BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780262|ref|YP_003064675.1| 30S ribosomal protein S10 [Candidatus Liberibacter asiaticus str. psy62] (104 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780262|ref|YP_003064675.1| 30S ribosomal protein S10 [Candidatus Liberibacter asiaticus str. psy62] Length = 104 Score = 209 bits (533), Expect = 8e-57, Method: Compositional matrix adjust. Identities = 104/104 (100%), Positives = 104/104 (100%) Query: 1 MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60 MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD Sbjct: 1 MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60 Query: 61 KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104 KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL Sbjct: 61 KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104 >537021.9.peg.1079_1 Length = 251 Score = 23.1 bits (48), Expect = 1.3, Method: Compositional matrix adjust. Identities = 7/19 (36%), Positives = 13/19 (68%) Query: 46 RSIRRFTVNRSPHVDKKSR 64 R + R T+N +PH +++ R Sbjct: 69 RQVIRMTINETPHYNEQER 87 >gi|255764477|ref|YP_003065232.2| dephospho-CoA kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 199 Score = 21.6 bits (44), Expect = 3.6, Method: Compositional matrix adjust. Identities = 14/49 (28%), Positives = 23/49 (46%), Gaps = 17/49 (34%) Query: 44 FPRSIRRFTVNRSPHVDKKSRDQLEMRIYKRLLYIIKPTPQTVDALMKL 92 FPRSI+ VN++ RLL I++ +P ++ L K+ Sbjct: 51 FPRSIQNNKVNKA-----------------RLLGILQKSPAKLEILEKI 82 >gi|254781060|ref|YP_003065473.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 249 Score = 20.4 bits (41), Expect = 8.6, Method: Compositional matrix adjust. Identities = 21/73 (28%), Positives = 33/73 (45%), Gaps = 16/73 (21%) Query: 44 FPRSIRRFTVNRSPHVD--------------KKSRDQLEMRIYKRLLYIIKPTPQTVDAL 89 F R +R+ T ++D KK + L+MR+ + L I+ T +D + Sbjct: 122 FTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLD-I 180 Query: 90 MKLDIAA-GVNVV 101 L IAA GVN + Sbjct: 181 DALKIAAQGVNAL 193 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.326 0.139 0.393 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,157 Number of Sequences: 1233 Number of extensions: 1904 Number of successful extensions: 6 Number of sequences better than 100.0: 6 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of query: 104 length of database: 328,796 effective HSP length: 62 effective length of query: 42 effective length of database: 252,350 effective search space: 10598700 effective search space used: 10598700 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 32 (16.9 bits)