BLAST/PSIBLAST alignment of GI: 254780257 and GI: 15965113 at iteration 1
>gi|15965113|ref|NP_385466.1| 30S ribosomal protein S19 [Sinorhizobium meliloti 1021] Length = 92
>gi|17987044|ref|NP_539678.1| 30S ribosomal protein S19 [Brucella melitensis bv. 1 str. 16M] Length = 92
>gi|23502106|ref|NP_698233.1| 30S ribosomal protein S19 [Brucella suis 1330] Length = 92
>gi|62290140|ref|YP_221933.1| 30S ribosomal protein S19 [Brucella abortus bv. 1 str. 9-941] Length = 92
>gi|82700063|ref|YP_414637.1| 30S ribosomal protein S19 [Brucella melitensis biovar Abortus 2308] Length = 92
>gi|150396211|ref|YP_001326678.1| 30S ribosomal protein S19 [Sinorhizobium medicae WSM419] Length = 92
>gi|161619185|ref|YP_001593072.1| 30S ribosomal protein S19 [Brucella canis ATCC 23365] Length = 92
>gi|163843495|ref|YP_001627899.1| 30S ribosomal protein S19 [Brucella suis ATCC 23445] Length = 92
>gi|189024378|ref|YP_001935146.1| Ribosomal protein S19/S15 [Brucella abortus S19] Length = 92
>gi|225627699|ref|ZP_03785736.1| ribosomal protein S19 [Brucella ceti str. Cudo] Length = 92
>gi|225852726|ref|YP_002732959.1| 30S ribosomal protein S19 [Brucella melitensis ATCC 23457] Length = 92
>gi|227821760|ref|YP_002825730.1| 30S ribosomal protein S19 [Sinorhizobium fredii NGR234] Length = 92
>gi|237815648|ref|ZP_04594645.1| ribosomal protein S19 [Brucella abortus str. 2308 A] Length = 92
>gi|254689449|ref|ZP_05152703.1| 30S ribosomal protein S19 [Brucella abortus bv. 6 str. 870] Length = 92
>gi|254693934|ref|ZP_05155762.1| 30S ribosomal protein S19 [Brucella abortus bv. 3 str. Tulya] Length = 92
>gi|254697584|ref|ZP_05159412.1| 30S ribosomal protein S19 [Brucella abortus bv. 2 str. 86/8/59] Length = 92
>gi|254701970|ref|ZP_05163798.1| 30S ribosomal protein S19 [Brucella suis bv. 5 str. 513] Length = 92
>gi|254704514|ref|ZP_05166342.1| 30S ribosomal protein S19 [Brucella suis bv. 3 str. 686] Length = 92
>gi|254710300|ref|ZP_05172111.1| 30S ribosomal protein S19 [Brucella pinnipedialis B2/94] Length = 92
>gi|254714297|ref|ZP_05176108.1| 30S ribosomal protein S19 [Brucella ceti M644/93/1] Length = 92
>gi|254717734|ref|ZP_05179545.1| 30S ribosomal protein S19 [Brucella ceti M13/05/1] Length = 92
>gi|254719287|ref|ZP_05181098.1| 30S ribosomal protein S19 [Brucella sp. 83/13] Length = 92
>gi|254730478|ref|ZP_05189056.1| 30S ribosomal protein S19 [Brucella abortus bv. 4 str. 292] Length = 92
>gi|256031794|ref|ZP_05445408.1| 30S ribosomal protein S19 [Brucella pinnipedialis M292/94/1] Length = 92
>gi|256044879|ref|ZP_05447783.1| 30S ribosomal protein S19 [Brucella melitensis bv. 1 str. Rev.1] Length = 92
>gi|256061309|ref|ZP_05451459.1| 30S ribosomal protein S19 [Brucella neotomae 5K33] Length = 92
>gi|256113783|ref|ZP_05454587.1| 30S ribosomal protein S19 [Brucella melitensis bv. 3 str. Ether] Length = 92
>gi|256159964|ref|ZP_05457682.1| 30S ribosomal protein S19 [Brucella ceti M490/95/1] Length = 92
