Query gi|254780257|ref|YP_003064670.1| SSU ribosomal protein S19P [Candidatus Liberibacter asiaticus str. psy62] Match_columns 92 No_of_seqs 105 out of 1230 Neff 4.8 Searched_HMMs 39220 Date Tue May 24 07:15:43 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780257.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 TIGR01050 rpsS_bact ribosomal 100.0 8.4E-45 0 277.3 7.9 91 1-91 1-92 (92) 2 PRK00357 rpsS 30S ribosomal pr 100.0 4.7E-43 0 267.5 8.7 92 1-92 1-92 (92) 3 COG0185 RpsS Ribosomal protein 100.0 1.3E-42 0 265.0 7.8 91 1-91 1-92 (93) 4 CHL00050 rps19 ribosomal prote 100.0 3E-41 1.4E-45 257.2 8.8 92 1-92 1-92 (92) 5 pfam00203 Ribosomal_S19 Riboso 100.0 8E-37 2E-41 231.9 7.5 79 3-81 1-79 (79) 6 KOG0899 consensus 100.0 2.4E-35 6.2E-40 223.4 4.2 84 1-87 10-93 (93) 7 PTZ00096 40S ribosomal protein 100.0 6.2E-32 1.6E-36 203.9 7.3 86 3-88 44-134 (144) 8 PRK04038 rps19p 30S ribosomal 100.0 1.5E-31 3.8E-36 201.6 7.3 86 3-88 35-122 (134) 9 TIGR01025 rpsS_arch ribosomal 100.0 1.8E-31 4.5E-36 201.2 7.2 87 3-89 33-125 (136) 10 KOG0898 consensus 99.9 1.1E-28 2.8E-33 185.2 0.8 84 1-87 52-139 (152) 11 KOG3265 consensus 28.0 54 0.0014 15.2 3.2 40 39-78 84-129 (250) 12 TIGR00128 fabD malonyl CoA-acy 26.9 15 0.00038 18.5 -0.4 15 61-75 83-98 (295) 13 TIGR03131 malonate_mdcH malona 26.6 15 0.00038 18.5 -0.4 10 66-75 80-89 (295) 14 KOG1539 consensus 26.0 59 0.0015 15.0 3.6 36 31-66 39-75 (910) 15 pfam06668 ITI_HC_C Inter-alpha 20.0 78 0.002 14.3 2.6 23 48-70 28-50 (188) No 1 >TIGR01050 rpsS_bact ribosomal protein S19; InterPro: IPR005732 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites , . About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits. Many of ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome , . The small ribosomal subunit protein S19 contains 88-144 amino acid residues. In Escherichia coli, S19 is known to form a complex with S13 that binds strongly to 16S ribosomal RNA. Experimental evidence has revealed that S19 is moderately exposed on the ribosomal surface.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0015935 small ribosomal subunit. Probab=100.00 E-value=8.4e-45 Score=277.35 Aligned_cols=91 Identities=56% Similarity=0.978 Sum_probs=87.2 Q ss_pred CCCCCCCCCCCCHHHHHHHHHHHCCCCCCEEEEEECCCEECCCCCCCEEEEEECCCEEEEEECCCCCCCCCCCCCCCCCC Q ss_conf 97787767562589999999862168983598750374781022264899970862689998525110101253364363 Q gi|254780257|r 1 MARSVRKGPFVTKSLLKKVSQARDSGGRGVVRVWCRNCDIMPQFIGLTFGVYNGRKHVPVSVSEEMVGFKLGDFAPTRHC 80 (92) Q Consensus 1 MsRS~~Kgpfv~~~L~~ki~~~~~~~~~~~IkT~sR~s~IlP~~vg~~i~VyNGk~f~~v~I~~~MVGhklGEFa~TRk~ 80 (92) |+||+|||||||.