R  +IV+P   +++ + + S
Sbjct: 71  ISSIMVDQGTSMKRTSARAKGRGNKIVKPTCHISLTLSDGS 111


>gi|225016280|ref|ZP_03705472.1| hypothetical protein CLOSTMETH_00183 [Clostridium methylpentosum
           DSM 5476]
 gi|224950955|gb|EEG32164.1| hypothetical protein CLOSTMETH_00183 [Clostridium methylpentosum
           DSM 5476]
          Length = 111

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 60/108 (55%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A     R++P+K+ +V  +IRGK  ++A+A L+ + K    ++ K L SA ANAE N
Sbjct: 2   EATAKLKFTRIAPRKVQIVLDLIRGKDTAEAMAILKHTPKAACEDLEKLLKSACANAETN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
             +D D L VS  YV     +KR   R + R  R+ +  S +T+ V E
Sbjct: 62  FHMDKDNLYVSSCYVTPGPILKRIRPRAQGRAFRVFKRTSHVTLSVSE 109


>gi|299143189|ref|ZP_07036269.1| ribosomal protein L22 [Peptoniphilus sp. oral taxon 386 str. F0131]
 gi|298517674|gb|EFI41413.1| ribosomal protein L22 [Peptoniphilus sp. oral taxon 386 str. F0131]
          Length = 111

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 70/108 (64%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AIA  +R+SP K+N + A IRGK+V +AL+ L+F+ KR A E+ K L SAVANAENN
Sbjct: 2   EARAIAKYVRISPLKVNYICAEIRGKQVDEALSILKFTPKRGAKELYKVLNSAVANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            +L+ D L V +AY      MKRFH + +     I++  S + V+V E
Sbjct: 62  LNLNRDNLYVKKAYANDGPTMKRFHPKAKGMAYPILKRSSHIGVVVAE 109


>gi|212704588|ref|ZP_03312716.1| hypothetical protein DESPIG_02650 [Desulfovibrio piger ATCC 29098]
 gi|212671987|gb|EEB32470.1| hypothetical protein DESPIG_02650 [Desulfovibrio piger ATCC 29098]
          Length = 112

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 62/108 (57%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E+ AIA   RVSP+K  LVA  ++GK V +A+  L F+  + AG +   L SAVANA   
Sbjct: 2   ESKAIAKFQRVSPRKTRLVAKNVQGKGVEEAMNILRFTPNKPAGVLLNVLKSAVANASQL 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
             ++VD +++ E  V +    KRF  R + R  +I +  S +TVI+ E
Sbjct: 62  GGVNVDAMVIKEVIVNEGPTWKRFMPRAQGRATKIHKRTSHVTVILAE 109


>gi|33519663|ref|NP_878495.1| 50S ribosomal subunit protein L22 [Candidatus Blochmannia
           floridanus]
 gi|51316364|sp|Q7VQE3|RL22_BLOFL RecName: Full=50S ribosomal protein L22
 gi|33517326|emb|CAD83711.1| 50S ribosomal subunit protein L22 [Candidatus Blochmannia
           floridanus]
          Length = 109

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 62/100 (62%)

Query: 24  LRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRL 83
           +R S QK+ LVA MIR K V  A+  L +  K+ A  V+KTL SA+ANAE+N  L++D+L
Sbjct: 10  IRSSAQKIRLVANMIRKKEVVKAINILNYVNKKAALLVKKTLESAIANAEHNFGLNIDKL 69

Query: 84  IVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
            V + +V     +KR   R + R  RIV+  S LT++V +
Sbjct: 70  RVVKIFVDCGPSIKRVMPRAKGRSDRIVKRTSHLTIVVSD 109


>gi|108804969|ref|YP_644906.1| 50S ribosomal protein L22P [Rubrobacter xylanophilus DSM 9941]
 gi|122975884|sp|Q1AU34|RL22_RUBXD RecName: Full=50S ribosomal protein L22
 gi|108766212|gb|ABG05094.1| LSU ribosomal protein L22P [Rubrobacter xylanophilus DSM 9941]
          Length = 127

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/101 (41%), Positives = 57/101 (56%)

Query: 19  AIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDL 78
           A+A  +R+SP+K  LVA  IRGK   +A + L F+ KR A  +   L SA ANAENNHD 
Sbjct: 3   AVAKYVRISPRKARLVADQIRGKSYPEAASILRFTNKRAARILGDVLKSAAANAENNHDA 62

Query: 79  DVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTV 119
           D + L V E  V +   +KR+  R   R   I +  S +T+
Sbjct: 63  DPELLFVEEVRVDEGPTIKRYRPRALGRATMIRKRTSHITL 103


>gi|332178460|gb|AEE14149.1| ribosomal protein L22 [Thermodesulfobium narugense DSM 14796]
          Length = 119

