HHSEARCH alignment of GI: 254780269 and SCOP domain: d1ne9a2

Alignment
>d1ne9a2 d.108.1.4 (A:165-335) Peptidyltransferase FemX {Weissella viridescens [TaxId: 1629]}
Probab=96.59  E-value=0.026  Score=32.79  Aligned_cols=128  Identities=10%  Similarity=0.088  Sum_probs=79.0

Q ss_pred             HHHHHHHHCCCCEEEECCC---HHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEEEECCCEEEEEEEEEEC
Q ss_conf             4577652158816876698---8999999850266889987269999999999864982699996537201211023205
Q gi|254780269|r   30 KRLKKYIRRELYDIRINTA---FESVISACAQKTQKRPTTWINMTIQKAYIDLFYMGYAHTIEAWKKDVLVGGLYGVSLG  106 (179)
Q Consensus        30 rsLrk~lrk~~~~itin~~---F~~VI~~Ca~~r~~~~~TWI~~~i~~aY~~Lh~~G~aHSvE~w~~~~LvGGlyGv~iG  106 (179)
                      +.+||..| ...+|.....   ++...+..........-+..+.+..+...+....+...-+.+..+|++|+|..-+..|
T Consensus         7 ~~Irka~k-~gv~i~~~~~~e~~~~f~~l~~~~~~r~g~~~~~~~~~~~l~~~~~~~~~~l~~~~~~g~~va~~l~~~~~   85 (171)
T d1ne9a2           7 SKIKRPFR-DGVEVHSGNSATELDEFFKTYTTMAERHGITHRPIEYFQRMQAAFDADTMRIFVAEREGKLLSTGIALKYG   85 (171)
T ss_dssp             HHHHHHHH-TTEEEEEECSHHHHHHHHHHHHHHHHHTTCCCCCHHHHHHHHHHSCTTTEEEEEEEETTEEEEEEEEEEET
T ss_pred             HHHHHHHH-CCCEEEECCCHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHCCCCEEEEEEEEECCEEEEEEEEEEEC
T ss_conf             99999998-79889986998999999999999851446788897999999874378839999997299079999999987


Q ss_pred             CC---EEEEEEEEECCCHHHHHHHHHHHHHHHCCCEEEEECC-----CCH----HHHHCCCEEE
Q ss_conf             72---1200344525768999999999999968973999075-----893----4771197983
Q gi|254780269|r  107 AV---FFGESMFSHMENASKICLTHLVKHLKKRQFLLLDIQF-----ITN----HLRQFGAIEI  158 (179)
Q Consensus       107 ~~---F~GESMFs~~~nASKiAl~~L~~~l~~~g~~liD~Q~-----~t~----HL~slGa~~i  158 (179)
                      ..   ++|-|.-.....||..-++...++++.+|+..+|-.=     .+|    -..+||+..+
T Consensus        86 ~~~~y~~~a~~~~~~~~~~~~L~~~~i~~~~~~G~~~~D~gG~~~~~~~~gl~~FK~~fgg~~~  149 (171)
T d1ne9a2          86 RKIWYMYAGSMDGNTYYAPYAVQSEMIQWALDTNTDLYDLGGIESESTDDSLYVFKHVFVKDAP  149 (171)
T ss_dssp             TEEEEEEEEECSSCCTTHHHHHHHHHHHHHHHTTCSEEEEEECSCSSTTCHHHHHHHHHCCSCC
T ss_pred             CEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCHHHHHHHCCCCCCC
T ss_conf             8799997320444322427899999999999829819995798788888478998656599975


SCOP domain information

class: Alpha and beta proteins (a+b)
fold: Acyl-CoA N-acyltransferases (Nat)
superfamily: Acyl-CoA N-acyltransferases (Nat)
family: FemXAB nonribosomal peptidyltransferases
domain: Peptidyltransferase FemX
species: Weissella viridescens [TaxId: 1629]