+|++|+.++++.+++++||||||+|+|+|+|||.|++||||++|+||+|+|+|||||||||||||++ T Consensus 1 M~RS~kKGPFvd~~LlkKv~~~~~~~~~~~iKtwSRrS~I~P~mvG~t~~vhNG~~~ipvyi~e~mVGhKLGEFapTR~f 80 (92) T TIGR01050 1 MSRSLKKGPFVDKHLLKKVEKLNESGKKKVIKTWSRRSTIIPEMVGHTIAVHNGKKFIPVYITEEMVGHKLGEFAPTRTF 80 (92) T ss_pred CCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCEEECCCCCCCEEEEECCCEEEEEEEECCCCCCCCCCCCCCCCC T ss_conf 98766566214578999999875036762368861110325631230678703966742686033124201675543342 Q ss_pred CCCC-CCCCCCC Q ss_conf 5766-6653125 Q gi|254780257|r 81 PGHG-SDKKAKR 91 (92) Q Consensus 81 ~~H~-~~kk~k~ 91 (92) .+|. .++|+++ T Consensus 81 ~~H~~~~kk~~~ 92 (92) T TIGR01050 81 KGHAKSDKKAKR 92 (92) T ss_pred CCCCCCCCCCCC T ss_conf 345423246789 No 2 >PRK00357 rpsS 30S ribosomal protein S19; Reviewed Probab=100.00 E-value=4.7e-43 Score=267.53 Aligned_cols=92 Identities=62% Similarity=1.043 Sum_probs=90.3 Q ss_pred CCCCCCCCCCCCHHHHHHHHHHHCCCCCCEEEEEECCCEECCCCCCCEEEEEECCCEEEEEECCCCCCCCCCCCCCCCCC Q ss_conf 97787767562589999999862168983598750374781022264899970862689998525110101253364363 Q gi|254780257|r 1 MARSVRKGPFVTKSLLKKVSQARDSGGRGVVRVWCRNCDIMPQFIGLTFGVYNGRKHVPVSVSEEMVGFKLGDFAPTRHC 80 (92) Q Consensus 1 MsRS~~Kgpfv~~~L~~ki~~~~~~~~~~~IkT~sR~s~IlP~~vg~~i~VyNGk~f~~v~I~~~MVGhklGEFa~TRk~ 80 (92) ||||+||||||+++|++++.++..++.+++|+||||+|+|+|+|||++|+||||++|++|+|++|||||||||||+||++ T Consensus 1 MsRS~~KgPfv~~~LlkKi~~~~~~~~k~~Ikt~sR~s~IlP~~vG~t~~VhNGk~fv~v~I~~~MvGhklGEFa~TRk~ 80 (92) T PRK00357 1 MPRSLKKGPFVDDHLLKKVEKANESGDKKVIKTWSRRSTILPDFIGLTIAVHNGRKHVPVYVTENMVGHKLGEFAPTRTF 80 (92) T ss_pred CCCCCCCCCCCCHHHHHHHHHHHHCCCCCEEEEECCCCEECHHHCCCEEEEECCCEEEEEEECCCCCCCEEECCCCCCCC T ss_conf 98755558363889999999987247984058853577978678187899976980587885736137121110034255 Q ss_pred CCCCCCCCCCCC Q ss_conf 576666531259 Q gi|254780257|r 81 PGHGSDKKAKRK 92 (92) Q Consensus 81 ~~H~~~kk~k~k 92 (92) ++|++++|+++| T Consensus 81 ~~H~~~~k~~rk 92 (92) T PRK00357 81 RGHAADKKAKRK 92 (92) T ss_pred CCCCCCCCCCCC T ss_conf 566776544579 No 3 >COG0185 RpsS Ribosomal protein S19 [Translation, ribosomal structure and biogenesis] Probab=100.00 E-value=1.3e-42 Score=264.98 Aligned_cols=91 Identities=56% Similarity=0.992 