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/106 (39%), Positives = 61/106 (57%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A++  +R+SP+K+  +  ++ GK+V  AL  L     + A  + K   SAVANAENN
Sbjct: 2   EVRAVSKYVRISPKKVQEIIHLLPGKQVDVALNSLSVMPHKAARILYKVTKSAVANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
            +LD   LIVS+A+  K   MKRF  R   R   I++  S +TV+V
Sbjct: 62  FNLDRKDLIVSKAFADKGPSMKRFTPRAYGRAFPILKRTSHITVVV 107


>gi|253580624|ref|ZP_04857888.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251847995|gb|EES75961.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 129

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 48/127 (37%), Positives = 68/127 (53%), Gaps = 8/127 (6%)

Query: 3   GKRSVSKRRMGDNEAN------AIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKR 56
           G RS  KR    NE+N      A  S  R+S QK   V  +IRGK V  AL  L ++ + 
Sbjct: 4   GHRSQIKR--ARNESNRETRPSAKLSYARISVQKACYVLDVIRGKDVQTALGILTYNPRY 61

Query: 57  IAGEVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSR 116
            +  ++K L SA+ANAENN+ ++ D L V+  Y  K   MKR   R + R  RI +  S 
Sbjct: 62  ASSVIKKLLESAIANAENNNGMNADNLYVAACYADKGPTMKRIQPRAQGRAYRIEKRTSH 121

Query: 117 LTVIVRE 123
           +T+++ E
Sbjct: 122 ITIVLDE 128


>gi|315656198|ref|ZP_07909089.1| 50S ribosomal protein L22 [Mobiluncus curtisii subsp. holmesii ATCC
           35242]
 gi|315493200|gb|EFU82800.1| 50S ribosomal protein L22 [Mobiluncus curtisii subsp. holmesii ATCC
           35242]
          Length = 244

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 60/109 (55%), Gaps = 5/109 (4%)

Query: 24  LRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN-----NHDL 78
           +RV+PQK   +   +RG     AL  L+F+ ++ A  +RKTL SA+ANAE          
Sbjct: 24  VRVTPQKARRIMNEVRGMEADKALDLLKFAPQKPALPIRKTLVSALANAEQAARNAGTSF 83

Query: 79  DVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           + D + + EAYV     MKRF  R + R  RI++  S LT++V +  D+
Sbjct: 84  NSDEMYIVEAYVNDGPTMKRFRARAQGRGARILKRTSHLTIVVGDAEDK 132


>gi|166033619|gb|ABY78837.1| ribosomal protein L22 [Potato purple top phytoplasma YN-169]
          Length = 122

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 67/116 (57%)

Query: 12  MGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVAN 71
           M    A AIA  + ++P+K+ LV  +IRGK++  A A L F+ K  A  V K L SAVAN
Sbjct: 1   METKNATAIARKVSIAPRKVRLVVDLIRGKKIDQAQAILTFTPKASAFVVLKLLNSAVAN 60

Query: 72  AENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE 127
           A NN  L+ ++L V E +V + + +KR   R +     I +  S +T++V+ + +E
Sbjct: 61  ALNNLKLEREQLYVKEVFVNEGLRLKRIFPRAKGSGDMIKKRTSHITLVVQTLKEE 116


>gi|300782613|ref|YP_003762904.1| 50S ribosomal protein L22 [Amycolatopsis mediterranei U32]
 gi|299792127|gb|ADJ42502.1| large subunit ribosomal protein L22 [Amycolatopsis mediterranei
           U32]
          Length = 139

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/105 (41%), Positives = 59/105 (56%)

Query: 17  ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNH 76
           A A A  +R SP K+  V  +I+G+  +DALA L F+ +  +  V K L SAVANAENN 
Sbjct: 16  AYARARFVRDSPTKVRRVIELIKGRSAADALAVLRFAPQAASEPVAKVLASAVANAENNL 75

Query: 77  DLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
            LD + L V  AY  +   +KR   R + R  RI +  S +TV V
Sbjct: 76  QLDPETLWVKNAYADEGPTLKRIRPRAQGRAYRIRKRTSHITVEV 120


>gi|330850878|ref|YP_004376628.1| 50S ribosomal protein L22 [Fistulifera sp. JPCC DA0580]
 gi|328835698|dbj|BAK18994.1| 50S ribosomal protein L22 [Fistulifera sp. JPCC DA0580]
          Length = 115

 Score = 68.6 bits (166), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 62/107 (57%)

Query: 19  AIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDL 78
           A+A  +R+SP K+  V   IRG+   +AL  LEF      G + + + SA ANA++N+ L
Sbjct: 9   AVAKYIRMSPHKIRRVLDQIRGRSYQEALMILEFLPYDAGGPIWQVVHSAAANAKHNYGL 68

Query: 79  DVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVS 125
           D  +L++ E +  +   +KR   R + R  +I++P   +TV+++ V+
Sbjct: 69  DKKKLVIDEIFADEGPKLKRIRPRAQGRAYKILKPTCHITVVMKAVN 115


>gi|291521893|emb|CBK80186.1| LSU ribosomal protein L22P [Coprococcus catus GD/7]
          Length = 128

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 64/124 (51%), Gaps = 3/124 (2%)

