BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780266|ref|YP_003064679.1| 30S ribosomal protein S12 [Candidatus Liberibacter asiaticus str. psy62] (124 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780266|ref|YP_003064679.1| 30S ribosomal protein S12 [Candidatus Liberibacter asiaticus str. psy62] Length = 124 Score = 249 bits (635), Expect = 1e-68, Method: Compositional matrix adjust. Identities = 124/124 (100%), Positives = 124/124 (100%) Query: 1 MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60 MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS Sbjct: 1 MPTVNQLIRKPRKGSFRACAKVTALRGNPQKRGVCLRVYTVTPKKPNSALRKVIKARLTS 60 Query: 61 GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120 GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA Sbjct: 61 GVEVIAYVPGEGHNLQEHSVVMLCGGRVKDLPGVKYRVIRGVLDAQGVKNRKQARSRYGA 120 Query: 121 ERPK 124 ERPK Sbjct: 121 ERPK 124 >gi|254780808|ref|YP_003065221.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Candidatus Liberibacter asiaticus str. psy62] Length = 626 Score = 25.0 bits (53), Expect = 0.48, Method: Composition-based stats. Identities = 11/30 (36%), Positives = 19/30 (63%) Query: 70 GEGHNLQEHSVVMLCGGRVKDLPGVKYRVI 99 G+GH ++E + GRV D G+++RV+ Sbjct: 54 GKGHLVREIDALDGLMGRVADAAGIQFRVL 83 >gi|254780701|ref|YP_003065114.1| putative two-component sensor histidine kinase transcriptional regulatory protein [Candidatus Liberibacter asiaticus str. psy62] Length = 495 Score = 23.9 bits (50), Expect = 1.1, Method: Composition-based stats. Identities = 9/17 (52%), Positives = 14/17 (82%) Query: 53 VIKARLTSGVEVIAYVP 69 +I+++L GVEVIA +P Sbjct: 457 LIRSKLREGVEVIAILP 473 >gi|254780784|ref|YP_003065197.1| polynucleotide phosphorylase/polyadenylase [Candidatus Liberibacter asiaticus str. psy62] Length = 699 Score = 21.6 bits (44), Expect = 5.5, Method: Composition-based stats. Identities = 7/23 (30%), Positives = 17/23 (73%) Query: 87 RVKDLPGVKYRVIRGVLDAQGVK 109 +++++ G+ +VIRG+++ G K Sbjct: 562 QIRNVIGMGGKVIRGIVEQTGAK 584 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.320 0.136 0.400 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,829 Number of Sequences: 1233 Number of extensions: 2483 Number of successful extensions: 11 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 7 length of query: 124 length of database: 328,796 effective HSP length: 64 effective length of query: 60 effective length of database: 249,884 effective search space: 14993040 effective search space used: 14993040 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 33 (17.3 bits)