>gi|256255195|ref|ZP_05460731.1| 30S ribosomal protein S19 [Brucella ceti B1/94] Length = 92
>gi|256257695|ref|ZP_05463231.1| 30S ribosomal protein S19 [Brucella abortus bv. 9 str. C68] Length = 92
>gi|256263784|ref|ZP_05466316.1| 30S ribosomal protein S19 [Brucella melitensis bv. 2 str. 63/9] Length = 92
>gi|256369653|ref|YP_003107163.1| 30S ribosomal protein S19 [Brucella microti CCM 4915] Length = 92
>gi|260168928|ref|ZP_05755739.1| 30S ribosomal protein S19 [Brucella sp. F5/99] Length = 92
>gi|260546688|ref|ZP_05822427.1| ribosomal protein S19/S15 [Brucella abortus NCTC 8038] Length = 92
>gi|260565519|ref|ZP_05836003.1| 30S ribosomal protein S19 [Brucella melitensis bv. 1 str. 16M] Length = 92
>gi|260566242|ref|ZP_05836712.1| ribosomal protein S19/S15 [Brucella suis bv. 4 str. 40] Length = 92
>gi|260754972|ref|ZP_05867320.1| ribosomal protein S19 [Brucella abortus bv. 6 str. 870] Length = 92
>gi|260758188|ref|ZP_05870536.1| ribosomal protein S19 [Brucella abortus bv. 4 str. 292] Length = 92
>gi|260762014|ref|ZP_05874357.1| 30S ribosomal protein S19 [Brucella abortus bv. 2 str. 86/8/59] Length = 92
>gi|260883981|ref|ZP_05895595.1| ribosomal protein S19 [Brucella abortus bv. 9 str. C68] Length = 92
>gi|261214226|ref|ZP_05928507.1| ribosomal protein S19 [Brucella abortus bv. 3 str. Tulya] Length = 92
>gi|261219577|ref|ZP_05933858.1| 30S ribosomal protein S19 [Brucella ceti M13/05/1] Length = 92
>gi|261222391|ref|ZP_05936672.1| 30S ribosomal protein S19 [Brucella ceti B1/94] Length = 92
>gi|261317863|ref|ZP_05957060.1| ribosomal protein S19 [Brucella pinnipedialis B2/94] Length = 92
>gi|261322072|ref|ZP_05961269.1| 30S ribosomal protein S19 [Brucella ceti M644/93/1] Length = 92
>gi|261325316|ref|ZP_05964513.1| 30S ribosomal protein S19 [Brucella neotomae 5K33] Length = 92
>gi|261752538|ref|ZP_05996247.1| ribosomal protein S19 [Brucella suis bv. 5 str. 513] Length = 92
>gi|261755197|ref|ZP_05998906.1| 30S ribosomal protein S19 [Brucella suis bv. 3 str. 686] Length = 92
>gi|261758421|ref|ZP_06002130.1| ribosomal protein S19 [Brucella sp. F5/99] Length = 92
>gi|265984287|ref|ZP_06097022.1| ribosomal protein S19 [Brucella sp. 83/13] Length = 92
>gi|265988892|ref|ZP_06101449.1| 30S ribosomal protein S19 [Brucella pinnipedialis M292/94/1] Length = 92
>gi|265991306|ref|ZP_06103863.1| ribosomal protein S19 [Brucella melitensis bv. 1 str. Rev.1] Length = 92
>gi|265995143|ref|ZP_06107700.1| 30S ribosomal protein S19 [Brucella melitensis bv. 3 str. Ether] Length = 92
>gi|265998356|ref|ZP_06110913.1| ribosomal protein S19 [Brucella ceti M490/95/1] Length = 92
>gi|294852566|ref|ZP_06793239.1| 30S ribosomal protein S19 [Brucella sp. NVSL 07-0026] Length = 92
>gi|297248535|ref|ZP_06932253.1| 30S ribosomal protein S19 [Brucella abortus bv. 5 str. B3196] Length = 92
>gi|306838039|ref|ZP_07470897.1| ribosomal protein S19 [Brucella sp. NF 2653] Length = 92
