>TIGR00531 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier protein; InterPro: IPR001249 The proteins in this family are a component of the acetyl coenzyme A carboxylase complex (6.4.1.2 from EC) and are involved in the first step in long-chain fatty acid synthesis. In plants this is usually located in the chloroplast. In the first step, biotin carboxylase catalyses the carboxylation of the carrier protein to form an intermediate. Next, the transcarboxylase complex transfers the carboxyl group from the intermediate to acetyl-CoA forming malonyl-CoA. This protein functions in the transfer of CO_2 from one site to another, the biotin binding site locates to the C-terminal of this protein. The biotin is specifically attached to a lysine residue in the sequence AMKM. The structure of the C-terminal domain of the biotin carboxyl carrier (BCC) protein was shown to be a flattened beta-barrel structure comprising two four-stranded beta sheets interrupted by a structural loop forming a thumb structure. The biotinyl-lysine is located on a tight beta-turn on the opposite end of the molecule. The thumb structure has been shown to attached biotin, thus stabilising the structure. ; GO: 0003989 acetyl-CoA carboxylase activity, 0006633 fatty acid biosynthetic process, 0009317 acetyl-CoA carboxylase complex.

Probab=99.97 E-value=1.1e-31 Score=212.91 Aligned_cols=159 Identities=33% Similarity=0.537 Sum_probs=125.1 Q ss_pred CCCHHHHHHHHHHHHHCCCEEEEEEECCEEEEEECCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC Q ss_conf 13989999999999865970899950996999970677652113320234445542223322112234444454433345 Q gi|254780267|r 7 KINLTLIRNLANILNETNLTEVEIDNDGMRIRLLRSPQKDTVTNYYSEDNKNNHSLVGFPPSSTIDNTPPESDLIPLLSP 86 (171) Q Consensus 7 ~mdi~~Ik~Li~~~~es~l~eleie~~~~kI~I~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 86 (171) T Consensus 1 ~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~-~p~~~~~~~~p~~~~ 79 (159) T TIGR00531 1 ALNIREIKELIKLIEESGITELELKEEEFELRLSKAAPAAGKSAVQPAAAPVPAPVPAAVPPAA-VPAPAPAAPAPPPAD 79 (159) T ss_pred CCCHHHHHHHHHHHHHCCCCEEEEECCCEEEEEECCCCCCCHHHCCCCCCCCCCCHHHHCCCCC-CCCCCCCCCCCCCCC T ss_conf 9646789999876520585204652475168872211100000001112553100011103110-343211246764110 Q ss_pred CCCCEEEECCCEEEEEECCCCCCCEECCCCCEEECCEEEEEECCCEEEEEECCCCCEEEEEECCCCCCCCCCCEEEEEEE Q ss_conf 46626870462567740367641000124420104348999737726899989981999998489868369972999953 Q gi|254780267|r 87 DNYHTVTSPMVGTAYLASSPGSDPFVNKGNLVVEGQTLLIIEAMKTMNHIVAPCSGKVQDINVKDGQSVEYGDALLVLEK 166 (171) Q Consensus 87 ~~~~~I~SPmvGtfy~~psP~~~~~V~vGd~Vk~G~~l~iiEAMKm~n~I~a~~~G~I~~i~v~~G~~V~~gq~L~~i~~ 166 (171) T Consensus 80 ~~~~~~~~p~~gtfy~~p~p~~~p~~~~g~~~~~g~~~c~~ea~k~~n~~e~~~~g~~~~~~~~~g~~~e~g~~l~~~~~ 159 (159) T TIGR00531 80 EKGHLVRSPMVGTFYRAPSPDAKPFVEVGDKVNKGDGVCIVEAMKLMNEIEAEVAGEVVEILVEDGQPVEYGEPLILIEP 159 (159) T ss_pred CCCCEEECCCCCCEECCCCCCCCCEEEECCEECCCCEEEHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCEEEEEEC T ss_conf 23301004421100027888866402105500246332012455565442002465378997428850103862467619

HHsearch alignment for GI: 254780267 and conserved domain: TIGR00531