>cd04175 Rap1 Rap1 subgroup. The Rap1 subgroup is part of the Rap subfamily of the Ras family. It can be further divided into the Rap1a and Rap1b isoforms. In humans, Rap1a and Rap1b share 95% sequence homology, but are products of two different genes located on chromosomes 1 and 12, respectively. Rap1a is sometimes called smg p21 or Krev1 in the older literature. Rap1 proteins are believed to perform different cellular functions, depending on the isoform, its subcellular localization, and the effector proteins it binds. For example, in rat salivary gland, neutrophils, and platelets, Rap1 localizes to secretory granules and is believed to regulate exocytosis or the formation of secretory granules. Rap1 has also been shown to localize in the Golgi of rat fibroblasts, zymogen granules, plasma membrane, and the microsomal membrane of pancreatic acini, as well as in the endocytic compartment of skeletal muscle cells and fibroblasts. High expression of Rap1 has been observed in the n

Probab=98.62 E-value=8e-07 Score=62.55 Aligned_cols=110 Identities=23% Similarity=0.232 Sum_probs=75.1 Q ss_pred EEEEECCCCCCHHHHHHHHHHHCCCCCCCCEECCCCEECCCHHHHHHHCCCEEEEE-EEEEECCCCCCCEEEEEEECCCC Q ss_conf 79998687889778999999980873214220179561378088987085376407-99996077787138999817987 Q gi|254780264|r 12 NFGIMAHIDAGKTTTTERILYYAGKSHKIGEVHDGSATMDWMEQEQERGITITSAS-TTVFWPGRDGGQKKLTIIDTPGH 90 (701) Q Consensus 12 Nv~iiaHvd~GKTTL~d~LL~~~g~i~~~g~v~~g~~~~D~~~~E~eRgITi~ss~-~sl~~~~~~~~~~~iNlIDTPGH 90 (701) T Consensus 3 KIvllGd~~VGKTsli~r~~~--~~f~~--~------y~----------pTi~~~~~k~i~~---~~~~~~l~iwDtaG~ 59 (164) T cd04175 3 KLVVLGSGGVGKSALTVQFVQ--GIFVE--K------YD----------PTIEDSYRKQVEV---DGQQCMLEILDTAGT 59 (164) T ss_pred EEEEECCCCCCHHHHHHHHHH--CCCCC--C------CC----------CCEEEEEEEEEEE---CCEEEEEEECCCCCC T ss_conf 999989999759999999970--92886--5------68----------8404689999999---999999985147754 Q ss_pred CCCHHHHHHHHHHHCEEEEEEECCCCCCHHH-HHHHHHHH----HCCCCEEEEECCCCC Q ss_conf 5528999999986045699995588888347-99999998----739978999817676 Q gi|254780264|r 91 VDFTMEVERSIRVTDGAIALLDSNAGVEPQT-ETVWRQAD----KYSVPRVIFCNKMDK 144 (701) Q Consensus 91 ~DF~~Ev~~aL~~~DgailvVDa~eGv~~qT-~~vlr~~~----~~~lp~ilvINKiDr 144 (701) T Consensus 60 e~~~~l~~~y~~~a~~~ilvydvt~~~Sf~~~~~~~~~i~~~~~~~~~piilvgNK~DL 118 (164) T cd04175 60 EQFTAMRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKCDL 118 (164) T ss_pred HHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCC T ss_conf 32456788873578689999607877789999999999998628999639985214572

HHsearch alignment for GI: 254780264 and conserved domain: cd04175