>cd04177 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the Rap subfamily of the Ras family that is found in fungi. In budding yeasts, RSR1 is involved in selecting a site for bud growth on the cell cortex, which directs the establishment of cell polarization. The Rho family GTPase cdc42 and its GEF, cdc24, then establish an axis of polarized growth by organizing the actin cytoskeleton and secretory apparatus at the bud site. It is believed that cdc42 interacts directly with RSR1 in vivo. In filamentous fungi, polar growth occurs at the tips of hypha and at novel growth sites along the extending hypha. In Ashbya gossypii, RSR1 is a key regulator of hyphal growth, localizing at the tip region and regulating in apical polarization of the actin cytoskeleton. Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key featu

Probab=98.61 E-value=1.6e-07 Score=67.06 Aligned_cols=111 Identities=23% Similarity=0.228 Sum_probs=74.8 Q ss_pred EEEEECCCCCCHHHHHHHHHHHCCCCCCCCEECCCCEECCCHHHHHHHCCCEEEEEEEEEECCCCCCCEEEEEEECCCCC Q ss_conf 79998687889778999999980873214220179561378088987085376407999960777871389998179875 Q gi|254780264|r 12 NFGIMAHIDAGKTTTTERILYYAGKSHKIGEVHDGSATMDWMEQEQERGITITSASTTVFWPGRDGGQKKLTIIDTPGHV 91 (701) Q Consensus 12 Nv~iiaHvd~GKTTL~d~LL~~~g~i~~~g~v~~g~~~~D~~~~E~eRgITi~ss~~sl~~~~~~~~~~~iNlIDTPGH~ 91 (701) T Consensus 3 KivlvGd~~VGKTsli~rf~~--~~f~~--------~y~pTi~~------~~-~k~--i~i---~~~~~~l~iwDtaG~e 60 (168) T cd04177 3 KIVVLGAGGVGKSALTVQFVQ--NVFIE--------SYDPTIED------SY-RKQ--VEI---DGRQCDLEILDTAGTE 60 (168) T ss_pred EEEEECCCCCCHHHHHHHHHH--CCCCC--------CCCCCCCC------EE-EEE--EEE---CCEEEEEEEEECCCCC T ss_conf 999989999779999999961--93898--------65883331------59-999--999---9999999998278862 Q ss_pred CCHHHHHHHHHHHCEEEEEEECCCCCCHHH-HHHHHHHH----HCCCCEEEEECCCCC Q ss_conf 528999999986045699995588888347-99999998----739978999817676 Q gi|254780264|r 92 DFTMEVERSIRVTDGAIALLDSNAGVEPQT-ETVWRQAD----KYSVPRVIFCNKMDK 144 (701) Q Consensus 92 DF~~Ev~~aL~~~DgailvVDa~eGv~~qT-~~vlr~~~----~~~lp~ilvINKiDr 144 (701) T Consensus 61 ~~~~~~~~~~~~a~~~ilvydvt~~~Sf~~~~~~~~~i~~~~~~~~~piilvgNK~DL 118 (168) T cd04177 61 QFTAMRELYIKSGQGFLLVYSVTSEASLNELGELREQVLRIKDSDNVPMVLVGNKADL 118 (168) T ss_pred CCCCCHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCH T ss_conf 3334515451268667985368988899999999999998517888748988731461

HHsearch alignment for GI: 254780264 and conserved domain: cd04177