Score = 67.4 bits (165), Expect = 3e-13 Identities = 21/62 (33%), Positives = 30/62 (48%), Gaps = 1/62 (1%) Query: 7 YDTIISPVIAEKSTLLAG-QNQVVFNVKKDSSKSEIKSAVEALFSVKVVSVNTLIRKGKV 65 +D I P + EK+ QN++ F V +SK E+ AVE + V V VNT Sbjct: 2 WDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGE 61 Query: 66 KR 67 K+ Sbjct: 62 KK 63
class: Alpha and beta proteins (a+b)
fold: Ribosomal proteins S24e, L23 and L15e
superfamily: Ribosomal proteins S24e, L23 and L15e
family: L23p
domain: Ribosomal protein L23
species: Archaeon Haloarcula marismortui [TaxId: 2238]