>cd04124 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily. RabL2s are novel Rab proteins identified recently which display features that are distinct from other Rabs, and have been termed Rab-like. RabL2 contains RabL2a and RabL2b, two very similar Rab proteins that share 98% sequence identity in humans. RabL2b maps to the subtelomeric region of chromosome 22q13.3 and RabL2a maps to 2q13, a region that suggests it is also a subtelomeric gene. Both genes are believed to be expressed ubiquitously, suggesting that RabL2s are the first example of duplicated genes in human proximal subtelomeric regions that are both expressed actively. Like other Rab-like proteins, RabL2s lack a prenylation site at the C-terminus. The specific functions of RabL2a and RabL2b remain unknown. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-b

Probab=98.82 E-value=1.4e-08 Score=72.28 Aligned_cols=140 Identities=16% Similarity=0.171 Sum_probs=80.0 Q ss_pred EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHH--HHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHHHHHH Q ss_conf 7999990468988789999998764442001312686869--86292063789998219908999847873024677987 Q gi|254780263|r 13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEE--KLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNMIT 90 (392) Q Consensus 13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E--~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~~mi~ 90 (392) T Consensus 1 iKivllGd~~VGKTsli~r~~~~------------~f~~~~~~Tig~~~~~~~~~~~~~~~~l~iwDtaG~e~f~~~~~~ 68 (161) T cd04124 1 VKIILLGDSAVGKSKLVERFLMD------------GYEPQQLSTYALTLYKHNAKFEGKTILVDFWDTAGQERFQTMHAS 68 (161) T ss_pred CEEEEECCCCCCHHHHHHHHHHC------------CCCCCCCCCCCEEEEEEEEEECCEEEEEEEEECCCCCCCCHHHHH T ss_conf 98999998996789999999809------------779972665415799999999999999999979998434324699 Q ss_pred HHHCCCCEEEEECCCCCCC-CCHHHHHHHHHH--CCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEECCC Q ss_conf 7400233145201234433-210677888863--1876023310023335612221101232100111014532210233 Q gi|254780263|r 91 GATQADGAILVCAAEDGPK-PQTREHILLARQ--IGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIR 167 (392) Q Consensus 91 g~~~~D~ailvVda~~G~~-~QT~eh~~l~~~--lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pii~ 167 (392) T Consensus 69 y~~~a~~~ilvfDit~~~Sf~~~~~w~~~i~~~~~~~p-~ilVgNK~DL~-~~-~~~----~~~~~a~~~----~~~f~e 137 (161) T cd04124 69 YYHKAHACILVFDVTRKITYKNLSKWYEELREYRPEIP-CIVVANKIDLD-PS-VTQ----KKFNFAEKH----NLPLYY 137 (161) T ss_pred HHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCC-EEEEEECCCCC-CH-HHH----HHHHHHHHC----CCEEEE T ss_conf 73568767999968977889999999999998686998-99999971177-42-589----999999986----991999 Q ss_pred CEEEEEEE Q ss_conf 11467641 Q gi|254780263|r 168 GSALCALQ 175 (392) Q Consensus 168 ~sa~~g~~ 175 (392) T Consensus 138 tSAk~g~n 145 (161) T cd04124 138 VSAADGTN 145 (161) T ss_pred EECCCCCC T ss_conf 90783809

HHsearch alignment for GI: 254780263 and conserved domain: cd04124