Query: 3   GKRSVSKRRMGDNE---ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAG 59
           G RS  KR    N+    +A  S  R+  QK   V   IRGK V  ALA L ++ +  + 
Sbjct: 4   GHRSQIKRERNSNKDTRPSAKLSFARIPVQKACFVLDAIRGKDVETALAILAYNPRYAST 63

Query: 60  EVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTV 119
            + K L SA+ANAENN+ +D  +L + E Y      MKR   R + R  RI +  S +T+
Sbjct: 64  VIDKLLKSAIANAENNNGMDRSKLFIEECYASNGPIMKRVQPRAQGRAYRIEKRMSHITI 123

Query: 120 IVRE 123
           ++ E
Sbjct: 124 VLNE 127


>gi|156743943|ref|YP_001434072.1| 50S ribosomal protein L22 [Roseiflexus castenholzii DSM 13941]
 gi|189041962|sp|A7NR58|RL22_ROSCS RecName: Full=50S ribosomal protein L22
 gi|156235271|gb|ABU60054.1| ribosomal protein L22 [Roseiflexus castenholzii DSM 13941]
          Length = 113

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 42/114 (36%), Positives = 64/114 (56%), Gaps = 4/114 (3%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A A+   +R+SP K+  V  ++RGK V  ALA L +   + A E+ +T+ SA ANA NN
Sbjct: 2   QAKAVTKYVRISPTKVRPVMDLVRGKPVDRALAILRYLPHKAAREIARTIESARANATNN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEGK 129
           +D+  D L+V   +  +    KR   R R R  RI +  + +TVIV    D+G+
Sbjct: 62  YDMAPDALVVKYIFADEGPAFKRIMPRARGRADRIRKRTTHITVIV----DDGE 111


>gi|108796833|ref|YP_636421.1| ribosomal protein L22 [Staurastrum punctulatum]
 gi|109893082|sp|Q32RV5|RK22_STAPU RecName: Full=50S ribosomal protein L22, chloroplastic
 gi|61393601|gb|AAX45742.1| ribosomal protein L22 [Staurastrum punctulatum]
          Length = 132

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 64/124 (51%)

Query: 6   SVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTL 65
           +VS  R    E  AIA  +R+SP K+  V   IRG+   +AL  LEF   R    + +T+
Sbjct: 8   NVSPPRRDLQEVRAIAKRVRMSPHKVRKVIDQIRGRSYEEALMLLEFMPYRACYPILQTV 67

Query: 66  CSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVS 125
           CSA ANA +N  L    LI+S+  V +   +KRF  R + R   I +P   +TV V+   
Sbjct: 68  CSAAANANHNLGLSKANLIISKVMVDQGPVLKRFRPRAQGRGYPIRKPSCTITVFVKNHP 127

Query: 126 DEGK 129
            + +
Sbjct: 128 SQNE 131


>gi|284042809|ref|YP_003393149.1| ribosomal protein L22 [Conexibacter woesei DSM 14684]
 gi|283947030|gb|ADB49774.1| ribosomal protein L22 [Conexibacter woesei DSM 14684]
          Length = 212

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 60/103 (58%)

Query: 19  AIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDL 78
           A A  +R S +K  LV   IRGK V +A A L ++ + +A +  K L SAVANAE+NH+L
Sbjct: 106 AHAKYVRSSARKARLVCDHIRGKSVEEARAILAYTPRHVARDWSKLLESAVANAEHNHEL 165

Query: 79  DVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           D D L++  A+  +   +KRF  R   R   I +  S LT+++
Sbjct: 166 DGDDLVIKAAHADEGPTLKRFRPRAMGRATPIRKRTSHLTILL 208


>gi|281358720|ref|ZP_06245197.1| ribosomal protein L22 [Victivallis vadensis ATCC BAA-548]
 gi|281314846|gb|EFA98882.1| ribosomal protein L22 [Victivallis vadensis ATCC BAA-548]
          Length = 111

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 64/110 (58%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A+   +R+SP+K   V+ +I+GK   +ALA +E S ++ A  +  TL SAVANAENN
Sbjct: 2   EVRALTRNVRISPEKARHVSRLIQGKSAVEALAIVELSPRKAASLLGDTLRSAVANAENN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVS 125
            ++    L+V  A V     +KRF  + R   GRI +  S L VI+ +++
Sbjct: 62  ENVSRKALVVKAALVSPGPIIKRFRAKARGSAGRIRKRTSHLEVILTDMN 111


>gi|226226284|ref|YP_002760390.1| 50S ribosomal protein L22 [Gemmatimonas aurantiaca T-27]
 gi|226089475|dbj|BAH37920.1| 50S ribosomal protein L22 [Gemmatimonas aurantiaca T-27]
          Length = 125

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 45/113 (39%), Positives = 65/113 (57%), Gaps = 5/113 (4%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAV-----A 70
           EA AI    R SP K+ LV   IRG+RV+DALA L+FS+K  A ++ KTL SAV     A
Sbjct: 10  EARAIQRTTRQSPYKMRLVIDQIRGQRVNDALALLKFSKKHAAEQIGKTLNSAVANAEQA 69

