HHsearch results for GI: 254780267 and protein with PDBid: 1f3z_A

>1f3z_A EIIA-GLC, glucose-specific phosphocarrier; phosphotransferase, signal transduction, sugar transport; 1.98A {Escherichia coli} SCOP: b.84.3.1 PDB: 1f3g_A 1ggr_A 1gla_F 1glb_F* 1glc_F* 1gld_F* 1gle_F* 1o2f_A 2f3g_A
Probab=97.35  E-value=0.00031  Score=44.80  Aligned_cols=57  Identities=19%  Similarity=0.376  Sum_probs=39.4

Q ss_pred             CCEECCCCCEEECCEEEEEEC-------CCEEEEEECCCCCEEEEEECCCCCCCCCCC-EEEEEEE
Q ss_conf             100012442010434899973-------772689998998199999848986836997-2999953
Q gi|254780267|r  109 DPFVNKGNLVVEGQTLLIIEA-------MKTMNHIVAPCSGKVQDINVKDGQSVEYGD-ALLVLEK  166 (171)
Q Consensus       109 ~~~V~vGd~Vk~G~~l~iiEA-------MKm~n~I~a~~~G~I~~i~v~~G~~V~~gq-~L~~i~~  166 (171)
                      +.+|+.||+|++||.|+-+.-       --+..+|.-........++...| .|..|+ +||+|++
T Consensus        97 ~~~vk~Gd~V~~G~~L~~~D~~~i~~~g~~~~t~vvv~n~~~~~~~~~~~~-~v~~g~~~l~~i~k  161 (161)
T 1f3z_A           97 KRIAEEGQRVKVGDTVIEFDLPLLEEKAKSTLTPVVISNMDEIKELIKLSG-SVTVGETPVIRIKK  161 (161)
T ss_dssp             EECSCTTCEECTTCEEEEECHHHHHHHCSBCCEEEEESCGGGCSEEEECCS-EECTTTSEEEEEEC
T ss_pred             EEEECCCCEEECCCEEEEECHHHHHHCCCCCCEEEEEECCHHCCEEEECCC-CEEECCCEEEEEEC
T ss_conf             899768999938989899879999861999825999976566031462478-58629927999989