Sum_probs=86.9 Q ss_pred CCCCCCCCCCCCHHHHHHHHHHHCCCCCCEEEEEECCCEECCCCCCCEEEEEECCCEEEEEECCCCCCCCCCCCCCCCCC Q ss_conf 97787767562589999999862168983598750374781022264899970862689998525110101253364363 Q gi|254780257|r 1 MARSVRKGPFVTKSLLKKVSQARDSGGRGVVRVWCRNCDIMPQFIGLTFGVYNGRKHVPVSVSEEMVGFKLGDFAPTRHC 80 (92) Q Consensus 1 MsRS~~Kgpfv~~~L~~ki~~~~~~~~~~~IkT~sR~s~IlP~~vg~~i~VyNGk~f~~v~I~~~MVGhklGEFa~TRk~ 80 (92) |+||+|||||++.+|++++++++.++++++||||||+|+|||+|||+||+||||++|+||+|+|||||||||||||||++ T Consensus 1 ~~RSlkkGp~~~~~Ll~Kv~~~~~~~~k~~IkT~sR~s~IlPemVG~ti~VhNGk~~vpV~I~~eMVGHkLGEFapTR~~ 80 (93) T COG0185 1 MRRSLKKGPFVDKHLLKKVRKAKESGKKKPIKTWSRRSTILPEMVGLTIAVHNGKKFVPVEITEEMVGHKLGEFAPTRTF 80 (93) T ss_pred CCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCEEEECCCEECHHHCCCEEEEECCCEEEEEEECHHHCCEECCCCCCEECC T ss_conf 97432237661289999999987506787606530454855546373899976963777882642336140331553021 Q ss_pred CCCCCCC-CCCC Q ss_conf 5766665-3125 Q gi|254780257|r 81 PGHGSDK-KAKR 91 (92) Q Consensus 81 ~~H~~~k-k~k~ 91 (92) ++|+.++ ++.+ T Consensus 81 ~~H~~~~~~atr 92 (93) T COG0185 81 VGHGADGIKATR 92 (93) T ss_pred CCCCCCCCCCCC T ss_conf 446888757555 No 4 >CHL00050 rps19 ribosomal protein S19 Probab=100.00 E-value=3e-41 Score=257.20 Aligned_cols=92 Identities=41% Similarity=0.847 Sum_probs=87.3 Q ss_pred CCCCCCCCCCCCHHHHHHHHHHHCCCCCCEEEEEECCCEECCCCCCCEEEEEECCCEEEEEECCCCCCCCCCCCCCCCCC Q ss_conf 97787767562589999999862168983598750374781022264899970862689998525110101253364363 Q gi|254780257|r 1 MARSVRKGPFVTKSLLKKVSQARDSGGRGVVRVWCRNCDIMPQFIGLTFGVYNGRKHVPVSVSEEMVGFKLGDFAPTRHC 80 (92) Q Consensus 1 MsRS~~Kgpfv~~~L~~ki~~~~~~~~~~~IkT~sR~s~IlP~~vg~~i~VyNGk~f~~v~I~~~MVGhklGEFa~TRk~ 80 (92) ||||+||||||+.+|++++.++..++.+++|+||||+|+|+|+|||++|+||||++|++|+|+||||||+||||||||++ T Consensus 1 MsRS~kKgPfv~~~LlkKv~~~~~~~~k~~ikt~sR~s~IlP~~vg~~i~VyNGk~fi~v~I~~~MvGhklGEF~~Trk~ 80 (92) T CHL00050 1 MTRSLKKNPFVANHLLKKIEKLNTKEEKEIIKTWSRASTIIPTMIGHTIAVHNGKEHLPIYITDQMVGHKLGEFAPTRNF 80 (92) T ss_pred CCCCCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEECCCEECHHHCCCEEEEECCCEEEEEEECCCCCCCEEECCCCCCCC T ss_conf 98644568448899999999876247885279870466978678387999977980588885737137120111046155 Q ss_pred CCCCCCCCCCCC Q ss_conf 576666531259 Q gi|254780257|r 81 PGHGSDKKAKRK 92 (92) Q Consensus 81 ~~H~~~kk~k~k 92 (92) ++|++++++.