>cd01875 RhoG RhoG subfamily. RhoG is a GTPase with high sequence similarity to members of the Rac subfamily, including the regions involved in effector recognition and binding. However, RhoG does not bind to known Rac1 and Cdc42 effectors, including proteins containing a Cdc42/Rac interacting binding (CRIB) motif. Instead, RhoG interacts directly with Elmo, an upstream regulator of Rac1, in a GTP-dependent manner and forms a ternary complex with Dock180 to induce activation of Rac1. The RhoG-Elmo-Dock180 pathway is required for activation of Rac1 and cell spreading mediated by integrin, as well as for neurite outgrowth induced by nerve growth factor. Thus RhoG activates Rac1 through Elmo and Dock180 to control cell morphology. RhoG has also been shown to play a role in caveolar trafficking and has a novel role in signaling the neutrophil respiratory burst stimulated by G protein-coupled receptor (GPCR) agonists. Most Rho proteins contain a lipid modification site at the C-termin

Probab=98.32 E-value=6.6e-06 Score=56.67 Aligned_cols=112 Identities=17% Similarity=0.109 Sum_probs=73.2 Q ss_pred EEEEECCCCCCHHHHHHHHHHHCCCCCCCCEECCCCEECCCHHHHHHHCCCEEEEEEEEEECCCCCCCEEEEEEECCCCC Q ss_conf 79998687889778999999980873214220179561378088987085376407999960777871389998179875 Q gi|254780264|r 12 NFGIMAHIDAGKTTTTERILYYAGKSHKIGEVHDGSATMDWMEQEQERGITITSASTTVFWPGRDGGQKKLTIIDTPGHV 91 (701) Q Consensus 12 Nv~iiaHvd~GKTTL~d~LL~~~g~i~~~g~v~~g~~~~D~~~~E~eRgITi~ss~~sl~~~~~~~~~~~iNlIDTPGH~ 91 (701) T Consensus 5 KivlvGd~~VGKTsli~r~~~--~~F~~--------~y~p----------ti~~-~~~~~~~-i~~~~v~l~iwDtaG~e 62 (191) T cd01875 5 KCVVVGDGAVGKTCLLICYTT--NAFPK--------EYIP----------TVFD-NYSAQTA-VDGRTVSLNLWDTAGQE 62 (191) T ss_pred EEEEECCCCCCHHHHHHHHHH--CCCCC--------CCCC----------CCCE-EEEEEEE-ECCEEEEEEEEECCCCC T ss_conf 999999999899999999972--99998--------6466----------2100-0467899-99999999998588870 Q ss_pred CCHHHHHHHHHHHCEEEEEEECCCCCCHHHH-HHHHHHH---HCCCCEEEEECCCCCC Q ss_conf 5289999999860456999955888883479-9999998---7399789998176765 Q gi|254780264|r 92 DFTMEVERSIRVTDGAIALLDSNAGVEPQTE-TVWRQAD---KYSVPRVIFCNKMDKM 145 (701) Q Consensus 92 DF~~Ev~~aL~~~DgailvVDa~eGv~~qT~-~vlr~~~---~~~lp~ilvINKiDr~ 145 (701) T Consensus 63 ~~~~~~~~~~~~a~~~ilvfdvt~~~Sf~~v~~~w~~ei~~~~~~~piiLvGnK~DL~ 120 (191) T cd01875 63 EYDRLRTLSYPQTNVFIICFSIASPSSYENVRHKWHPEVCHHCPNVPILLVGTKKDLR 120 (191) T ss_pred CHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCC T ss_conf 0356778774478689999857977889999999999999709699789998880102

HHsearch alignment for GI: 254780264 and conserved domain: cd01875