Query: 71  NAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
               N  LDVD L++++A V +   +KR+      R   +++  S + ++V E
Sbjct: 70  ARAANLSLDVDTLVITKAIVNEGPKLKRWTPAAMGRATPMLKRTSHVEIVVTE 122


>gi|89902550|ref|YP_525021.1| 50S ribosomal protein L22 [Rhodoferax ferrireducens T118]
 gi|109893228|sp|Q21RW3|RL22_RHOFD RecName: Full=50S ribosomal protein L22
 gi|89347287|gb|ABD71490.1| LSU ribosomal protein L22P [Rhodoferax ferrireducens T118]
          Length = 109

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 41/106 (38%), Positives = 62/106 (58%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A    +R+S  K  LVA +IRGK+V  AL  L+F++K+ A  ++K L SA+ANAE+N
Sbjct: 2   ETRATLRGVRLSVDKGRLVADLIRGKKVDQALNILQFTQKKAAVIIKKVLESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L V   +V +   ++RF  R + R  +I +P   + V V
Sbjct: 62  DGADIDELRVKTIFVEQGASLRRFTARAKGRGNQIRKPTCHVYVTV 107


>gi|319944790|ref|ZP_08019054.1| 50S ribosomal protein L22 [Lautropia mirabilis ATCC 51599]
 gi|319742039|gb|EFV94462.1| 50S ribosomal protein L22 [Lautropia mirabilis ATCC 51599]
          Length = 113

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 44/106 (41%), Positives = 60/106 (56%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A+   +R+S QK  LVA  +RGK V  AL  L FS K+ A  ++K L SA+ANAE+N
Sbjct: 2   ETQAVLRGVRISAQKGRLVADQVRGKSVEAALNILNFSPKKAAKILKKVLESAIANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              DVD L VS  +V K   ++RF  R + R  RI +    + + V
Sbjct: 62  DGADVDELRVSRVHVEKGQSLRRFSARAKGRGVRIEKQTCHIYLTV 107


>gi|46579719|ref|YP_010527.1| 50S ribosomal protein L22 [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120602804|ref|YP_967204.1| 50S ribosomal protein L22 [Desulfovibrio vulgaris DP4]
 gi|51316273|sp|Q72CH5|RL22_DESVH RecName: Full=50S ribosomal protein L22
 gi|166220844|sp|A1VEB1|RL22_DESVV RecName: Full=50S ribosomal protein L22
 gi|46449134|gb|AAS95786.1| ribosomal protein L22 [Desulfovibrio vulgaris str. Hildenborough]
 gi|120563033|gb|ABM28777.1| LSU ribosomal protein L22P [Desulfovibrio vulgaris DP4]
 gi|311233510|gb|ADP86364.1| ribosomal protein L22 [Desulfovibrio vulgaris RCH1]
          Length = 112

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 61/108 (56%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E+ A A  +RVSP+K  LVA  I G  V DA+  L F+  + AG +   L SA+ANA+  
Sbjct: 2   ESRATAKFMRVSPRKTRLVARNIDGLPVEDAMNLLRFTPNKPAGVLYDVLRSALANAQQM 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
             +DVD ++V +  V +    KRF  R + R  RI +  S +TVI+ E
Sbjct: 62  PGVDVDAMVVKQVVVNEGPSWKRFLPRAQGRATRIKKRTSHITVILAE 109


>gi|269217130|ref|ZP_06160984.1| ribosomal protein L22 [Slackia exigua ATCC 700122]
 gi|269129267|gb|EEZ60352.1| ribosomal protein L22 [Slackia exigua ATCC 700122]
          Length = 113

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 43/106 (40%), Positives = 58/106 (54%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A  +RVSP+K  +V   +RGK +  A   + FS + IA  V K + SAVANA NN
Sbjct: 2   EARATAKYVRVSPRKARIVVDQVRGKDIPRAREIVAFSERAIAETVGKVIDSAVANAVNN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           H +    L +  A+V +   MKRF  R +     I +  S +TVIV
Sbjct: 62  HGMSDKNLFIKAAFVDEGPTMKRFRPRAKGSASPIRKRTSHITVIV 107


>gi|269796250|ref|YP_003315705.1| 50S ribosomal protein L22P [Sanguibacter keddieii DSM 10542]
 gi|269098435|gb|ACZ22871.1| LSU ribosomal protein L22P [Sanguibacter keddieii DSM 10542]
          Length = 123

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 66/111 (59%), Gaps = 5/111 (4%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A    +RV+PQK   V  +IRGK+ ++A+A L+F+ +  +  +RK + SA+ANA   
Sbjct: 2   EAKAQVRFIRVTPQKARRVVDLIRGKQATEAVAVLKFAPQAASEPIRKVVESAIANARVK 61

Query: 76  HD-----LDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
            D      D  +L+V+ A+V +   +KRF  R + R  +I++  S +TV+V
Sbjct: 62  ADRASVAFDEQQLVVTAAFVDEGPTLKRFRPRAQGRASQILKRTSHITVVV 112