++ T Consensus 81 ~~H~~~~kk~kr 92 (92) T CHL00050 81 RGHAKSDKKSRR 92 (92) T ss_pred CCCCCCCCCCCC T ss_conf 455888755569 No 5 >pfam00203 Ribosomal_S19 Ribosomal protein S19. Probab=100.00 E-value=8e-37 Score=231.85 Aligned_cols=79 Identities=46% Similarity=0.908 Sum_probs=77.6 Q ss_pred CCCCCCCCCCHHHHHHHHHHHCCCCCCEEEEEECCCEECCCCCCCEEEEEECCCEEEEEECCCCCCCCCCCCCCCCCCC Q ss_conf 7877675625899999998621689835987503747810222648999708626899985251101012533643635 Q gi|254780257|r 3 RSVRKGPFVTKSLLKKVSQARDSGGRGVVRVWCRNCDIMPQFIGLTFGVYNGRKHVPVSVSEEMVGFKLGDFAPTRHCP 81 (92) Q Consensus 3 RS~~Kgpfv~~~L~~ki~~~~~~~~~~~IkT~sR~s~IlP~~vg~~i~VyNGk~f~~v~I~~~MVGhklGEFa~TRk~~ 81 (92) ||+|||||++.+|++++++++..+.+++|+||||+|+|+|+|||++|+|||||+|++|+|+||||||||||||+||++| T Consensus 1 RS~~Kgpfv~~~Llkk~~~~~~~~~~~~ikt~sR~~~IlP~~vg~~~~V~NGk~f~~v~I~~~MvGhklGEFa~TRk~v 79 (79) T pfam00203 1 RSLKKGPFVDLKLLRKIKKENTANEKEVIKTWSRRSTILPEMVGHTIAVYNGKEFVPVYITPEMVGHKLGEFAPTRKFV 79 (79) T ss_pred CCCCCCCCCCHHHHHHHHHHHHCCCCCCEEEECCCCEECHHHCCCEEEEECCCCEEEEEECCCEECEEEECCCCEEECC T ss_conf 9886673677899999998660279876788656779675785979999879806757964680042203345677559 No 6 >KOG0899 consensus Probab=100.00 E-value=2.4e-35 Score=223.36 Aligned_cols=84 Identities=49% Similarity=0.925 Sum_probs=78.4 Q ss_pred CCCCCCCCCCCCHHHHHHHHHHHCCCCCCEEEEEECCCEECCCCCCCEEEEEECCCEEEEEECCCCCCCCCCCCCCCCCC Q ss_conf 97787767562589999999862168983598750374781022264899970862689998525110101253364363 Q gi|254780257|r 1 MARSVRKGPFVTKSLLKKVSQARDSGGRGVVRVWCRNCDIMPQFIGLTFGVYNGRKHVPVSVSEEMVGFKLGDFAPTRHC 80 (92) Q Consensus 1 MsRS~~Kgpfv~~~L~~ki~~~~~~~~~~~IkT~sR~s~IlP~~vg~~i~VyNGk~f~~v~I~~~MVGhklGEFa~TRk~ 80 (92) |+||+||||||+.+|++++++++.. -+|+||||+|+|||+|||++|.|||||+|+||+|+|+|||||||||||||++ T Consensus 10 m~RSvwK~P~V~~~~~rk~~~~~~~---~pikt~sRasTIlP~~Vg~~~~IhNGk~~v~vkIte~mVGHKlGEFapTrk~ 86 (93) T KOG0899 10 MTRSVWKGPFVVKFLLRKIEKLKGK---APIKTWSRASTILPTMVGHTFAIHNGKEHVPVKITEDMVGHKLGEFAPTRKF 86 (93) T ss_pred HHHHHHCCCCHHHHHHHHHHHHCCC---CCEEEHHHHCCHHHHHHCCEEEEECCCCEEEEEEECCHHCCCCCCCCCHHHH T ss_conf 7777621963568887899986588---7546402331011465071689856961233786401012221233414555 Q ss_pred CCCCCCC Q ss_conf 5766665 Q gi|254780257|r 81 PGHGSDK 87 (92) Q Consensus 81 ~~H~~~k 87 (92) .+|...