HHsearch alignment for GI: 254780264 and conserved domain: COG1163

>COG1163 DRG Predicted GTPase [General function prediction only].
Probab=98.19  E-value=1.2e-05  Score=54.89  Aligned_cols=113  Identities=16%  Similarity=0.278  Sum_probs=78.4

Q ss_pred             EEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCEECCCCEECCCHHHHHHHCCCEEEEEEEEEECCCCCCCEEEEEEECCC
Q ss_conf             52799986878897789999999808732142201795613780889870853764079999607778713899981798
Q gi|254780264|r   10 SRNFGIMAHIDAGKTTTTERILYYAGKSHKIGEVHDGSATMDWMEQEQERGITITSASTTVFWPGRDGGQKKLTIIDTPG   89 (701)
Q Consensus        10 iRNv~iiaHvd~GKTTL~d~LL~~~g~i~~~g~v~~g~~~~D~~~~E~eRgITi~ss~~sl~~~~~~~~~~~iNlIDTPG   89 (701)
T Consensus        63 da~v~lVGfPsvGKStLL~~L---Tnt~seva~y~----FT-----------Tl~~vPG~l~Y~g-----a~IQild~Pg  119 (365)
T COG1163          63 DATVALVGFPSVGKSTLLNKL---TNTKSEVADYP----FT-----------TLEPVPGMLEYKG-----AQIQLLDLPG  119 (365)
T ss_pred             CEEEEEECCCCCCHHHHHHHH---HCCCCCCCCCC----CE-----------ECCCCCCEEEECC-----CEEEEECCCC
T ss_conf             738999768874589999887---68876434567----41-----------0244574475478-----1699972763


Q ss_pred             CCCC-------HHHHHHHHHHHCEEEEEEECCCCCCHHHHHHHHHHHHCCC-----CEEEEECCCCCCC
Q ss_conf             7552-------8999999986045699995588888347999999987399-----7899981767658
Q gi|254780264|r   90 HVDF-------TMEVERSIRVTDGAIALLDSNAGVEPQTETVWRQADKYSV-----PRVIFCNKMDKMG  146 (701)
Q Consensus        90 H~DF-------~~Ev~~aL~~~DgailvVDa~eGv~~qT~~vlr~~~~~~l-----p~ilvINKiDr~~  146 (701)
T Consensus       120 ii~gas~g~grG~~vls~~R~ADlIiiVld~~~~~~~-~~~i~~ELe~~GIrlnk~~p~V~I~kk~~gG  187 (365)
T COG1163         120 IIEGASSGRGRGRQVLSVARNADLIIIVLDVFEDPHH-RDIIERELEDVGIRLNKRPPDVTIKKKESGG  187 (365)
T ss_pred             CCCCCCCCCCCCCEEEEEECCCCEEEEEEECCCCHHH-HHHHHHHHHHCCEEECCCCCCEEEEEECCCC
T ss_conf             1257656888764654652158889999716888248-8999999985676821799965999952598