>gi|306840305|ref|ZP_07473077.1| ribosomal protein S19 [Brucella sp. BO2] Length = 92
>gi|306844133|ref|ZP_07476727.1| ribosomal protein S19 [Brucella sp. BO1] Length = 92
>gi|307322075|ref|ZP_07601451.1| ribosomal protein S19 [Sinorhizobium meliloti AK83] Length = 92
>gi|54039425|sp|P66489|RS19_BRUME RecName: Full=30S ribosomal protein S19 Length = 92
>gi|54039426|sp|P66490|RS19_BRUSU RecName: Full=30S ribosomal protein S19 Length = 92
>gi|54042157|sp|P66488|RS19_RHIME RecName: Full=30S ribosomal protein S19 Length = 92
>gi|75505261|sp|Q57CR2|RS19_BRUAB RecName: Full=30S ribosomal protein S19 Length = 92
>gi|119367072|sp|Q2YM07|RS19_BRUA2 RecName: Full=30S ribosomal protein S19 Length = 92
>gi|166199987|sp|A6U863|RS19_SINMW RecName: Full=30S ribosomal protein S19 Length = 92
>gi|189029699|sp|A9M5P6|RS19_BRUC2 RecName: Full=30S ribosomal protein S19 Length = 92
>gi|189029700|sp|B0CH28|RS19_BRUSI RecName: Full=30S ribosomal protein S19 Length = 92
>gi|226735150|sp|B2S675|RS19_BRUA1 RecName: Full=30S ribosomal protein S19 Length = 92
>gi|254812983|sp|C0RJJ7|RS19_BRUMB RecName: Full=30S ribosomal protein S19 Length = 92
>gi|254813017|sp|C3MAY4|RS19_RHISN RecName: Full=30S ribosomal protein S19 Length = 92
>gi|15074293|emb|CAC45939.1| Probable 30S ribosomal protein S19 [Sinorhizobium meliloti 1021] Length = 92
>gi|17982700|gb|AAL51942.1| ssu ribosomal protein s19p [Brucella melitensis bv. 1 str. 16M] Length = 92
>gi|23348066|gb|AAN30148.1| ribosomal protein S19 [Brucella suis 1330] Length = 92
>gi|62196272|gb|AAX74572.1| RpsS, ribosomal protein S19 [Brucella abortus bv. 1 str. 9-941] Length = 92
>gi|82616164|emb|CAJ11207.1| Ribosomal protein S19/S15:Ribosomal protein S19, bacterial and organelle form [Brucella melitensis biovar Abortus 2308] Length = 92
>gi|150027726|gb|ABR59843.1| ribosomal protein S19 [Sinorhizobium medicae WSM419] Length = 92
>gi|161335996|gb|ABX62301.1| 30S ribosomal protein S19 [Brucella canis ATCC 23365] Length = 92
>gi|163674218|gb|ABY38329.1| ribosomal protein S19 [Brucella suis ATCC 23445] Length = 92
>gi|189019950|gb|ACD72672.1| Ribosomal protein S19/S15 [Brucella abortus S19] Length = 92
>gi|225617704|gb|EEH14749.1| ribosomal protein S19 [Brucella ceti str. Cudo] Length = 92
>gi|225641091|gb|ACO01005.1| ribosomal protein S19 [Brucella melitensis ATCC 23457] Length = 92
>gi|227340759|gb|ACP24977.1| ribosomal protein S19 [Sinorhizobium fredii NGR234] Length = 92
>gi|237788946|gb|EEP63157.1| ribosomal protein S19 [Brucella abortus str. 2308 A] Length = 92
>gi|255999815|gb|ACU48214.1| 30S ribosomal protein S19 [Brucella microti CCM 4915] Length = 92
>gi|260095738|gb|EEW79615.1| ribosomal protein S19/S15 [Brucella abortus NCTC 8038] Length = 92
>gi|260151587|gb|EEW86681.1| 30S ribosomal protein S19 [Brucella melitensis bv. 1 str. 16M] Length = 92
