>cd04154 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are members of the Arf family that bind GDP and GTP with very low affinity. Unlike most Arf family proteins, Arl2 is not myristoylated at its N-terminal helix. The protein PDE-delta, first identified in photoreceptor rod cells, binds specifically to Arl2 and is structurally very similar to RhoGDI. Despite the high structural similarity between Arl2 and Rho proteins and between PDE-delta and RhoGDI, the interactions between the GTPases and their effectors are very different. In its GTP bound form, Arl2 interacts with the protein Binder of Arl2 (BART), and the complex is believed to play a role in mitochondrial adenine nucleotide transport. In its GDP bound form, Arl2 interacts with tubulin- folding Cofactor D; this interaction is believed to play a role in regulation of microtubule dynamics that impact the cytoskeleton, cell division, and cytokinesis.

Probab=99.37 E-value=3.6e-11 Score=90.48 Aligned_cols=111 Identities=22% Similarity=0.206 Sum_probs=78.9 Q ss_pred EEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCEECCCCEECCCHHHHHHHCCCEEEEEEEEEECCCCCCCEEEEEEECCC Q ss_conf 52799986878897789999999808732142201795613780889870853764079999607778713899981798 Q gi|254780264|r 10 SRNFGIMAHIDAGKTTTTERILYYAGKSHKIGEVHDGSATMDWMEQEQERGITITSASTTVFWPGRDGGQKKLTIIDTPG 89 (701) Q Consensus 10 iRNv~iiaHvd~GKTTL~d~LL~~~g~i~~~g~v~~g~~~~D~~~~E~eRgITi~ss~~sl~~~~~~~~~~~iNlIDTPG 89 (701) T Consensus 14 ~~KililG~~~sGKTsll~~l~--~~~~~~---------~----------~pT~G~~~~~~~~~-----~~~l~iwD~~G 67 (173) T cd04154 14 EMRILILGLDNAGKTTILKKLL--GEDIDT---------I----------SPTLGFQIKTLEYE-----GYKLNIWDVGG 67 (173) T ss_pred CEEEEEECCCCCCHHHHHHHHC--CCCCCC---------C----------CCCCCEEEEEEEEC-----CEEEEEEECCC T ss_conf 3189999899978899999983--999897---------2----------67057778999989-----99999996688 Q ss_pred CCCCHHHHHHHHHHHCEEEEEEECCCCCCH-HHHHHHHHH----HHCCCCEEEEECCCCCCC Q ss_conf 755289999999860456999955888883-479999999----873997899981767658 Q gi|254780264|r 90 HVDFTMEVERSIRVTDGAIALLDSNAGVEP-QTETVWRQA----DKYSVPRVIFCNKMDKMG 146 (701) Q Consensus 90 H~DF~~Ev~~aL~~~DgailvVDa~eGv~~-qT~~vlr~~----~~~~lp~ilvINKiDr~~ 146 (701) T Consensus 68 ~e~~~~~~~~y~~~a~~ii~VvD~td~~~~~~~~~~l~~ll~~~~~~~~pili~~NK~Dl~~ 129 (173) T cd04154 68 QKTLRPYWRNYFESTDALIWVVDSSDRLRLDDCKRELKELLQEERLAGATLLILANKQDLPG 129 (173) T ss_pred CCCCCHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCC T ss_conf 60200589997226653899985565788999999999998635415984799987656777

HHsearch alignment for GI: 254780264 and conserved domain: cd04154