+ T Consensus 87 ~~~aktk 93 (93) T KOG0899 87 FGHAKTK 93 (93) T ss_pred HCCCCCC T ss_conf 2212479 No 7 >PTZ00096 40S ribosomal protein S15; Provisional Probab=99.97 E-value=6.2e-32 Score=203.86 Aligned_cols=86 Identities=33% Similarity=0.496 Sum_probs=76.1 Q ss_pred CCCCCCCCCC-HHHHHHHHHHHC----CCCCCEEEEEECCCEECCCCCCCEEEEEECCCEEEEEECCCCCCCCCCCCCCC Q ss_conf 7877675625-899999998621----68983598750374781022264899970862689998525110101253364 Q gi|254780257|r 3 RSVRKGPFVT-KSLLKKVSQARD----SGGRGVVRVWCRNCDIMPQFIGLTFGVYNGRKHVPVSVSEEMVGFKLGDFAPT 77 (92) Q Consensus 3 RS~~Kgpfv~-~~L~~ki~~~~~----~~~~~~IkT~sR~s~IlP~~vg~~i~VyNGk~f~~v~I~~~MVGhklGEFa~T 77 (92) |++.+|.... ..|++++.+++. ..++++||||+|||+|+|+|||++|+|||||+|++|+|+||||||||||||+| T Consensus 44 R~l~RGl~~~~~~Ll~klrkak~~~~~~eKp~~ikTh~R~~iIlPemvG~~v~VynGk~f~~v~I~~eMiGh~lGEFa~T 123 (144) T PTZ00096 44 RRISRHLKRRAPNLLKKLRKAKKEVKPGEKPKPVKTHLRNMVIVPEMVGSIVGVYNGRQFNNVEIKPEMIGHYLGEFSLT 123 (144) T ss_pred HHHCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCEECCHHCCEEEEEECCCEEEEEECCCCEECEEECCCCCC T ss_conf 35304998899999999999776354567897647704777768201360898864851576772648203132334676 Q ss_pred CCCCCCCCCCC Q ss_conf 36357666653 Q gi|254780257|r 78 RHCPGHGSDKK 88 (92) Q Consensus 78 Rk~~~H~~~kk 88 (92) |+++.||...- T Consensus 124 rk~v~HG~PGi 134 (144) T PTZ00096 124 YKPVRHGKPGV 134 (144) T ss_pred CCCCCCCCCCC T ss_conf 58665799976 No 8 >PRK04038 rps19p 30S ribosomal protein S19P; Provisional Probab=99.97 E-value=1.5e-31 Score=201.65 Aligned_cols=86 Identities=41% Similarity=0.716 Sum_probs=76.2 Q ss_pred CCCCCCCCC-CHHHHHHHHHHHCC-CCCCEEEEEECCCEECCCCCCCEEEEEECCCEEEEEECCCCCCCCCCCCCCCCCC Q ss_conf 787767562-58999999986216-8983598750374781022264899970862689998525110101253364363 Q gi|254780257|r 3 RSVRKGPFV-TKSLLKKVSQARDS-GGRGVVRVWCRNCDIMPQFIGLTFGVYNGRKHVPVSVSEEMVGFKLGDFAPTRHC 80 (92) Q Consensus 3 RS~~Kgpfv-~~~L~~ki~~~~~~-~~~~~IkT~sR~s~IlP~~vg~~i~VyNGk~f~~v~I~~~MVGhklGEFa~TRk~ 80 (92) |++.+|..- ...|++++.+++.. .++++|+||+|||+|+|+|||++|+|||||+|++|+|+||||||||||||+||++ T Consensus 35 R~l~RGl~~~~~~Ll~klrkak~~~~kp~~ikTh~R~~iIlPemvG~~i~VynGk~f~~veI~~eMiGh~lGEFa~Trk~ 114 (134) T PRK04038 35 RSLKRGLTPEQRKLLEKIRKAKRLKNKGRVIRTHCRDMIILPEMVGLTIAVYNGKEFVPVEIVPEMIGHYLGEFALTRKR 114 (134) T ss_pred HHHCCCCCHHHHHHHHHHHHHHHCCCCCCCEEEECCCCEECHHHCCCEEEEECCCEEEEEEECCCCCCEEECCCCCCCCC T ss_conf 45403778789999999998664357998626733676868646471898963864788871625036030024564377 Q ss_pred CCCCCCCC Q ss_conf 57666653 Q gi|254780257|r 81 PGHGSDKK 88 (92) Q Consensus 81 ~~H~~~kk 88 (92) +.||...