HHsearch alignment for GI: 254780267 and conserved domain: cd06250

>cd06250 M14_PaAOTO_like An uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the the M14 family of metallocarboxypeptidases. This subgroup includes Pseudomonas aeruginosa AotO and related proteins. ASTE catalyzes the fifth and last step in arginine catabolism by the arginine succinyltransferase pathway, and aspartoacylase (ASPA, also known as aminoacylase 2, and ACY-2; EC:3.5.1.15) cleaves N-acetyl L-aspartic acid (NAA) into aspartate and acetate. NAA is abundant in the brain, and hydrolysis of NAA by ASPA may help maintain white matter. ASPA is an NAA scavenger in other tissues. Mutations in the gene encoding ASPA cause Canavan disease (CD), a fatal progressive neurodegenerative disorder involving dysmyelination and spongiform degeneration of white matter in children. This enzyme binds zinc which is necessary for activity. Measurement of elevated NAA levels in urine is used in the diagnosis of CD. The gene encoding
Probab=97.56  E-value=0.00079  Score=43.65  Aligned_cols=68  Identities=22%  Similarity=0.182  Sum_probs=53.1

Q ss_pred             CCCCEEEECCCEEEEEECCCCCCCEECCCCCEEECCEEEEEECC-C---EEEEEECCCCCEEEEEECCCCCCCCCCCEEE
Q ss_conf             46626870462567740367641000124420104348999737-7---2689998998199999848986836997299
Q gi|254780267|r   87 DNYHTVTSPMVGTAYLASSPGSDPFVNKGNLVVEGQTLLIIEAM-K---TMNHIVAPCSGKVQDINVKDGQSVEYGDALL  162 (171)
Q Consensus        87 ~~~~~I~SPmvGtfy~~psP~~~~~V~vGd~Vk~G~~l~iiEAM-K---m~n~I~a~~~G~I~~i~v~~G~~V~~gq~L~  162 (171)
T Consensus       287 ~~~~~v~Ap~~Gi~~--------~~~~~G~~V~~G~~la~I~dP~~~~~~~~~i~Ap~~Gii~~~~~--~p~V~~G~~l~  356 (359)
T cd06250         287 AGVEMLYAPAGGMVV--------YRAAPGDWVEAGDVLAEILDPLGDGVGPVEIRAPTDGLLFARAS--RRFVRAGDELA  356 (359)
T ss_pred             CCCEEEECCCCEEEE--------ECCCCCCEECCCCEEEEEECCCCCCCCEEEEECCCCCEEEEEEC--CCCCCCCCCEE
T ss_conf             366799569986898--------72799999779998999948999987548997599949998523--86067898046


Q ss_pred             EE
Q ss_conf             99
Q gi|254780267|r  163 VL  164 (171)
Q Consensus       163 ~i  164 (171)
T Consensus       357 ~I  358 (359)
T cd06250         357 KI  358 (359)
T ss_pred             EE
T ss_conf             61