>gi|183221342|ref|YP_001839338.1| 50S ribosomal protein L22 [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Paris)']
 gi|215274827|sp|B0SSH2|RL22_LEPBP RecName: Full=50S ribosomal protein L22
 gi|167779764|gb|ABZ98062.1| 50S ribosomal protein L22 [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Paris)']
          Length = 117

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 60/110 (54%), Gaps = 1/110 (0%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANA-EN 74
           EA A+   LR+S +K  LVA  +RG    +A+  L F+ K  +  +   L SAVANA + 
Sbjct: 3   EAKAVGKHLRISARKARLVADEVRGYDYKEAIDILRFTNKAASSMIINLLNSAVANAIQM 62

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV 124
           N  LD + L V + YV     MKRF  R R R  RI +  S +TV+V E+
Sbjct: 63  NESLDPNSLFVKKIYVDDGPIMKRFRPRARGRASRIRKRLSHITVVVSEI 112


>gi|300088192|ref|YP_003758714.1| 50S ribosomal protein L22 [Dehalogenimonas lykanthroporepellens
           BL-DC-9]
 gi|299527925|gb|ADJ26393.1| ribosomal protein L22 [Dehalogenimonas lykanthroporepellens
           BL-DC-9]
          Length = 112

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 58/96 (60%)

Query: 26  VSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLIV 85
           VSP+K+ L   ++RGK V +AL+ L +     AG V KT+ SA A+AENN+ ++ + L +
Sbjct: 12  VSPRKVRLYVDLVRGKGVDEALSILRYMPSPTAGLVAKTVKSAAASAENNYQMEPNELKI 71

Query: 86  SEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
            + Y   +  MKR   R R R+  I++  S +TVIV
Sbjct: 72  IKIYADGAPMMKRHRPRSRGRVSPILKRSSHITVIV 107


>gi|291562763|emb|CBL41579.1| LSU ribosomal protein L22P [butyrate-producing bacterium SS3/4]
          Length = 128

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 64/124 (51%), Gaps = 3/124 (2%)

Query: 3   GKRSVSKRR---MGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAG 59
           G RS  KR      D   +A  S  RVS QK   V   IRGK V  AL  + ++ +  + 
Sbjct: 4   GHRSQIKRERNAQKDTRPSAKLSYARVSVQKACFVLDAIRGKDVQTALGIVTYNPRYASS 63

Query: 60  EVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTV 119
            + K L SA+ANAENN+ ++ + L V E Y  +   MKR   R + R  RI +  S +T+
Sbjct: 64  LIEKLLKSAIANAENNNGMNAENLYVEECYASQGPIMKRVKPRAQGRAYRIEKRMSHITI 123

Query: 120 IVRE 123
           ++ E
Sbjct: 124 VLNE 127


>gi|153210009|ref|ZP_01947560.1| ribosomal protein L22 [Coxiella burnetii 'MSU Goat Q177']
 gi|165924131|ref|ZP_02219963.1| ribosomal protein L22 [Coxiella burnetii RSA 334]
 gi|212218079|ref|YP_002304866.1| 50S ribosomal protein L22 [Coxiella burnetii CbuK_Q154]
 gi|226733449|sp|B6J5D7|RL22_COXB1 RecName: Full=50S ribosomal protein L22
 gi|120575192|gb|EAX31816.1| ribosomal protein L22 [Coxiella burnetii 'MSU Goat Q177']
 gi|165916413|gb|EDR35017.1| ribosomal protein L22 [Coxiella burnetii RSA 334]
 gi|212012341|gb|ACJ19721.1| LSU ribosomal protein L22P [Coxiella burnetii CbuK_Q154]
          Length = 115

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 56/99 (56%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R+S QK  LVA  +RG     A+  L FS K+ A  ++K L SA+ANAE+N   D+D L 
Sbjct: 11  RISAQKARLVADQVRGLGAEQAVNLLRFSNKKAAALMKKVLNSAIANAEHNEGADIDELK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           VS   V +    +RFH R R R  +I++    +TV V +
Sbjct: 71  VSTVMVDEGPSARRFHARARGRANQILKRTCHITVKVSD 109


>gi|117620539|ref|YP_854845.1| ribosomal protein L22 [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
 gi|166220821|sp|A0KF26|RL22_AERHH RecName: Full=50S ribosomal protein L22
 gi|117561946|gb|ABK38894.1| ribosomal protein L22 [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
          Length = 114

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 57/99 (57%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R S QK  LVA  +RG  V  AL  L FS K+ A  V+K L SA+ANAE+N   D+D L 
Sbjct: 11  RTSAQKARLVADQVRGLSVDKALNILTFSPKKAAALVKKVLESAIANAEHNEGADIDALR 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           V+   V +   MKR   R + R  RI++  + +TV+V +
Sbjct: 71  VATIMVDEGPSMKRIRPRAKGRADRILKRTAHITVVVSD 109