- T Consensus 115 v~Hg~pGi 122 (134) T PRK04038 115 VQHGSPGI 122 (134) T ss_pred CCCCCCCC T ss_conf 66799965 No 9 >TIGR01025 rpsS_arch ribosomal protein S19; InterPro: IPR005713 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites , . About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits. Many of ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome , . This family represents eukaryotic ribosomal protein S15 and its archaeal equivalent. It excludes bacterial and organellar ribosomal protein S19. The nomenclature for the archaeal members is unresolved and given variously as S19 (after the more distant bacterial homologs) or S15.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0015935 small ribosomal subunit. Probab=99.97 E-value=1.8e-31 Score=201.24 Aligned_cols=87 Identities=40% Similarity=0.701 Sum_probs=76.2 Q ss_pred CCCCCCCCC-CHHHHHHHHHHHC-----CCCCCEEEEEECCCEECCCCCCCEEEEEECCCEEEEEECCCCCCCCCCCCCC Q ss_conf 787767562-5899999998621-----6898359875037478102226489997086268999852511010125336 Q gi|254780257|r 3 RSVRKGPFV-TKSLLKKVSQARD-----SGGRGVVRVWCRNCDIMPQFIGLTFGVYNGRKHVPVSVSEEMVGFKLGDFAP 76 (92) Q Consensus 3 RS~~Kgpfv-~~~L~~ki~~~~~-----~~~~~~IkT~sR~s~IlP~~vg~~i~VyNGk~f~~v~I~~~MVGhklGEFa~ 76 (92) |++.+|..- +..|+++|.+++. ...+++|+|||||++|+|+|||.+|+|||||+|++|+|+||||||||||||+ T Consensus 33 R~l~RGl~~~~~~ll~k~rk~k~e~~~~g~~P~~~rTH~RdmiilPeMvG~~~~v~NGK~F~~V~i~PEMIGhylgEF~~ 112 (136) T TIGR01025 33 RRLKRGLTPKQKKLLKKLRKAKKEAKPKGEKPEVIRTHCRDMIILPEMVGLTVGVYNGKEFVEVEIKPEMIGHYLGEFAL 112 (136) T ss_pred CCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCEEEECCCCEEECCCCCCCEEEEECCCEEEEEEEEEEEECCCHHHCCC T ss_conf 21102877447899999999887432146888600212442157642336077872086555677420031220000001 Q ss_pred CCCCCCCCCCCCC Q ss_conf 4363576666531 Q gi|254780257|r 77 TRHCPGHGSDKKA 89 (92) Q Consensus 77 TRk~~~H~~~kk~ 89 (92) ||+.+.||...=+ T Consensus 113 t~k~v~Hg~PG~G 125 (136) T TIGR01025 113 TRKPVKHGAPGVG 125 (136) T ss_pred CCCCCCCCCCCCC T ss_conf 1253236856966 No 10 >KOG0898 consensus Probab=99.94 E-value=1.1e-28 Score=185.25 Aligned_cols=84 Identities=35% Similarity=0.564 Sum_probs=73.2 Q ss_pred CCCCCCCCCCCCHHHHHHHHH----HHCCCCCCEEEEEECCCEECCCCCCCEEEEEECCCEEEEEECCCCCCCCCCCCCC Q ss_conf 977877675625899999998----6216898359875037478102226489997086268999852511010125336 Q gi|254780257|r 1 MARSVRKGPFVTKSLLKKVSQ----ARDSGGRGVVRVWCRNCDIMPQFIGLTFGVYNGRKHVPVSVSEEMVGFKLGDFAP 76 (92) Q Consensus 1 MsRS~~Kgpfv~~~L~~ki~~----~~~~~~~~~IkT~sR~s~IlP~~vg~~i~VyNGk~f~~v~I~~~MVGhklGEFa~ 76 (92) ++|.