BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780257|ref|YP_003064670.1| SSU ribosomal protein S19P [Candidatus Liberibacter asiaticus str. psy62] (92 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780257|ref|YP_003064670.1| SSU ribosomal protein S19P [Candidatus Liberibacter asiaticus str. psy62] Length = 92 Score = 189 bits (481), Expect = 5e-51, Method: Compositional matrix adjust. Identities = 92/92 (100%), Positives = 92/92 (100%) Query: 1 MARSVRKGPFVTKSLLKKVSQARDSGGRGVVRVWCRNCDIMPQFIGLTFGVYNGRKHVPV 60 MARSVRKGPFVTKSLLKKVSQARDSGGRGVVRVWCRNCDIMPQFIGLTFGVYNGRKHVPV Sbjct: 1 MARSVRKGPFVTKSLLKKVSQARDSGGRGVVRVWCRNCDIMPQFIGLTFGVYNGRKHVPV 60 Query: 61 SVSEEMVGFKLGDFAPTRHCPGHGSDKKAKRK 92 SVSEEMVGFKLGDFAPTRHCPGHGSDKKAKRK Sbjct: 61 SVSEEMVGFKLGDFAPTRHCPGHGSDKKAKRK 92 >gi|254781118|ref|YP_003065531.1| lysyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 502 Score = 21.2 bits (43), Expect = 3.4, Method: Composition-based stats. Identities = 8/16 (50%), Positives = 11/16 (68%) Query: 7 KGPFVTKSLLKKVSQA 22 K PF KS+L+ V +A Sbjct: 314 KAPFACKSMLQLVKEA 329 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.323 0.139 0.437 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,828 Number of Sequences: 1233 Number of extensions: 2172 Number of successful extensions: 2 Number of sequences better than 100.0: 2 Number of HSP's better than 100.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 92 length of database: 328,796 effective HSP length: 60 effective length of query: 32 effective length of database: 254,816 effective search space: 8154112 effective search space used: 8154112 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 31 (16.5 bits)