>gi|260155760|gb|EEW90840.1| ribosomal protein S19/S15 [Brucella suis bv. 4 str. 40] Length = 92
>gi|260668506|gb|EEX55446.1| ribosomal protein S19 [Brucella abortus bv. 4 str. 292] Length = 92
>gi|260672446|gb|EEX59267.1| 30S ribosomal protein S19 [Brucella abortus bv. 2 str. 86/8/59] Length = 92
>gi|260675080|gb|EEX61901.1| ribosomal protein S19 [Brucella abortus bv. 6 str. 870] Length = 92
>gi|260873509|gb|EEX80578.1| ribosomal protein S19 [Brucella abortus bv. 9 str. C68] Length = 92
>gi|260915833|gb|EEX82694.1| ribosomal protein S19 [Brucella abortus bv. 3 str. Tulya] Length = 92
>gi|260920975|gb|EEX87628.1| 30S ribosomal protein S19 [Brucella ceti B1/94] Length = 92
>gi|260924666|gb|EEX91234.1| 30S ribosomal protein S19 [Brucella ceti M13/05/1] Length = 92
>gi|261294762|gb|EEX98258.1| 30S ribosomal protein S19 [Brucella ceti M644/93/1] Length = 92
>gi|261297086|gb|EEY00583.1| ribosomal protein S19 [Brucella pinnipedialis B2/94] Length = 92
>gi|261301296|gb|EEY04793.1| 30S ribosomal protein S19 [Brucella neotomae 5K33] Length = 92
>gi|261738405|gb|EEY26401.1| ribosomal protein S19 [Brucella sp. F5/99] Length = 92
>gi|261742291|gb|EEY30217.1| ribosomal protein S19 [Brucella suis bv. 5 str. 513] Length = 92
>gi|261744950|gb|EEY32876.1| 30S ribosomal protein S19 [Brucella suis bv. 3 str. 686] Length = 92
>gi|262552824|gb|EEZ08814.1| ribosomal protein S19 [Brucella ceti M490/95/1] Length = 92
>gi|262766256|gb|EEZ12045.1| 30S ribosomal protein S19 [Brucella melitensis bv. 3 str. Ether] Length = 92
>gi|263002090|gb|EEZ14665.1| ribosomal protein S19 [Brucella melitensis bv. 1 str. Rev.1] Length = 92
>gi|263093912|gb|EEZ17846.1| 30S ribosomal protein S19 [Brucella melitensis bv. 2 str. 63/9] Length = 92
>gi|264661089|gb|EEZ31350.1| 30S ribosomal protein S19 [Brucella pinnipedialis M292/94/1] Length = 92
>gi|264662879|gb|EEZ33140.1| ribosomal protein S19 [Brucella sp. 83/13] Length = 92
>gi|294821155|gb|EFG38154.1| 30S ribosomal protein S19 [Brucella sp. NVSL 07-0026] Length = 92
>gi|297175704|gb|EFH35051.1| 30S ribosomal protein S19 [Brucella abortus bv. 5 str. B3196] Length = 92
>gi|306275576|gb|EFM57308.1| ribosomal protein S19 [Brucella sp. BO1] Length = 92
>gi|306289704|gb|EFM60893.1| ribosomal protein S19 [Brucella sp. BO2] Length = 92
>gi|306406963|gb|EFM63184.1| ribosomal protein S19 [Brucella sp. NF 2653] Length = 92
>gi|306892257|gb|EFN23067.1| ribosomal protein S19 [Sinorhizobium meliloti AK83] Length = 92
Score = 129 bits (324), Expect = 1e-28, Method: Compositional matrix adjust.
Identities = 62/92 (67%), Positives = 71/92 (77%)
Query: 1 MARSVRKGPFVTKSLLKKVSQARDSGGRGVVRVWCRNCDIMPQFIGLTFGVYNGRKHVPV 60
MARSV KGPFV LLKK + R+ G V+++W R I+PQF+GLTFGVYNG KHVPV
Sbjct: 1 MARSVWKGPFVDGYLLKKAEKVREGGRNEVIKMWSRRSTILPQFVGLTFGVYNGNKHVPV 60
Query: 61 SVSEEMVGFKLGDFAPTRHCPGHGSDKKAKRK 92
SVSEEMVG K G+FAPTR GHG+DKKAKRK
Sbjct: 61 SVSEEMVGHKFGEFAPTRTYYGHGADKKAKRK 92