>cd04103 Centaurin_gamma Centaurin gamma. The centaurins (alpha, beta, gamma, and delta) are large, multi-domain proteins that all contain an ArfGAP domain and ankyrin repeats, and in some cases, numerous additional domains. Centaurin gamma contains an additional GTPase domain near its N-terminus. The specific function of this GTPase domain has not been well characterized, but centaurin gamma 2 (CENTG2) may play a role in the development of autism. Centaurin gamma 1 is also called PIKE (phosphatidyl inositol (PI) 3-kinase enhancer) and centaurin gamma 2 is also known as AGAP (ArfGAP protein with a GTPase-like domain, ankyrin repeats and a Pleckstrin homology domain) or GGAP. Three isoforms of PIKE have been identified. PIKE-S (short) and PIKE-L (long) are brain-specific isoforms, with PIKE-S restricted to the nucleus and PIKE-L found in multiple cellular compartments. A third isoform, PIKE-A was identified in human glioblastoma brain cancers and has been found in various tissues.

Probab=97.88 E-value=0.0001 Score=49.03 Aligned_cols=104 Identities=21% Similarity=0.262 Sum_probs=65.8 Q ss_pred EEEECCCCCCHHHHHHHHHHHCCCCCCCCEECCCCEECCCHHHHHHHCCCEEEEEEEEEECCCCCCCEEEEEEECCCCCC Q ss_conf 99986878897789999999808732142201795613780889870853764079999607778713899981798755 Q gi|254780264|r 13 FGIMAHIDAGKTTTTERILYYAGKSHKIGEVHDGSATMDWMEQEQERGITITSASTTVFWPGRDGGQKKLTIIDTPGHVD 92 (701) Q Consensus 13 v~iiaHvd~GKTTL~d~LL~~~g~i~~~g~v~~g~~~~D~~~~E~eRgITi~ss~~sl~~~~~~~~~~~iNlIDTPGH~D 92 (701) T Consensus 3 ivllGd~~VGKTsl~~Rf~~--~~F~~-----------~~~pt----~~~~~-~--~~~v---dg~~~~l~i~DTaG~~~ 59 (158) T cd04103 3 LGIVGNLQSGKSALVHRYLT--GSYVQ-----------LESPE----GGRFK-K--EVLV---DGQSHLLLIRDEGGAPD 59 (158) T ss_pred EEEECCCCCCHHHHHHHHHH--CCCCC-----------CCCCC----CCEEE-E--EEEE---CCEEEEEEEEECCCCCC T ss_conf 99999699879999999980--94787-----------44466----44179-9--9999---99999999995899834 Q ss_pred CHHHHHHHHHHHCEEEEEEECCCCCCHHH-HHHHHHHHH----CCCCEEEEECCCCC Q ss_conf 28999999986045699995588888347-999999987----39978999817676 Q gi|254780264|r 93 FTMEVERSIRVTDGAIALLDSNAGVEPQT-ETVWRQADK----YSVPRVIFCNKMDK 144 (701) Q Consensus 93 F~~Ev~~aL~~~DgailvVDa~eGv~~qT-~~vlr~~~~----~~lp~ilvINKiDr 144 (701) T Consensus 60 ~-----~~~~~ada~ilVydit~~~SF~~v~~~~~~i~~~~~~~~ipiilvGnK~dl 111 (158) T cd04103 60 A-----QFASWVDAVIFVFSLENEASFQTVYNLYHQLSSYRNISEIPLILVGTQDAI 111 (158) T ss_pred H-----HHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCC T ss_conf 3-----332149989999988988899999999999998559789968999877003

HHsearch alignment for GI: 254780264 and conserved domain: cd04103