>gi|189911435|ref|YP_001962990.1| 50S ribosomal protein L22 [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Ames)']
 gi|226733480|sp|B0SA42|RL22_LEPBA RecName: Full=50S ribosomal protein L22
 gi|167776111|gb|ABZ94412.1| 50S Ribosomal protein L22 [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Ames)']
          Length = 116

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 60/110 (54%), Gaps = 1/110 (0%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANA-EN 74
           EA A+   LR+S +K  LVA  +RG    +A+  L F+ K  +  +   L SAVANA + 
Sbjct: 2   EAKAVGKHLRISARKARLVADEVRGYDYKEAIDILRFTNKAASSMIINLLNSAVANAIQM 61

Query: 75  NHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV 124
           N  LD + L V + YV     MKRF  R R R  RI +  S +TV+V E+
Sbjct: 62  NESLDPNSLFVKKIYVDDGPIMKRFRPRARGRASRIRKRLSHITVVVSEI 111


>gi|291613241|ref|YP_003523398.1| ribosomal protein L22 [Sideroxydans lithotrophicus ES-1]
 gi|291583353|gb|ADE11011.1| ribosomal protein L22 [Sideroxydans lithotrophicus ES-1]
          Length = 109

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 56/98 (57%)

Query: 24  LRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRL 83
           +R+S QK  LVA  IRG  V+ AL  L FS K+  G ++K L SA+ANAE+N   D+D L
Sbjct: 10  VRLSAQKARLVADQIRGLPVAQALNILAFSPKKGGGIIKKALDSAIANAEHNDGADIDEL 69

Query: 84  IVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
            V+  YV K   +KR   R + R   I +    +T+ V
Sbjct: 70  KVATIYVDKGTSLKRMIPRAKGRGNSIEKQTCHITITV 107


>gi|145588247|ref|YP_001154844.1| 50S ribosomal protein L22 [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
 gi|189041957|sp|A4SUW6|RL22_POLSQ RecName: Full=50S ribosomal protein L22
 gi|145046653|gb|ABP33280.1| LSU ribosomal protein L22P [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
          Length = 109

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 44/106 (41%), Positives = 59/106 (55%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  AI    R+S QK  LVA  IRG  ++ AL  L FS K+ A  V+K + SA+ANAE+N
Sbjct: 2   EVKAIHKSARISAQKTRLVADQIRGLPIARALNILNFSPKKAAFIVKKVVESAMANAEHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
              D+D L VS   V K   +KRF  R + R  +I +    +TV +
Sbjct: 62  KGADIDELKVSTIIVDKGTSLKRFTARAKGRGNQIEKQTCHITVTL 107


>gi|11466743|ref|NP_039339.1| ribosomal protein L22 [Marchantia polymorpha]
 gi|132788|sp|P06388|RK22_MARPO RecName: Full=50S ribosomal protein L22, chloroplastic
 gi|11714|emb|CAA28125.1| rpl22 [Marchantia polymorpha]
          Length = 119

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 57/114 (50%), Gaps = 4/114 (3%)

Query: 12  MGDNEAN----AIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCS 67
           M  N +N    A+A  + +SP K+  V + IRG+    AL  LEF   R    + + L S
Sbjct: 1   MQTNTSNKKIRAVAKHIHMSPHKVRRVVSQIRGRSYEQALMILEFMPYRACNPILQLLSS 60

Query: 68  AVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
           A ANA +N  L    L +SE  V K  F KRF  R + R   I +P   +T+++
Sbjct: 61  AAANANHNFGLSKTNLFISEIQVNKGTFFKRFQPRAQGRGYPIHKPTCHITIVL 114


>gi|311896565|dbj|BAJ28973.1| putative ribosomal protein L22 [Kitasatospora setae KM-6054]
          Length = 115

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 66/114 (57%), Gaps = 3/114 (2%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA A A  +RV+P K   V  +IRG   ++A A L F+ +     V K L SA+ANA +N
Sbjct: 2   EARAQARYIRVTPMKARRVVDLIRGLPATEAQAVLRFAPQAATVPVGKVLNSAIANAAHN 61

Query: 76  HDL-DVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG 128
           ++  +VD L +SEAYV +   +KRF  R + R  RI +  S +TV+V   S EG
Sbjct: 62  YNHSNVDDLYISEAYVDEGPTLKRFRPRAQGRAYRIRKRTSHITVVVS--SKEG 113


>gi|15829054|ref|NP_326414.1| 50S ribosomal protein L22 [Mycoplasma pulmonis UAB CTIP]
 gi|51316906|sp|Q98PY6|RL22_MYCPU RecName: Full=50S ribosomal protein L22
 gi|14089998|emb|CAC13756.1| 50S RIBOSOMAL PROTEIN L22 [Mycoplasma pulmonis]
          Length = 110

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 63/108 (58%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A+   +RVS +K +LVA + R +  ++A++ L+ + K+ A    K L SA++NA NN
Sbjct: 2   EVRALLKTVRVSSKKASLVANLFRHQSTANAISILKNTNKKSAPIFLKILNSAISNAVNN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           H LD  +L VS   V +   +KRF    + R  RI++  S L+V+V E
Sbjct: 62  HGLDASKLYVSNVMVNEGPTLKRFQPHSQGRATRILKRTSHLSVMVSE 109


