>cd01863 Rab18 Rab18 subfamily. Mammalian Rab18 is implicated in endocytic transport and is expressed most highly in polarized epithelial cells. However, trypanosomal Rab, TbRAB18, is upregulated in the BSF (Blood Stream Form) stage and localized predominantly to elements of the Golgi complex. In human and mouse cells, Rab18 has been identified in lipid droplets, organelles that store neutral lipids. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of mos

Probab=98.83 E-value=3.9e-08 Score=71.00 Aligned_cols=111 Identities=21% Similarity=0.298 Sum_probs=74.4 Q ss_pred EEEECCCCCCHHHHHHHHHHHCCCCCCCCEECCCCEECCCHHHHHHHCCCEEEEEEEEEECCCCCCCEEEEEEECCCCCC Q ss_conf 99986878897789999999808732142201795613780889870853764079999607778713899981798755 Q gi|254780264|r 13 FGIMAHIDAGKTTTTERILYYAGKSHKIGEVHDGSATMDWMEQEQERGITITSASTTVFWPGRDGGQKKLTIIDTPGHVD 92 (701) Q Consensus 13 v~iiaHvd~GKTTL~d~LL~~~g~i~~~g~v~~g~~~~D~~~~E~eRgITi~ss~~sl~~~~~~~~~~~iNlIDTPGH~D 92 (701) T Consensus 3 ivvvG~~~vGKTsli~r~~~--~~f~~--~------~~~ti------~~~~~~~--~~~~---~~~~~~l~iwDt~g~~~ 61 (161) T cd01863 3 ILLIGDSGVGKSSLLLRFTD--DTFDP--D------LAATI------GVDFKVK--TLTV---DGKKVKLAIWDTAGQER 61 (161) T ss_pred EEEECCCCCCHHHHHHHHHH--CCCCC--C------CCCCC------CCCCEEE--EEEE---CCEEEEEEEEECCCCCC T ss_conf 99999799579999999963--99999--8------48731------3342389--9999---99999999999999842 Q ss_pred CHHHHHHHHHHHCEEEEEEECCCCCCHHHHHHH-HHHH----HCCCCEEEEECCCCC Q ss_conf 289999999860456999955888883479999-9998----739978999817676 Q gi|254780264|r 93 FTMEVERSIRVTDGAIALLDSNAGVEPQTETVW-RQAD----KYSVPRVIFCNKMDK 144 (701) Q Consensus 93 F~~Ev~~aL~~~DgailvVDa~eGv~~qT~~vl-r~~~----~~~lp~ilvINKiDr 144 (701) T Consensus 62 ~~~~~~~~~~~a~~~ilvfd~~~~~Sf~~i~~~~~~i~~~~~~~~~~~ilVgnK~D~ 118 (161) T cd01863 62 FRTLTSSYYRGAQGVILVYDVTRRDTFTNLETWLNELETYSTNNDIVKMLVGNKIDK 118 (161) T ss_pred CCCCHHHHHHHCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCC T ss_conf 353422441321534899767826569999999999998568888737887310440

HHsearch alignment for GI: 254780264 and conserved domain: cd01863