+|+-|. .|++++.+ +..++++++|+||.|||+|+|||||+.++|||||.|++|+|+||||||||||||+ T Consensus 52 ~~RGL~~k~~---~liKklrkAkk~A~~~ekpe~VkTHlR~mII~PEMvGs~VGVyNGK~FnqvEiKPEMIGhYL~eFsi 128 (152) T KOG0898 52 LNRGLTRKPH---SLIKKLRKAKKEAPPMEKPEVVKTHLRNMIIVPEMVGSMVGVYNGKTFNQVEIKPEMIGHYLGEFSI 128 (152) T ss_pred HHCCCCCCHH---HHHHHHHHHHHHCCCCCCCHHHHHHHHCCEEEHHHHCCEEEEECCCCCCEEECCHHHHHHHHHHCCC T ss_conf 9722122337---9999999887516964472789987631265086626357776175233133147887555411033 Q ss_pred CCCCCCCCCCC Q ss_conf 43635766665 Q gi|254780257|r 77 TRHCPGHGSDK 87 (92) Q Consensus 77 TRk~~~H~~~k 87 (92) |++++.||-.. T Consensus 129 TykpvkHgrpg 139 (152) T KOG0898 129 TYKPVKHGRPG 139 (152) T ss_pred CCCCCCCCCCC T ss_conf 22434367888 No 11 >KOG3265 consensus Probab=27.97 E-value=54 Score=15.24 Aligned_cols=40 Identities=23% Similarity=0.374 Sum_probs=28.1 Q ss_pred EECCCCCCCEE----EEEECCCEEEE--EECCCCCCCCCCCCCCCC Q ss_conf 78102226489----99708626899--985251101012533643 Q gi|254780257|r 39 DIMPQFIGLTF----GVYNGRKHVPV--SVSEEMVGFKLGDFAPTR 78 (92) Q Consensus 39 ~IlP~~vg~~i----~VyNGk~f~~v--~I~~~MVGhklGEFa~TR 78 (92) +=+.++||.|+ .-|+|++|++| ++..++---.|-|=-||. T Consensus 84 IP~~d~vGVTviLltC~Y~gQEFIRvGYyVnNeY~~~elrEnpP~k 129 (250) T KOG3265 84 IPEDDIVGVTVILLTCSYRGQEFIRVGYYVNNEYTEEELRENPPSK 129 (250) T ss_pred CCCCCEEEEEEEEEEEEECCCEEEEEEEEECCCCCCHHHCCCCCCC T ss_conf 7630011158999998876803689878861778725542289873 No 12 >TIGR00128 fabD malonyl CoA-acyl carrier protein transacylase; InterPro: IPR004410 Malonyl CoA-acyl carrier protein transacylase 2.3.1.39 from EC is involved in fatty acid biosynthesis and transfers the malonyl moeity from coenzyme A to acyl-carrier protein.; GO: 0004314 [acyl-carrier-protein] S-malonyltransferase activity, 0006633 fatty acid biosynthetic process. Probab=26.93 E-value=15 Score=18.49 Aligned_cols=15 Identities=20% Similarity=0.718 Sum_probs=10.4 Q ss_pred EECCC-CCCCCCCCCC Q ss_conf 98525-1101012533 Q gi|254780257|r 61 SVSEE-MVGFKLGDFA 75 (92) Q Consensus 61 ~I~~~-MVGhklGEFa 75 (92) .++|+ |.||=||||+ T Consensus 83 ~~~P~f~AGHSLGEYs 98 (295) T TIGR00128 83 GLKPDFVAGHSLGEYS 98 (295) T ss_pred CCCCCEEECCCHHHHH T ss_conf 8465346246347899 No 13 >TIGR03131 malonate_mdcH malonate decarboxylase, epsilon subunit. Members of this protein family are the epsilon subunit of malonate decarboxylase. This subunit has malonyl-CoA/dephospho-CoA acyltransferase activity. Malonate