PSIBLAST alignment of GI: 254780267 and protein with PDB id: 3hbl

>gi|242556622|pdb|3HBL|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase T908a Mutant Length = 1150
>gi|242556623|pdb|3HBL|B Chain B, Crystal Structure Of S. Aureus Pyruvate Carboxylase T908a Mutant Length = 1150
 Score = 67.6 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 32/142 (22%), Positives = 56/142 (39%), Gaps = 7/142 (4%)

Query: 28   VEIDNDGMRIRLLRSPQKDTVTNYYSEDNKNNHSLVGFPPSSTIDNTPPESDLIPLLSPD 87
            VEI+ D  +  +++           +       +          +N    +++ P     
Sbjct: 1016 VEIEIDKGKRLIIKLETISEPDENGNRTIYYAMNGQARRIYIKDENVHTNANVKPKADKS 1075

Query: 88   NYHTVTSPMVGTAYLASSPGSDPFVNKGNLVVEGQTLLIIEAMKTMNHIVAPCSGKVQDI 147
            N   + + M G+         +  V+ G  V   Q LLI EAMK    I AP  G ++ +
Sbjct: 1076 NPSHIGAQMPGSVT-------EVKVSVGETVKANQPLLITEAMKMETTIQAPFDGVIKQV 1128

Query: 148  NVKDGQSVEYGDALLVLEKTGD 169
             V +G ++  GD L+ +EK  D
Sbjct: 1129 TVNNGDTIATGDLLIEIEKATD 1150