>cd00157 Rho Rho (Ras homology) family. Members of the Rho family include RhoA, Cdc42, Rac, Rnd, Wrch1, RhoBTB, and Rop. There are 22 human Rho family members identified currently. These proteins are all involved in the reorganization of the actin cytoskeleton in response to external stimuli. They also have roles in cell transformation by Ras in cytokinesis, in focal adhesion formation and in the stimulation of stress-activated kinase. These various functions are controlled through distinct effector proteins and mediated through a GTP-binding/GTPase cycle involving three classes of regulating proteins: GAPs (GTPase-activating proteins), GEFs (guanine nucleotide exchange factors), and GDIs (guanine nucleotide dissociation inhibitors). Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of most Rho protein

Probab=98.71 E-value=2.2e-07 Score=66.08 Aligned_cols=111 Identities=23% Similarity=0.212 Sum_probs=73.1 Q ss_pred EEEEECCCCCCHHHHHHHHHHHCCCCCCCCEECCCCEECCCHHHHHHHCCCEEE-EEEEEEECCCCCCCEEEEEEECCCC Q ss_conf 799986878897789999999808732142201795613780889870853764-0799996077787138999817987 Q gi|254780264|r 12 NFGIMAHIDAGKTTTTERILYYAGKSHKIGEVHDGSATMDWMEQEQERGITITS-ASTTVFWPGRDGGQKKLTIIDTPGH 90 (701) Q Consensus 12 Nv~iiaHvd~GKTTL~d~LL~~~g~i~~~g~v~~g~~~~D~~~~E~eRgITi~s-s~~sl~~~~~~~~~~~iNlIDTPGH 90 (701) T Consensus 2 Ki~llGd~~VGKTsli~r~~~--~~f~~--~------y~~----------Ti~~~~~~~~~~---~~~~~~l~iwDt~G~ 58 (171) T cd00157 2 KIVVVGDGAVGKTCLLISYTT--GKFPT--E------YVP----------TVFDNYSATVTV---DGKQVNLGLWDTAGQ 58 (171) T ss_pred EEEEECCCCCCHHHHHHHHHC--CCCCC--C------CCC----------EEEEEEEEEEEE---CCEEEEEEEEECCCC T ss_conf 899999999669999999962--99998--7------588----------034666899999---999999999989987 Q ss_pred CCCHHHHHHHHHHHCEEEEEEECCCCCCHHH-HHHHHH-H--HHCCCCEEEEECCCCCC Q ss_conf 5528999999986045699995588888347-999999-9--87399789998176765 Q gi|254780264|r 91 VDFTMEVERSIRVTDGAIALLDSNAGVEPQT-ETVWRQ-A--DKYSVPRVIFCNKMDKM 145 (701) Q Consensus 91 ~DF~~Ev~~aL~~~DgailvVDa~eGv~~qT-~~vlr~-~--~~~~lp~ilvINKiDr~ 145 (701) T Consensus 59 e~~~~~~~~~~~~a~~~ilvydit~~~Sf~~i~~~w~~~i~~~~~~~piilvgNK~DL~ 117 (171) T cd00157 59 EEYDRLRPLSYPNTDVFLICFSVDSPSSFENVKTKWIPEIRHYCPNVPIILVGTKIDLR 117 (171) T ss_pred CCCCCCHHHHHHHCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCC T ss_conf 10241322344426589999968977889999999999999859998689999871001

HHsearch alignment for GI: 254780264 and conserved domain: cd00157