>gi|7674221|sp|O66094|RL22_PHYS1 RecName: Full=50S ribosomal protein L22
 gi|3047154|gb|AAC13663.1| ribosomal protein L22 [Phytoplasma sp. STRAWB1]
          Length = 131

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 41/106 (38%), Positives = 64/106 (60%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A AIAS + ++P+K+ LV  +IRGK ++ A A L F+ K  A  + K L SAVANA NN
Sbjct: 7   QAKAIASKVSIAPRKVRLVIDLIRGKNIAQAQAILTFTSKVAAPVILKLLNSAVANATNN 66

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
             L+ ++L V E +V + + +KR   R +     I +  S +T++V
Sbjct: 67  LKLNHEQLYVKEVFVNEGLRLKRIFPRAKGSGDMIKKRTSHITLVV 112


>gi|71894648|ref|YP_278756.1| 50S ribosomal protein L22 [Mycoplasma synoviae 53]
 gi|109893211|sp|Q4A5C6|RL22_MYCS5 RecName: Full=50S ribosomal protein L22
 gi|71851436|gb|AAZ44045.1| 50S ribosomal protein L22 [Mycoplasma synoviae 53]
          Length = 113

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 59/108 (54%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           +A A   M RVS  K  LVA + RGK  + AL  L  + ++ A    K L SA+ANA NN
Sbjct: 4   QAKAHVKMQRVSVSKAKLVANLFRGKDATLALGILHNTPQKSAKIFIKLLNSAIANATNN 63

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           H +D  +L V E +V +   +KRF  R + R   I++  S  ++I+ E
Sbjct: 64  HGMDASKLFVKEIHVNEGPTLKRFQPRSQGRAYEILKRTSHFSIILEE 111


>gi|261338274|ref|ZP_05966158.1| ribosomal protein L22 [Bifidobacterium gallicum DSM 20093]
 gi|270276929|gb|EFA22783.1| ribosomal protein L22 [Bifidobacterium gallicum DSM 20093]
          Length = 119

 Score = 67.8 bits (164), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 41/111 (36%), Positives = 65/111 (58%), Gaps = 5/111 (4%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           EA AIA  +RV+P+K   +  +IRGK+ ++A+  L+F+ +  +  V K L SA+ANA   
Sbjct: 2   EAKAIARHVRVTPRKARRMVNLIRGKKATEAITILKFAPQAASEPVLKVLQSAIANARFK 61

Query: 76  HD-----LDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIV 121
            D        + L++ E YV + V +KRF  R + R GRI +  + +TV+V
Sbjct: 62  ADKAGEAFRENDLVIKETYVDEGVTLKRFRARAQGRAGRINKRTAHITVVV 112


>gi|88860954|ref|ZP_01135590.1| 50S ribosomal subunit protein L22 [Pseudoalteromonas tunicata D2]
 gi|88817167|gb|EAR26986.1| 50S ribosomal subunit protein L22 [Pseudoalteromonas tunicata D2]
          Length = 110

 Score = 67.8 bits (164), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 57/97 (58%)

Query: 27  SPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLIVS 86
           S QK  LVA  +RG  V  AL  L FS K+ A  V+K L SA+ANAE+N   D+D L V+
Sbjct: 13  SAQKARLVADQVRGLPVDKALQILAFSPKKAAVLVKKVLESAIANAEHNEGADIDELRVA 72

Query: 87  EAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
             +V +   MKR   R + R  RI++  S +TV+V +
Sbjct: 73  TIFVDEGPSMKRILPRAKGRADRILKRTSHITVVVSD 109


>gi|110833263|ref|YP_692122.1| 50S ribosomal protein L22 [Alcanivorax borkumensis SK2]
 gi|254427790|ref|ZP_05041497.1| ribosomal protein L22 [Alcanivorax sp. DG881]
 gi|123345808|sp|Q0VSJ8|RL22_ALCBS RecName: Full=50S ribosomal protein L22
 gi|110646374|emb|CAL15850.1| 50S ribosomal protein L22 [Alcanivorax borkumensis SK2]
 gi|196193959|gb|EDX88918.1| ribosomal protein L22 [Alcanivorax sp. DG881]
          Length = 114

 Score = 67.8 bits (164), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 59/99 (59%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R+S QK  LVA  +RG  V  AL  LEFS K+ A  V+K L SA+ANAENN   DVD L 
Sbjct: 13  RISAQKARLVADQVRGLEVEKALNLLEFSPKKAAKIVKKVLESAIANAENNDGADVDELK 72

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           VS  +V + + MKR   R + R  RI++    +TV V E
Sbjct: 73  VSTVFVDEGMTMKRIRPRAKGRADRILKRTCHITVKVSE 111


>gi|160914554|ref|ZP_02076769.1| hypothetical protein EUBDOL_00560 [Eubacterium dolichum DSM 3991]
 gi|158433712|gb|EDP12001.1| hypothetical protein EUBDOL_00560 [Eubacterium dolichum DSM 3991]
          Length = 111

