HHsearch alignment for GI: 254780264 and conserved domain: cd01891

>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily. BipA is a protein belonging to the ribosome-binding family of GTPases and is widely distributed in bacteria and plants. BipA was originally described as a protein that is induced in Salmonella typhimurium after exposure to bactericidal/permeability-inducing protein (a cationic antimicrobial protein produced by neutrophils), and has since been identified in E. coli as well. The properties thus far described for BipA are related to its role in the process of pathogenesis by enteropathogenic E. coli. It appears to be involved in the regulation of several processes important for infection, including rearrangements of the cytoskeleton of the host, bacterial resistance to host defense peptides, flagellum-mediated cell motility, and expression of K5 capsular genes. It has been proposed that BipA may utilize a novel mechanism to regulate the expression of target genes. In addition, BipA from enteropathogenic E. co
Probab=100.00  E-value=0  Score=363.64  Aligned_cols=145  Identities=37%  Similarity=0.559  Sum_probs=136.7

Q ss_pred             HEEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCEECCCCEECCCHHHHHHHCCCEEEEEEEEEECCCCCCCEEEEEEECC
Q ss_conf             25279998687889778999999980873214220179561378088987085376407999960777871389998179
Q gi|254780264|r    9 DSRNFGIMAHIDAGKTTTTERILYYAGKSHKIGEVHDGSATMDWMEQEQERGITITSASTTVFWPGRDGGQKKLTIIDTP   88 (701)
Q Consensus         9 ~iRNv~iiaHvd~GKTTL~d~LL~~~g~i~~~g~v~~g~~~~D~~~~E~eRgITi~ss~~sl~~~~~~~~~~~iNlIDTP   88 (701)
T Consensus         1 nIRNv~iiGHvd~GKTTL~~~Ll~~tg~~~~~~~~~~--~~~D~~~~E~ergiTI~~~~~~~~~~-----~~~~n~IDtP   73 (194)
T cd01891           1 DIRNIAIIAHVDHGKTTLVDALLKQSGTFRENEEVEE--RVMDSNDLERERGITILAKNTAVTYK-----DTKINIVDTP   73 (194)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCE--EEECCCHHHHHCCCCEEEEEEEEEEC-----CEEEEEEECC
T ss_conf             9878999906898799999999997487630465216--86147588887287633458999989-----9889999899


Q ss_pred             CCCCCHHHHHHHHHHHCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHCCCC
Q ss_conf             875528999999986045699995588888347999999987399789998176765875555666411110
Q gi|254780264|r   89 GHVDFTMEVERSIRVTDGAIALLDSNAGVEPQTETVWRQADKYSVPRVIFCNKMDKMGADFYRSVEMISSRL  160 (701)
Q Consensus        89 GH~DF~~Ev~~aL~~~DgailvVDa~eGv~~qT~~vlr~~~~~~lp~ilvINKiDr~~~d~~~~l~~i~~~l  160 (701)
T Consensus        74 GH~dF~~~~~~~~~~~D~ailVVdA~~Gv~~QT~~~l~~a~~~~~~~iv~iNK~D~~~a~~~~v~~ei~~~~  145 (194)
T cd01891          74 GHADFGGEVERVLSMVDGVLLLVDASEGPMPQTRFVLKKALELGLKPIVVINKIDRPDARPEEVVDEVFDLF  145 (194)
T ss_pred             CCHHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHHHHHHHH
T ss_conf             847777789877643446789865378975899999999987299749988564589888999999999999