decarboxylase may be a soluble enzyme, or linked to membrane subunits and active as a sodium pump. The epsilon subunit is closely related to the malonyl CoA-acyl carrier protein (ACP) transacylase family described by TIGR00128, but acts on an ACP subunit of malonate decarboxylase that has an unusual coenzyme A derivative as its prothetic group. Probab=26.64 E-value=15 Score=18.45 Aligned_cols=10 Identities=30% Similarity=1.069 Sum_probs=4.7 Q ss_pred CCCCCCCCCC Q ss_conf 1101012533 Q gi|254780257|r 66 MVGFKLGDFA 75 (92) Q Consensus 66 MVGhklGEFa 75 (92) ++||-||||+ T Consensus 80 v~GHSlGE~a 89 (295) T TIGR03131 80 VAGYSVGEYA 89 (295) T ss_pred EEECCHHHHH T ss_conf 9767775899 No 14 >KOG1539 consensus Probab=26.03 E-value=59 Score=15.04 Aligned_cols=36 Identities=25% Similarity=0.283 Sum_probs=26.5 Q ss_pred EEEEEC-CCEECCCCCCCEEEEEECCCEEEEEECCCC Q ss_conf 987503-747810222648999708626899985251 Q gi|254780257|r 31 VRVWCR-NCDIMPQFIGLTFGVYNGRKHVPVSVSEEM 66 (92) Q Consensus 31 IkT~sR-~s~IlP~~vg~~i~VyNGk~f~~v~I~~~M 66 (92) ..+-.+ +-+-+-..||.+|.|||++++.-+.+.++| T Consensus 39 ~~~~~~~~~~~vtt~vgksfqvYd~~kl~ll~vs~~l 75 (910) T KOG1539 39 FRVVALGSTFYVTTCVGKSFQVYDVNKLNLLFVSKPL 75 (910) T ss_pred EEEEECCCEEEEEEECCCEEEEEECCCEEEEEECCCC T ss_conf 5545158529999854865899720034799965889 No 15 >pfam06668 ITI_HC_C Inter-alpha-trypsin inhibitor heavy chain C-terminus. This family represents the C-terminal region of inter-alpha-trypsin inhibitor heavy chains. Inter-alpha-trypsin inhibitors are glycoproteins with a high inhibitory activity against trypsin, built up from different combinations of four polypeptides: bikunin and the three heavy chains that belong to this family (HC1, HC2, HC3). The heavy chains do not have any protease inhibitory properties but have the capacity to interact in vitro and in vivo with hyaluronic acid, which promotes the stability of the extra-cellular matrix. All family members contain the pfam00092 domain. Probab=20.01 E-value=78 Score=14.34 Aligned_cols=23 Identities=26% Similarity=0.394 Sum_probs=13.5 Q ss_pred EEEEEECCCEEEEEECCCCCCCC Q ss_conf 89997086268999852511010 Q gi|254780257|r 48 TFGVYNGRKHVPVSVSEEMVGFK 70 (92) Q Consensus 48 ~i~VyNGk~f~~v~I~~~MVGhk 70 (92) .++|++.+.=+.|+|++|.|=-. T Consensus 28 ~i~I~~~~~~~~ieVTp~~I~l~ 50 (188) T pfam06668 28 TIGITFKKPDVQVEVTPEKITLT 50 (188) T ss_pred EEEEEECCCCEEEEEECCEEEEE T ss_conf 89999679985999977689997 Done!