 Score = 67.8 bits (164), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 62/108 (57%)

Query: 16  EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENN 75
           E  A A  LR+ P+K  +V  +IRGK  ++A A L+F+    A  + K L SAVANA +N
Sbjct: 2   EVKATAKTLRIPPRKARIVIDLIRGKDAAEAAAILKFTPNVAAEAIGKVLKSAVANAVHN 61

Query: 76  HDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           ++++ ++L V   Y  + V +KRF  R +     I +  S +TV+V E
Sbjct: 62  NEMNEEKLYVKACYANEGVTLKRFMPRAKGSASAIHKRTSHITVVVAE 109


>gi|302388083|ref|YP_003823905.1| ribosomal protein L22 [Clostridium saccharolyticum WM1]
 gi|302198711|gb|ADL06282.1| ribosomal protein L22 [Clostridium saccharolyticum WM1]
          Length = 128

 Score = 67.8 bits (164), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 47/124 (37%), Positives = 65/124 (52%), Gaps = 3/124 (2%)

Query: 3   GKRSVSKRR---MGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAG 59
           G RS  KR    + D   +A  S  RVS QK   V   IRGK V  AL  + ++ +  + 
Sbjct: 4   GHRSQIKRERNAVKDTRPSAKLSYARVSVQKACFVLDAIRGKDVMTALGIVTYNPRYASS 63

Query: 60  EVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTV 119
            + K L SAVANAENN+ +D  +L V E +  K   MKR   R + R  RI +  S +T+
Sbjct: 64  LIEKLLKSAVANAENNNGMDPAKLYVEECFANKGPTMKRVKPRAQGRAYRIEKRMSHITI 123

Query: 120 IVRE 123
           ++ E
Sbjct: 124 VLNE 127


>gi|29653595|ref|NP_819287.1| 50S ribosomal protein L22 [Coxiella burnetii RSA 493]
 gi|154706985|ref|YP_001425177.1| 50S ribosomal protein L22 [Coxiella burnetii Dugway 5J108-111]
 gi|161830730|ref|YP_001596190.1| 50S ribosomal protein L22 [Coxiella burnetii RSA 331]
 gi|212213245|ref|YP_002304181.1| 50S ribosomal protein L22 [Coxiella burnetii CbuG_Q212]
 gi|6225980|sp|O85387|RL22_COXBU RecName: Full=50S ribosomal protein L22
 gi|189041946|sp|A9KD26|RL22_COXBN RecName: Full=50S ribosomal protein L22
 gi|189041947|sp|A9NAM9|RL22_COXBR RecName: Full=50S ribosomal protein L22
 gi|226733450|sp|B6J258|RL22_COXB2 RecName: Full=50S ribosomal protein L22
 gi|3248939|gb|AAD09928.1| 50S ribosomal protein L22 [Coxiella burnetii]
 gi|29540857|gb|AAO89801.1| LSU ribosomal protein L22P [Coxiella burnetii RSA 493]
 gi|154356271|gb|ABS77733.1| LSU ribosomal protein L22P [Coxiella burnetii Dugway 5J108-111]
 gi|161762597|gb|ABX78239.1| ribosomal protein L22 [Coxiella burnetii RSA 331]
 gi|212011655|gb|ACJ19036.1| LSU ribosomal protein L22P [Coxiella burnetii CbuG_Q212]
          Length = 115

 Score = 67.8 bits (164), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 56/99 (56%)

Query: 25  RVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLI 84
           R+S QK  LVA  +RG     A+  L FS K+ A  ++K L SA+ANAE+N   D+D L 
Sbjct: 11  RISAQKARLVADQVRGLGAEQAVNLLRFSNKKAAALMKKVLDSAIANAEHNEGADIDELK 70

Query: 85  VSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           VS   V +    +RFH R R R  +I++    +TV V +
Sbjct: 71  VSTVMVDEGPSARRFHARARGRANQILKRTCHITVKVSD 109


>gi|266620258|ref|ZP_06113193.1| ribosomal protein L22 [Clostridium hathewayi DSM 13479]
 gi|288868161|gb|EFD00460.1| ribosomal protein L22 [Clostridium hathewayi DSM 13479]
          Length = 128

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 58/110 (52%)

Query: 14  DNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAE 73
           D   +A  S  RVS QK   V   IRGK    AL  + ++ +  +  + K L SA+ANAE
Sbjct: 18  DTRPSAKLSYARVSVQKACFVLDAIRGKDAQTALGIVTYNPRYASTLIEKLLKSAIANAE 77

Query: 74  NNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVRE 123
           NN+ +D  +L V E Y  K   MKR   R + R  RI +  S +T+++ E
Sbjct: 78  NNNGMDPSKLYVEECYANKGPTMKRVKPRAQGRAYRIEKRMSHITIVLNE 127


>gi|260905716|ref|ZP_05914038.1| 50S ribosomal protein L22 [Brevibacterium linens BL2]
          Length = 128

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 65/111 (